Symbol:
Angptl3
Name:
angiopoietin like 3
RGD ID:
9032997
Description:
ENCODES a protein that exhibits enzyme inhibitor activity (ortholog); growth factor activity (ortholog); integrin binding (ortholog); INVOLVED IN acylglycerol homeostasis (ortholog); artery morphogenesis (ortholog); cell-matrix adhesion (ortholog); PARTICIPATES IN lipid metabolic pathway; ASSOCIATED WITH congenital disorder of glycosylation It (ortholog); developmental and epileptic encephalopathy 23 (ortholog); Experimental Diabetes Mellitus (ortholog); FOUND IN cell surface (ortholog); early endosome (ortholog); extracellular space (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
angiopoietin-like 3; angiopoietin-related protein 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
ChiLan1.0 - Chinchilla ChiLan1.0 Assembly
Position:
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955423 27,109,962 - 27,121,276 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955423 27,113,378 - 27,121,339 (-) NCBI ChiLan1.0 ChiLan1.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Angptl3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955423 27,109,962 - 27,121,276 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955423 27,113,378 - 27,121,339 (-) NCBI ChiLan1.0 ChiLan1.0
ANGPTL3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 62,597,520 - 62,606,313 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 62,597,520 - 62,606,313 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 63,063,191 - 63,071,984 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 62,835,775 - 62,843,768 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 62,775,207 - 62,783,201 NCBI Celera 1 61,352,392 - 61,360,385 (+) NCBI Celera Cytogenetic Map 1 p31.3 NCBI HuRef 1 61,175,226 - 61,184,044 (+) NCBI HuRef CHM1_1 1 63,178,532 - 63,187,341 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 62,476,065 - 62,484,858 (+) NCBI T2T-CHM13v2.0
Angptl3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 98,919,191 - 98,926,429 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 98,919,191 - 98,934,348 (+) Ensembl GRCm39 Ensembl GRCm38 4 99,030,954 - 99,038,192 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 99,030,954 - 99,046,111 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 98,697,646 - 98,704,879 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 98,523,006 - 98,530,045 (+) NCBI MGSCv36 mm8 Celera 4 97,401,867 - 97,409,102 (+) NCBI Celera Cytogenetic Map 4 C6 NCBI cM Map 4 45.6 NCBI
Angptl3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 118,818,494 - 118,825,531 (+) NCBI GRCr8 mRatBN7.2 5 113,703,007 - 113,710,044 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 113,703,012 - 113,709,957 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 116,277,032 - 116,284,068 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 118,002,370 - 118,009,406 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 118,064,903 - 118,071,939 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 117,698,590 - 117,706,729 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 117,698,764 - 117,705,808 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 121,639,555 - 121,647,526 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 119,479,669 - 119,484,358 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 112,263,891 - 112,268,719 (+) NCBI Celera Cytogenetic Map 5 q33 NCBI
ANGPTL3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 164,233,352 - 164,254,549 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 163,393,857 - 163,403,865 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 61,855,870 - 61,863,476 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 63,670,516 - 63,679,194 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 63,670,516 - 63,679,194 (+) Ensembl panpan1.1 panPan2
ANGPTL3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 47,524,390 - 47,532,931 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 47,525,365 - 47,532,899 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 47,585,756 - 47,594,294 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 47,709,313 - 47,717,848 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 47,709,323 - 47,717,810 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 47,663,840 - 47,672,380 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 47,609,996 - 47,618,532 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 47,872,446 - 47,880,983 (-) NCBI UU_Cfam_GSD_1.0
Angptl3
ANGPTL3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 149,832,542 - 149,845,831 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 149,836,417 - 149,845,854 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 138,100,831 - 138,111,284 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ANGPTL3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 70,452,771 - 70,461,590 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 70,449,227 - 70,460,469 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 46,993,590 - 47,002,411 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Angptl3
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSCLAT00000017349 ⟹ ENSCLAP00000017180
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 Ensembl NW_004955423 27,109,962 - 27,121,276 (-) Ensembl
RefSeq Acc Id:
XM_005385334 ⟹ XP_005385391
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955423 27,113,378 - 27,121,339 (-) NCBI
Sequence:
GTCTAGGTCTACTTATAGGAGAAAATTATTCAAAATTCCCTGAAACTGAATAATTAGGAAAAAATGTACACAATTAAGCTCTTTCTCATTATTGTTCCTCTAGTTCTTTCTTCCAGGGCTAATCAAGG
hide sequence
RefSeq Acc Id:
XP_005385391 ⟸ XM_005385334
- UniProtKB:
A0A8C2VN29 (UniProtKB/TrEMBL)
- Sequence:
MYTIKLFLIIVPLVLSSRANQGNLSSDSKPSEPKPKFANLEEVKLIANGLLQLGHSLKDLAHKTKSEMNDIFKKLNIFDQSFYDLSLQTNEIKKEEKELRRTTSKLQVKNEEVKNMSLQLNLKLESLL
hide sequence
Ensembl Acc Id:
ENSCLAP00000017180 ⟸ ENSCLAT00000017349
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-16
Angptl3
angiopoietin like 3
angiopoietin-like 3
Symbol and/or name change
5135510 APPROVED
