Symbol:
Slc35b3
Name:
solute carrier family 35 member B3
RGD ID:
9030185
Description:
ENCODES a protein that exhibits 3'-phosphoadenosine 5'-phosphosulfate transmembrane transporter activity (ortholog); INVOLVED IN 5'-adenylyl sulfate transmembrane transport (ortholog); peptidyl-tyrosine sulfation (ortholog); FOUND IN Golgi membrane (ortholog); trans-Golgi network (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
adenosine 3'-phospho 5'-phosphosulfate transporter 2; solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
ChiLan1.0 - Chinchilla ChiLan1.0 Assembly
Position:
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955465 5,599,728 - 5,621,031 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955465 5,599,728 - 5,621,031 (+) NCBI ChiLan1.0 ChiLan1.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Slc35b3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955465 5,599,728 - 5,621,031 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955465 5,599,728 - 5,621,031 (+) NCBI ChiLan1.0 ChiLan1.0
SLC35B3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 8,411,435 - 8,435,567 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 8,411,435 - 8,435,561 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 8,411,668 - 8,435,800 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 8,358,306 - 8,380,624 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 8,358,305 - 8,380,624 NCBI Celera 6 9,642,577 - 9,665,073 (-) NCBI Celera Cytogenetic Map 6 p24.3 NCBI HuRef 6 8,290,537 - 8,313,030 (-) NCBI HuRef CHM1_1 6 8,415,413 - 8,437,924 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 8,280,719 - 8,304,851 (-) NCBI T2T-CHM13v2.0
Slc35b3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 39,116,112 - 39,144,855 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 39,116,112 - 39,144,851 (-) Ensembl GRCm39 Ensembl GRCm38 13 38,932,132 - 38,960,879 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 38,932,136 - 38,960,875 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 39,024,009 - 39,052,744 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 38,939,606 - 38,967,998 (-) NCBI MGSCv36 mm8 Celera 13 40,055,504 - 40,084,226 (-) NCBI Celera Cytogenetic Map 13 A3.3 NCBI cM Map 13 18.61 NCBI
Slc35b3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 26,052,249 - 26,078,686 (+) NCBI GRCr8 mRatBN7.2 17 25,846,590 - 25,873,115 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 25,846,748 - 25,872,557 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 25,714,852 - 25,741,043 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 27,318,430 - 27,344,622 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 25,662,913 - 25,689,103 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 26,478,777 - 26,505,225 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 26,478,315 - 26,504,738 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 28,399,829 - 28,427,084 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 31,910,886 - 31,938,409 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 31,913,843 - 31,940,009 (+) NCBI Celera 17 25,490,154 - 25,516,553 (+) NCBI Celera Cytogenetic Map 17 p12 NCBI
SLC35B3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 23,057,723 - 23,080,233 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 19,050,892 - 19,073,435 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 8,251,564 - 8,274,077 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 8,536,041 - 8,558,547 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 8,536,041 - 8,558,512 (-) Ensembl panpan1.1 panPan2
SLC35B3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 35 8,306,661 - 8,332,882 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 35 8,306,886 - 8,332,293 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 35 8,314,450 - 8,340,716 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 35 8,395,435 - 8,421,508 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 35 8,395,436 - 8,420,906 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 35 8,237,161 - 8,263,238 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 35 8,280,130 - 8,306,416 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 35 9,606,460 - 9,632,662 (-) NCBI UU_Cfam_GSD_1.0
Slc35b3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 15,950,529 - 15,973,175 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936534 4,220,274 - 4,242,314 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936534 4,219,557 - 4,242,152 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLC35B3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 5,579,152 - 5,606,531 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 5,577,410 - 5,606,575 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 5,785,506 - 5,810,271 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC35B3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 63,719,442 - 63,744,216 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 63,720,612 - 63,744,258 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 8,411,428 - 8,436,207 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Slc35b3
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSCLAT00000009770 ⟹ ENSCLAP00000009641
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 Ensembl NW_004955465 5,599,728 - 5,621,031 (+) Ensembl
RefSeq Acc Id:
XM_005398841 ⟹ XP_005398898
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955465 5,599,774 - 5,621,031 (+) NCBI
Sequence:
GGCGCCGGCTCTGCGAACACCTTCTGGCGGGGCCCACTGCGGCTGCGGAAAGTGCGGGAGGAAGAGAGGAGGAAGAGGCAGAGGAAGAGGAGAACTTGGCCGAGCAAGAAGCAGAAGAAAGACTGAAT
hide sequence
RefSeq Acc Id:
XM_005398842 ⟹ XP_005398899
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955465 5,599,728 - 5,621,031 (+) NCBI
Sequence:
GCGCCTGCGCACGCGCCTCAGGACACATAAGCGGAAGTGGCGCGCCGGCGCCGGCTCTGCGAACACCTTCTGGCGGGGCCCACTGCGGCTGCGGAAAGTGCGGGAGGAAGAGAGGAGGAAGAGGCAGA
hide sequence
RefSeq Acc Id:
XM_005398843 ⟹ XP_005398900
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955465 5,599,766 - 5,621,031 (+) NCBI
Sequence:
GGCGCGCCGGCGCCGGCTCTGCGAACACCTTCTGGCGGGGCCCACTGCGGCTGCGGAAAGTGCGGGAGGAAGAGAGGAGGAAGAGGCAGAGGAAGAGGAGAACTTGGCCGAGCAAGAAGCAGAAGAAA
hide sequence
RefSeq Acc Id:
XP_005398899 ⟸ XM_005398842
- Peptide Label:
isoform X2
- UniProtKB:
A0A8C2V6S3 (UniProtKB/TrEMBL)
- Sequence:
MDLKFNNSRKYISISVPSKTQTMSPHIKSVDDIVVLGINLSKFSKLTQFFICVAGVFVFYLIYGYLQELIFSMEGFKPYGWYLTLMQFAFYSIFGLIELQLIQDKRRRIPGKTYMIIAFLTVGTMGLS
hide sequence
RefSeq Acc Id:
XP_005398900 ⟸ XM_005398843
- Peptide Label:
isoform X2
- UniProtKB:
A0A8C2V6S3 (UniProtKB/TrEMBL)
- Sequence:
MDLKFNNSRKYISISVPSKTQTMSPHIKSVDDIVVLGINLSKFSKLTQFFICVAGVFVFYLIYGYLQELIFSMEGFKPYGWYLTLMQFAFYSIFGLIELQLIQDKRRRIPGKTYMIIAFLTVGTMGLS
hide sequence
RefSeq Acc Id:
XP_005398898 ⟸ XM_005398841
- Peptide Label:
isoform X1
- Sequence:
MQQNKNNGPQVQQLQEIHLYQCAIQNPNNVATHQELIFSMEGFKPYGWYLTLMQFAFYSIFGLIELQLIQDKRRRIPGKTYMIIAFLTVGTMGLSNTSLGYLNYPTQVIFKCCKLIPVMVGGVFIQGK
hide sequence
Ensembl Acc Id:
ENSCLAP00000009641 ⟸ ENSCLAT00000009770
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-03
Slc35b3
solute carrier family 35 member B3
solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B3
Symbol and/or name change
5135510 APPROVED
