Symbol:
Galnt3
Name:
polypeptide N-acetylgalactosaminyltransferase 3
RGD ID:
9009673
Description:
ENCODES a protein that exhibits calcium ion binding (ortholog); manganese ion binding (ortholog); polypeptide N-acetylgalactosaminyltransferase activity (ortholog); INVOLVED IN apoptotic process (ortholog); cell maturation (ortholog); chondrocyte development (ortholog); ASSOCIATED WITH asphyxiating thoracic dystrophy (ortholog); asphyxiating thoracic dystrophy 1 (ortholog); benign familial infantile seizures 3 (ortholog); FOUND IN Golgi apparatus (ortholog); perinuclear region of cytoplasm (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
ChiLan1.0 - Chinchilla ChiLan1.0 Assembly
Position:
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955449 8,379,164 - 8,406,988 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955449 8,365,951 - 8,406,988 (+) NCBI ChiLan1.0 ChiLan1.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Galnt3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955449 8,379,164 - 8,406,988 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955449 8,365,951 - 8,406,988 (+) NCBI ChiLan1.0 ChiLan1.0
GALNT3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 165,747,588 - 165,794,692 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 165,747,588 - 165,846,201 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 166,604,098 - 166,650,757 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 166,312,559 - 166,359,049 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 166,428,830 - 166,452,717 NCBI Celera 2 160,214,267 - 160,260,749 (-) NCBI Celera Cytogenetic Map 2 q24.3 NCBI HuRef 2 158,486,232 - 158,532,744 (-) NCBI HuRef CHM1_1 2 166,610,616 - 166,657,104 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 166,204,962 - 166,251,751 (-) NCBI T2T-CHM13v2.0
Galnt3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 65,913,110 - 65,955,217 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 65,913,110 - 65,955,338 (-) Ensembl GRCm39 Ensembl GRCm38 2 66,082,766 - 66,125,056 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 66,082,766 - 66,124,994 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 65,920,823 - 65,962,850 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 65,884,272 - 65,934,377 (-) NCBI MGSCv36 mm8 Celera 2 67,762,030 - 67,803,898 (-) NCBI Celera Cytogenetic Map 2 C1.3 NCBI cM Map 2 38.99 NCBI
Galnt3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 71,150,559 - 71,187,321 (-) NCBI GRCr8 mRatBN7.2 3 50,742,500 - 50,779,266 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 50,742,512 - 50,766,268 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 54,085,866 - 54,109,634 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 62,669,491 - 62,693,259 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 60,445,630 - 60,469,408 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 52,174,469 - 52,212,395 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 52,175,547 - 52,212,412 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 58,806,436 - 58,843,496 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 48,026,128 - 48,049,883 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 47,923,236 - 47,946,144 (-) NCBI Celera 3 50,332,309 - 50,356,022 (-) NCBI Celera Cytogenetic Map 3 q21 NCBI
GALNT3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 68,400,623 - 68,447,618 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 68,413,360 - 68,467,548 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 53,014,933 - 53,066,330 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 170,492,482 - 170,539,231 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 170,335,216 - 170,539,231 (-) Ensembl panpan1.1 panPan2
GALNT3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 36 10,895,366 - 10,990,848 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 36 10,896,128 - 10,919,000 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 36 11,040,139 - 11,084,227 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 36 11,029,831 - 11,074,091 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 36 11,030,584 - 11,124,756 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 36 11,111,447 - 11,155,527 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 36 11,084,131 - 11,128,392 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 36 11,196,286 - 11,240,452 (-) NCBI UU_Cfam_GSD_1.0
Galnt3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 128,040,946 - 128,145,958 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936469 13,538,258 - 13,576,657 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936469 13,538,349 - 13,576,608 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GALNT3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 72,293,614 - 72,342,435 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 72,276,502 - 72,343,524 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 80,794,975 - 80,818,272 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GALNT3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 51,237,150 - 51,284,301 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 51,236,756 - 51,259,062 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 148,228,855 - 148,279,748 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Galnt3
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSCLAT00000005610 ⟹ ENSCLAP00000005509
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 Ensembl NW_004955449 8,379,164 - 8,406,988 (+) Ensembl
RefSeq Acc Id:
XM_005393291 ⟹ XP_005393348
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955449 8,365,951 - 8,406,988 (+) NCBI
Sequence:
TCTCTGGGAGAGGGAGGCGCTCCTTTGGACGTGAGGCGCCTCTGCCAGAGCTGCGCGCACAGAAACGGAAACCACTGGCTGCTCTGAAGTATCATTTAAAGAAACTTTCTTACCAGCAAACCTATGAT
hide sequence
RefSeq Acc Id:
XM_013518790 ⟹ XP_013374244
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955449 8,379,164 - 8,406,988 (+) NCBI
Sequence:
AGAGAACTGGCCTTCACTGGGACTCAGGCTGTGCTCGGCATCCTGGGTAGCTTGTCCTGCTCATGGTGGTTCGGACTGTGTTCTTAAGGTCAAAGCGGGAGGTATCATTTAAAGAAACTTTCTTACCA
hide sequence
RefSeq Acc Id:
XP_005393348 ⟸ XM_005393291
- UniProtKB:
A0A8C2UZQ0 (UniProtKB/TrEMBL)
- Sequence:
MAHLKRLVKLHFKRLCHKKFWKLGGVIFFFILILILMQREVNVQFSKEESRMERNLKNKNKVFDLMLEAVNNIKDVMPKMQIGAPVRQHIDARERPCLPGYYTAAELKPVLDRPPQDSNAPGASGKAF
hide sequence
RefSeq Acc Id:
XP_013374244 ⟸ XM_013518790
- UniProtKB:
A0A8C2UZQ0 (UniProtKB/TrEMBL)
- Sequence:
MAHLKRLVKLHFKRLCHKKFWKLGGVIFFFILILILMQREVNVQFSKEESRMERNLKNKNKVFDLMLEAVNNIKDVMPKMQIGAPVRQHIDARERPCLPGYYTAAELKPVLDRPPQDSNAPGASGKAF
hide sequence
Ensembl Acc Id:
ENSCLAP00000005509 ⟸ ENSCLAT00000005610
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-08-25
Galnt3
polypeptide N-acetylgalactosaminyltransferase 3
UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3)
Symbol and/or name change
5135510 APPROVED
