Symbol:
Uxt
Name:
ubiquitously expressed prefoldin like chaperone
RGD ID:
8987011
Description:
ENCODES a protein that exhibits actin filament binding (ortholog); beta-tubulin binding (ortholog); chromatin binding (ortholog); INVOLVED IN centrosome cycle (ortholog); microtubule cytoskeleton organization (ortholog); negative regulation of transcription by RNA polymerase II (ortholog); ASSOCIATED WITH autistic disorder (ortholog); congenital disorder of glycosylation type IIm (ortholog); immune dysregulation-polyendocrinopathy-enteropathy-X-linked syndrome (ortholog); FOUND IN centrosome (ortholog); cytoplasm (ortholog); cytoskeleton (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
ubiquitously-expressed, prefoldin-like chaperone
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
ChiLan1.0 - Chinchilla ChiLan1.0 Assembly
Position:
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955516 420,616 - 430,134 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955516 421,402 - 429,804 (+) NCBI ChiLan1.0 ChiLan1.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Uxt Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955516 420,616 - 430,134 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955516 421,402 - 429,804 (+) NCBI ChiLan1.0 ChiLan1.0
UXT Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 47,651,796 - 47,659,180 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 47,651,796 - 47,659,180 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 47,511,195 - 47,518,579 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 47,396,139 - 47,403,504 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 47,267,449 - 47,274,770 NCBI Celera X 51,706,458 - 51,713,823 (-) NCBI Celera Cytogenetic Map X p11.23 NCBI HuRef X 45,223,944 - 45,231,332 (-) NCBI HuRef CHM1_1 X 47,542,327 - 47,549,715 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 47,061,699 - 47,069,083 (-) NCBI T2T-CHM13v2.0
Uxt Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 20,818,162 - 20,828,259 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 20,807,961 - 20,828,256 (-) Ensembl GRCm39 Ensembl GRCm38 X 20,951,665 - 20,962,017 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 20,941,722 - 20,962,017 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 20,528,791 - 20,539,104 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 20,108,624 - 20,118,937 (-) NCBI MGSCv36 mm8 Celera X 19,085,804 - 19,096,117 (-) NCBI Celera Cytogenetic Map X A1.3 NCBI cM Map X 16.46 NCBI
Uxt Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 3,679,630 - 3,691,944 (+) NCBI GRCr8 mRatBN7.2 X 1,126,110 - 1,138,670 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 1,126,162 - 1,138,663 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 1,154,446 - 1,166,501 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 4,630,138 - 4,642,193 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 950,682 - 962,723 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 1,275,402 - 1,287,781 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 1,275,612 - 1,287,512 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 2,090,439 - 2,102,802 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 12,616,439 - 12,628,479 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 12,621,996 - 12,634,035 (-) NCBI Celera X 1,695,268 - 1,707,300 (+) NCBI Celera Cytogenetic Map X q11 NCBI
UXT Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 49,278,273 - 49,285,734 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 49,281,645 - 49,289,111 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 40,087,712 - 40,095,164 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 47,983,770 - 47,991,169 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 47,983,770 - 47,991,148 (-) Ensembl panpan1.1 panPan2
UXT Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 41,271,908 - 41,280,433 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 41,271,908 - 41,280,340 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 15,646,536 - 15,655,076 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 41,405,725 - 41,413,955 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 41,405,719 - 41,413,934 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 41,393,272 - 41,401,810 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 41,381,544 - 41,390,081 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 41,474,238 - 41,482,772 (-) NCBI UU_Cfam_GSD_1.0
Uxt Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 33,577,677 - 33,587,087 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936502 13,418,403 - 13,427,767 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936502 13,419,520 - 13,427,777 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
UXT Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 42,176,145 - 42,184,079 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 42,176,142 - 42,184,131 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 47,294,749 - 47,302,738 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
UXT Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 44,828,836 - 44,836,433 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 44,828,841 - 44,835,985 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666076 10,083,180 - 10,090,625 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Uxt
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSCLAT00000002301 ⟹ ENSCLAP00000002254
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 Ensembl NW_004955516 420,616 - 430,134 (+) Ensembl
RefSeq Acc Id:
XM_005408943 ⟹ XP_005409000
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955516 421,402 - 429,804 (+) NCBI
Sequence:
TTCCGCCATTGGCCCGTTTAAGCCAGACAGACCCTGCTCCCACGCTCCGCAGTCTTCCGTGATCTTCTGGATTCCGTACAGCCCGCCCCTCTCCTCTTCCCTTTGGCCAGTCTTCTTCAATTCAGGAC
hide sequence
RefSeq Acc Id:
XP_005409000 ⟸ XM_005408943
- UniProtKB:
A0A8C2YJ14 (UniProtKB/TrEMBL)
- Sequence:
MSFIHATRKPWFIPIILIAGGPKELIMATPPKRRAVEAIGEKVLRYEAFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVSDTSRIYVALGYGFFLELT
hide sequence
Ensembl Acc Id:
ENSCLAP00000002254 ⟸ ENSCLAT00000002301
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-16
Uxt
ubiquitously expressed prefoldin like chaperone
ubiquitously-expressed, prefoldin-like chaperone
Symbol and/or name change
5135510 APPROVED
