Advanced Search (OLGA)

Gene: Msx2 (msh homeobox 2) Chinchilla lanigera

Subscribe to Updates

Analyze

Symbol:

Msx2

Name:

msh homeobox 2

RGD ID:

8955621

Description:

ENCODES a protein that exhibits DNA binding (ortholog); DNA-binding transcription factor activity, RNA polymerase II-specific (ortholog); DNA-binding transcription repressor activity, RNA polymerase II-specific (ortholog); INVOLVED IN activation of meiosis (ortholog); anterior/posterior pattern specification (ortholog); BMP signaling pathway (ortholog); ASSOCIATED WITH Craniofacial Abnormalities (ortholog); craniosynostosis (ortholog); craniosynostosis 2 (ortholog); FOUND IN cytosol (ortholog); nuclear speck (ortholog); transcription regulator complex (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

homeobox protein MSX-2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MSX2 (msh homeobox 2)	NCBI	Ortholog
Mus musculus (house mouse):	Msx2 (msh homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Msx2 (msh homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MSX2 (msh homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MSX2 (msh homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Msx2 (msh homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MSX2 (msh homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MSX2 (msh homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Msx2 (msh homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

ChiLan1.0 - Chinchilla ChiLan1.0 Assembly

Position:

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	27,323,360 - 27,329,755 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	27,323,405 - 27,329,484 (+)	NCBI	ChiLan1.0	ChiLan1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Msx2	Chinchilla	Craniofacial Abnormalities		ISO	MSX2 (Homo sapiens)	9068941	parietal foramina more ...	RGD	PMID:10742103 and REF_RGD_ID:1600492
Msx2	Chinchilla	craniosynostosis		ISO	MSX2 (Homo sapiens)	9068941	craniosynostosis type 2 more ...	RGD	PMID:8968743 and REF_RGD_ID:1600491
Msx2	Chinchilla	Femoral Fractures		ISO	Msx2 (Rattus norvegicus)	9068941	mRNA more ...	RGD	PMID:16451220 and REF_RGD_ID:5132608
Msx2	Chinchilla	hypertension		ISO	Msx2 (Rattus norvegicus)	9068941		RGD	PMID:18270471 and REF_RGD_ID:5132616

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Msx2	Chinchilla	craniosynostosis 2		ISO	MSX2 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:10742103 more ...
Msx2	Chinchilla	Craniosynostosis Syndrome, Autosomal Recessive		ISO	MSX2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Craniosynostosis syndrome	ClinVar
Msx2	Chinchilla	genetic disease		ISO	MSX2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:10742103 more ...
Msx2	Chinchilla	parietal foramina		ISO	MSX2 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:10742103 more ...
Msx2	Chinchilla	Parietal Foramina 1		ISO	MSX2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parietal foramina 1	ClinVar	PMID:10742103 more ...
Msx2	Chinchilla	Parietal Foramina with Cleidocranial Dysplasia		ISO	MSX2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parietal foramina with cleidocranial dysplasia	ClinVar	PMID:14571277

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Msx2	Chinchilla	Craniofacial Abnormalities		ISO	MSX2 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:9147639
Msx2	Chinchilla	Female Urogenital Diseases		ISO	MSX2 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:16513791

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Msx2	Chinchilla	craniosynostosis		ISO	Msx2 (Mus musculus)	9068941	OMIM:123100 more ...	MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Msx2	Chinchilla	craniosynostosis 2		ISO	MSX2 (Homo sapiens)	7240710		OMIM
Msx2	Chinchilla	Parietal Foramina 1		ISO	MSX2 (Homo sapiens)	7240710		OMIM
Msx2	Chinchilla	Parietal Foramina with Cleidocranial Dysplasia		ISO	MSX2 (Homo sapiens)	7240710		OMIM

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Msx2	Chinchilla	activation of meiosis	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:22071108	MGI	PMID:22071108
Msx2	Chinchilla	anterior/posterior pattern specification	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:21465616	MGI	PMID:21465616
Msx2	Chinchilla	BMP signaling pathway	acts_upstream_of_or_within	ISO	Msx2 (Mus musculus)	9068941	PMID:18590716	MGI	PMID:18590716
Msx2	Chinchilla	BMP signaling pathway	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:17601530 and PMID:18667074	MGI	PMID:17601530 and PMID:18667074
Msx2	Chinchilla	BMP signaling pathway	acts_upstream_of	ISO	MGI:97168	9068941	PMID:18667074	MGI	PMID:18667074
Msx2	Chinchilla	bone morphogenesis	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:17693062	MGI	PMID:17693062
Msx2	Chinchilla	bone trabecula formation	acts_upstream_of_or_within	ISO	MGI:1926381	9068941	PMID:10742104	MGI	PMID:10742104
Msx2	Chinchilla	branching involved in mammary gland duct morphogenesis	acts_upstream_of_or_within	ISO	MGI:1926381	9068941	PMID:10742104	MGI	PMID:10742104
Msx2	Chinchilla	cartilage development		ISO	Msx2 (Rattus norvegicus)	9068941		RGD	PMID:10332146 and REF_RGD_ID:1600462
Msx2	Chinchilla	cartilage development	acts_upstream_of_or_within	ISO	Msx2 (Mus musculus)	9068941	PMID:11668602	MGI	PMID:11668602
Msx2	Chinchilla	cartilage development	acts_upstream_of_or_within	ISO	MGI:1926381	9068941	PMID:10742104	MGI	PMID:10742104
Msx2	Chinchilla	cell surface receptor signaling pathway involved in heart development	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:18667074	MGI	PMID:18667074
Msx2	Chinchilla	cellular response to estradiol stimulus	acts_upstream_of_or_within	ISO	Msx2 (Mus musculus)	9068941	PMID:8787747	MGI	PMID:8787747
Msx2	Chinchilla	cellular response to growth factor stimulus	acts_upstream_of_or_within	ISO	Msx2 (Mus musculus)	9068941	PMID:7848824	MGI	PMID:7848824
Msx2	Chinchilla	chondrocyte development	acts_upstream_of_or_within	ISO	MGI:1926381	9068941	PMID:10742104	MGI	PMID:10742104
Msx2	Chinchilla	embryonic digit morphogenesis	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:21465616	MGI	PMID:21465616
Msx2	Chinchilla	embryonic forelimb morphogenesis	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:21465616	MGI	PMID:21465616
Msx2	Chinchilla	embryonic hindlimb morphogenesis	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:21465616	MGI	PMID:21465616
Msx2	Chinchilla	embryonic limb morphogenesis	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:15930102	MGI	PMID:15930102
Msx2	Chinchilla	embryonic limb morphogenesis	acts_upstream_of_or_within	ISO	MGI:97168 and MGI:98297	9068941	PMID:19422820	MGI	PMID:19422820
Msx2	Chinchilla	embryonic nail plate morphogenesis	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:21465616	MGI	PMID:21465616
Msx2	Chinchilla	enamel mineralization	acts_upstream_of_or_within	ISO	MGI:1926381	9068941	PMID:10742104	MGI	PMID:10742104
Msx2	Chinchilla	endochondral bone growth	acts_upstream_of_or_within	ISO	MGI:1926381	9068941	PMID:10742104	MGI	PMID:10742104
Msx2	Chinchilla	epithelial to mesenchymal transition involved in endocardial cushion formation	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:18667074	MGI	PMID:18667074
Msx2	Chinchilla	frontal suture morphogenesis	acts_upstream_of_or_within	ISO	MGI:1926381	9068941	PMID:10742104	MGI	PMID:10742104
Msx2	Chinchilla	mammary gland epithelium development	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:10742104	MGI	PMID:10742104
Msx2	Chinchilla	mesenchymal cell apoptotic process	acts_upstream_of	ISO	MGI:97168 and MGI:98297	9068941	PMID:19422820	MGI	PMID:19422820
Msx2	Chinchilla	negative regulation of apoptotic process	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:17601530	MGI	PMID:17601530
Msx2	Chinchilla	negative regulation of cell population proliferation	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:17601530	MGI	PMID:17601530
Msx2	Chinchilla	negative regulation of CREB transcription factor activity	acts_upstream_of_or_within	ISO	Msx2 (Mus musculus)	9068941	PMID:15175325	MGI	PMID:15175325
Msx2	Chinchilla	negative regulation of DNA-templated transcription	involved_in	ISO	Msx2 (Mus musculus)	9068941	PMID:15383550	UniProt	PMID:15383550
Msx2	Chinchilla	negative regulation of fat cell differentiation	acts_upstream_of_or_within	ISO	Msx2 (Mus musculus)	9068941	PMID:15175325	MGI	PMID:15175325
Msx2	Chinchilla	negative regulation of keratinocyte differentiation	acts_upstream_of_or_within	ISO	MGI:1926381	9068941	PMID:19769717	MGI	PMID:19769717
Msx2	Chinchilla	negative regulation of transcription by RNA polymerase II	involved_in	ISO	Msx2 (Mus musculus)	9068941	PMID:20843790 and PMID:8861098	BHF-UCL	PMID:20843790 and PMID:8861098
Msx2	Chinchilla	negative regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	ISO	Msx2 (Mus musculus)	9068941	PMID:9265625	MGI	PMID:9265625
Msx2	Chinchilla	negative regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	ISO	MGI:98494	9068941	PMID:18285513	MGI	PMID:18285513
Msx2	Chinchilla	negative regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	ISO	MGI:2137495	9068941	PMID:17030628	MGI	PMID:17030628
Msx2	Chinchilla	negative regulation of transcription by RNA polymerase II	involved_in	ISO	MSX2 (Homo sapiens)	9068941	PMID:14671321	UniProt	PMID:14671321
Msx2	Chinchilla	odontogenesis	acts_upstream_of_or_within	ISO	MGI:1926381	9068941	PMID:10742104	MGI	PMID:10742104
Msx2	Chinchilla	ossification	acts_upstream_of_or_within	ISO	MGI:1926381	9068941	PMID:10742104	MGI	PMID:10742104
Msx2	Chinchilla	osteoblast development		ISO	Msx2 (Rattus norvegicus)	9068941		RGD	PMID:11336915 and REF_RGD_ID:5132630
Msx2	Chinchilla	osteoblast development	acts_upstream_of_or_within	ISO	MGI:1926381	9068941	PMID:10742104	MGI	PMID:10742104
Msx2	Chinchilla	osteoblast differentiation	involved_in	ISO	Msx2 (Mus musculus)	9068941	PMID:15383550	UniProt	PMID:15383550
Msx2	Chinchilla	outflow tract morphogenesis	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:17601530	MGI	PMID:17601530
Msx2	Chinchilla	outflow tract septum morphogenesis	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:17601530	MGI	PMID:17601530
Msx2	Chinchilla	positive regulation of apoptotic process		ISO	Msx2 (Rattus norvegicus)	9068941		RGD	PMID:12205674 and REF_RGD_ID:727419
Msx2	Chinchilla	positive regulation of BMP signaling pathway	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:18667074	MGI	PMID:18667074
Msx2	Chinchilla	positive regulation of mesenchymal cell apoptotic process	acts_upstream_of_or_within	ISO	MGI:97168 and MGI:98297	9068941	PMID:19422820	MGI	PMID:19422820
Msx2	Chinchilla	positive regulation of osteoblast differentiation	acts_upstream_of_or_within	ISO	Msx2 (Mus musculus)	9068941	PMID:15175325	MGI	PMID:15175325
Msx2	Chinchilla	positive regulation of response to biotic stimulus		ISO	Msx2 (Rattus norvegicus)	9068941	BMP4-induced cell death	RGD	PMID:11518517 and REF_RGD_ID:10043821
Msx2	Chinchilla	positive regulation of timing of catagen	acts_upstream_of_or_within	ISO	MGI:1926381	9068941	PMID:10742104	MGI	PMID:10742104
Msx2	Chinchilla	regulation of apoptotic process	acts_upstream_of_or_within	ISO	Msx2 (Mus musculus)	9068941	PMID:18729207	MGI	PMID:18729207
Msx2	Chinchilla	signal transduction involved in regulation of gene expression	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:21465616	MGI	PMID:21465616
Msx2	Chinchilla	stem cell differentiation	acts_upstream_of_or_within	ISO	MGI:97168	9068941	PMID:17693062	MGI	PMID:17693062
Msx2	Chinchilla	transcription by RNA polymerase II		ISO	Msx2 (Rattus norvegicus)	9068941		RGD	PMID:7877617 and REF_RGD_ID:5132614
Msx2	Chinchilla	wound healing	acts_upstream_of_or_within	ISO	MGI:1926381	9068941	PMID:19769717	MGI	PMID:19769717
Msx2	Chinchilla	wound healing, spreading of epidermal cells	acts_upstream_of_or_within	ISO	MGI:1926381	9068941	PMID:19769717	MGI	PMID:19769717

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Msx2	Chinchilla	cytosol	located_in	ISO	MSX2 (Homo sapiens)	9068941		HPA	GO_REF:0000052
Msx2	Chinchilla	nuclear speck	located_in	ISO	MSX2 (Homo sapiens)	9068941		HPA	GO_REF:0000052
Msx2	Chinchilla	transcription regulator complex	part_of	ISO	PR:P70326 more ...	9068941	PMID:18285513	MGI	PMID:18285513

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Msx2	Chinchilla	DNA binding	enables	ISO	Msx2 (Mus musculus)	9068941	PMID:9265625	MGI	PMID:9265625
Msx2	Chinchilla	DNA-binding transcription factor activity, RNA polymerase II-specific		ISO	Msx2 (Rattus norvegicus)	9068941		RGD	PMID:7877617 and REF_RGD_ID:5132614
Msx2	Chinchilla	DNA-binding transcription repressor activity, RNA polymerase II-specific	enables	ISO	Msx2 (Mus musculus)	9068941	PMID:20843790 and PMID:8861098	BHF-UCL	PMID:20843790 and PMID:8861098
Msx2	Chinchilla	DNA-binding transcription repressor activity, RNA polymerase II-specific	enables	ISO	Msx2 (Mus musculus)	9068941	PMID:8861098	NTNU_SB	PMID:8861098
Msx2	Chinchilla	protein binding	enables	ISO	PR:Q62504	9068941	PMID:10451362	MGI	PMID:10451362
Msx2	Chinchilla	protein binding	enables	ISO	UniProtKB:O15197-2 more ...	9068941	PMID:32296183	IntAct	PMID:32296183
Msx2	Chinchilla	protein binding	enables	ISO	UniProtKB:G5E9A7 more ...	9068941	PMID:32814053	IntAct	PMID:32814053
Msx2	Chinchilla	protein binding	enables	ISO	UniProtKB:P12956 and UniProtKB:P13010	9068941	PMID:12145306	UniProt	PMID:12145306
Msx2	Chinchilla	protein binding	enables	ISO	UniProtKB:Q9QYH6	9068941	PMID:11084035 and PMID:11959851	IntAct	PMID:11084035 and PMID:11959851
Msx2	Chinchilla	protein binding	enables	ISO	UniProtKB:P25233 and UniProtKB:Q9QYH6	9068941	PMID:15272023	IntAct	PMID:15272023
Msx2	Chinchilla	RNA polymerase II cis-regulatory region sequence-specific DNA binding		ISO	Msx2 (Rattus norvegicus)	9068941		RGD	PMID:7877617 and REF_RGD_ID:5132614
Msx2	Chinchilla	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISO	Msx2 (Mus musculus)	9068941	PMID:20843790	BHF-UCL	PMID:20843790
Msx2	Chinchilla	RNA polymerase II transcription regulatory region sequence-specific DNA binding	enables	ISO	Msx2 (Mus musculus)	9068941	PMID:8861098	NTNU_SB	PMID:8861098
Msx2	Chinchilla	sequence-specific DNA binding	enables	ISO	MSX2 (Homo sapiens)	9068941	PMID:9073066	MGI	PMID:9073066
Msx2	Chinchilla	sequence-specific double-stranded DNA binding	enables	ISO	MSX2 (Homo sapiens)	9068941	PMID:28473536	ARUK-UCL	PMID:28473536
Msx2	Chinchilla	transcription cis-regulatory region binding	enables	ISO	Msx2 (Mus musculus)	9068941	PMID:15383550	UniProt	PMID:15383550

#	Reference Title	Reference Citation
1.	Transitive Annotation Pipeline	Automated assignment of GO, PW and RDO ISO annotations across species
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline

PMID:22301074	PMID:30032202

Msx2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	27,323,360 - 27,329,755 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	27,323,405 - 27,329,484 (+)	NCBI	ChiLan1.0	ChiLan1.0

MSX2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	174,724,582 - 174,730,896 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	174,724,582 - 174,730,896 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	174,151,585 - 174,157,899 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	174,084,181 - 174,090,508 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	174,084,207 - 174,090,507	NCBI
Celera	5	170,185,579 - 170,191,910 (+)	NCBI		Celera
Cytogenetic Map	5	q35.2	NCBI
HuRef	5	169,246,978 - 169,253,303 (+)	NCBI		HuRef
CHM1_1	5	173,583,988 - 173,590,298 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	175,263,949 - 175,271,855 (+)	NCBI		T2T-CHM13v2.0

Msx2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	53,620,917 - 53,626,816 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	53,620,920 - 53,627,110 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	53,466,881 - 53,472,780 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	53,466,884 - 53,473,074 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	53,562,250 - 53,568,149 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	53,475,420 - 53,480,608 (-)	NCBI		MGSCv36	mm8
Celera	13	54,545,172 - 54,551,024 (-)	NCBI		Celera
Cytogenetic Map	13	B1	NCBI
cM Map	13	27.84	NCBI

Msx2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	11,102,284 - 11,107,949 (+)	NCBI		GRCr8
mRatBN7.2	17	11,097,214 - 11,102,879 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	11,097,103 - 11,102,879 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	11,105,528 - 11,111,192 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	12,641,862 - 12,647,525 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	11,104,006 - 11,109,669 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	11,683,862 - 11,689,527 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	11,683,862 - 11,689,527 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	13,785,024 - 13,790,689 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	17,243,262 - 17,248,927 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	17,247,335 - 17,247,755 (+)	NCBI
Celera	17	11,158,359 - 11,164,024 (+)	NCBI		Celera
RH 3.4 Map	17	109.2	RGD
Cytogenetic Map	17	p14	NCBI

MSX2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	169,845,949 - 169,853,128 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	167,985,531 - 167,992,667 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	170,063,137 - 170,070,226 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	176,968,315 - 176,974,679 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	176,967,902 - 176,976,609 (+)	Ensembl	panpan1.1		panPan2

MSX2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	38,002,724 - 38,007,407 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	38,002,428 - 38,007,407 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	37,948,799 - 37,953,445 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	38,376,184 - 38,380,830 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	38,375,888 - 38,381,225 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	38,192,821 - 38,197,476 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	38,380,991 - 38,385,645 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	38,891,167 - 38,895,822 (-)	NCBI		UU_Cfam_GSD_1.0

Msx2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	92,492,782 - 92,498,921 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936609	1,216,436 - 1,221,561 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936609	1,216,436 - 1,221,528 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MSX2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	49,765,910 - 49,771,789 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	49,765,587 - 49,771,745 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

MSX2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	76,873,499 - 76,879,935 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	76,873,669 - 76,879,553 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	1,717,428 - 1,723,746 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Msx2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	15,288,326 - 15,294,568 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	15,288,417 - 15,294,481 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	XM_005376360	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AGCD01008678	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GBCE01057111	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSCLAT00000020630 ⟹ ENSCLAP00000020432

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0 Ensembl	NW_004955408	27,323,360 - 27,329,755 (+)	Ensembl

RefSeq Acc Id:

XM_005376360 ⟹ XP_005376417

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0	NW_004955408	27,323,405 - 27,329,484 (+)	NCBI

Sequence:

show sequence

GCTCGGCTCCCAGCGCGCCCCTCCCGTCTCCCCCGCAAAAAGTTTGTGTCGCGGCTGCGGAGCTGCCAGCGGAGTCGCGCGCCCGGAGCTACGCGGGGCAGAGAAGTCATGGCTTCTCCGTCCAAAGG
CAATGAGCTGTTTTCGTCCGATGAGGAGGGCCCGGCCATGGTGGCAGGGCCCGGCCCCGGGCCGGGGGGCGCCGAGGGGGGCTCCGAGGAGCGCCGCGTCAAGGTCTCCAGCCTGCCCTTCAGCGTGG
AGGCGCTCATGTCCGATAAGAAGCCGCCCAAGCCGGGGTCTCCGCTGCCGGCCGAGAGCGCGTCGGCTGGGGCCAGCCTGCGGCCGCTGCTGCTGCCGGGACACGGCGCCCGGGAGGCGCACAGTCCC
GGGCCTCTGGTCAAGCCCTTCGAGACTGCCTCGGTCAAGTCGGAGAACTCAGAAGACGGGGCGGCGTGGATGCAGGAAGCCGGCAGATACTCGCCGCCGCCGAGACATATGAGCCCCACCACCTGCAC
CCTGAGGAAGCACAAGACCAATCGGAAGCCACGCACACCCTTCACCACGTCCCAGCTCCTAGCTCTGGAGCGCAAGTTCCGCCAGAAACAGTACCTCTCCATTGCAGAGCGGGCAGAGTTCTCCAGCT
CTCTGAACCTCACAGAGACCCAGGTCAAAATCTGGTTTCAGAACCGAAGGGCCAAGGCGAAAAGACTGCAGGAGGCAGAACTGGAAAAGCTGAAAATGGCTGCAAAACCTATGCTGCCCTCTGGCTTC
AGTCTCCCCTTCCCCATCAACTCGCCCCTCCAAGCAGCGTCTATATATGGAACATCCTACCCTTTCCATAGACCTGTGCTTCCTATCCCTCCCGTCGGACTCTATGCCACGCCAGTCGGATATGGCAT
GTACCATCTATCCTAAGGAGGGCCAGGTTGACAGACTCCACGATGGATGTTTGTTTCAAAGGGTTCCCCTTTCTCTCCAAGGAGGCTACACTGACAGTCCTCCTGCTGTGCAAACCTTGCTTGCACCA
CTTTGAGCTAGAGCAGCCAGGCTGTGGGCCACACGACACAGATCAAAGTTTGTTTAGGTGGTTGGCACCAAGTCCTGTTTTCTTGGCGTAATCTTCCAGATACCCCCTTCTCCTTTTACAAAGATTGG
CTCTGACAGTTTTTATGTATAAATATATATAATAAAATATAAGATGTTTTTATACAGCAGACATAAAAATGCAAATTATTTTGAAAGGCAAAATTTATACACATATATACATTTTTCTATTGATCACC
TTCTGAAGAGTGACTGTATGTCCATTTGTTGTATTTCCTGAAAGGGGGAGACAAATTACTTATGAAAATTGATTTTGATAGGATGATTGACTTTTGCTTATGGAAAACAAATATTAGAATTAGACACA
GTGCACATAGAAAGTAGATATGGAGAAATTCTTCAAGTGAAGGGGCTGTATAACATGTTTGCATTTTACGTACATCAGAAAAATCTCATTAAATGCTACCATATTTGGCCCTAATTTTCCTCCCTCTC
TCTACACAGTTAACTTGTAACCTTTTTTTAAGGTCAATAAGAGGGAGATGAAATAATCCTAAGAACACTTCCAGTGGGGAGAAAATAGGAATACTTCCTAATCTCTGTCTCAATAACTACATTTTAGG
CAATTGGAGAGTGAAAAATTAAAACACGTCAAGAGGAATCGATGATTTCTGTGAAATACTAGGTCAGTCCTCTCACATTGCAATGGTGATTTTGGGGGGGTGTAGTAATTTTCTGCTTAAAAAATGAG
TATCTTGTAACCATTTAACTATATACTGAATGTTCCTGAACACTTAATAGAACCAGGAAGGGGGGAAAAAATCATGCTTTCTGTGTGTGTGTGCCTATTGTATGTGCTAAACTTATTAGGAAAGTTTA
TATACTTTTTAACATGTTGGGGGCAGAGGGTAAAGCCATGTTTTGACTTGCTAAAAATGGTGTTGTCAAACAGCCCATTTAGCTTCCTGGTATTTTACCTTCCTATCCATCTTTCCTCTCTCCCCCAC
CCCCAATATACTTCTATCCCTTTGAAAGGGTGCCTTGTACAATTTTATATATTTTATTGAAGAGTTATTTCTTATCTCTTATTCTGAATTAAATTAAACATTTGTTTTATTGCAGTAAAA

hide sequence


Protein RefSeqs	XP_005376417	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSCLAP00000020432
	ENSCLAP00000020432.1

RefSeq Acc Id:

XP_005376417 ⟸ XM_005376360

- UniProtKB:

A0A8C2W164 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASPSKGNELFSSDEEGPAMVAGPGPGPGGAEGGSEERRVKVSSLPFSVEALMSDKKPPKPGSPLPAESASAGASLRPLLLPGHGAREAHSPGPLVKPFETASVKSENSEDGAAWMQEAGRYSPPPRH
MSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSGFSLPFPINSPLQAASIYGTSYPFHRPVLPIPPVGLYA
TPVGYGMYHLS

hide sequence

Ensembl Acc Id:

ENSCLAP00000020432 ⟸ ENSCLAT00000020630

Protein Domains

Homeobox

Database	Acc Id	Source(s)
Ensembl Genes	ENSCLAG00000014001	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSCLAT00000020630	ENTREZGENE
	ENSCLAT00000020630.1	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
InterPro	Homeobox-like_sf	UniProtKB/TrEMBL
	Homeobox_CS	UniProtKB/TrEMBL
	Homeobox_dom	UniProtKB/TrEMBL
	Homeobox_metazoa	UniProtKB/TrEMBL
	Msh_Homeobox_Regulators	UniProtKB/TrEMBL
NCBI Gene	Msx2	ENTREZGENE
PANTHER	HOMEOBOX PROTEIN MSX	UniProtKB/TrEMBL
	HOMEOBOX PROTEIN MSX-2	UniProtKB/TrEMBL
Pfam	Homeodomain	UniProtKB/TrEMBL
PRINTS	HOMEOBOX	UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/TrEMBL
SMART	HOX	UniProtKB/TrEMBL
Superfamily-SCOP	SSF46689	UniProtKB/TrEMBL
UniProt	A0A8C2W164	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM