Symbol:
Lmcd1
Name:
LIM and cysteine rich domains 1
RGD ID:
8848632
Description:
ENCODES a protein that exhibits transcription corepressor activity (ortholog); INVOLVED IN negative regulation of transcription by RNA polymerase II (ortholog); positive regulation of calcineurin-NFAT signaling cascade (ortholog); regulation of cardiac muscle hypertrophy (ortholog); ASSOCIATED WITH Atrioventricular Septal Defect 2 (ortholog); coronary stenosis (ortholog); mitral valve insufficiency (ortholog); FOUND IN nucleus (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
LIM and cysteine-rich domains 1; LIM and cysteine-rich domains protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
ChiLan1.0 - Chinchilla ChiLan1.0 Assembly
Position:
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955561 151,308 - 214,476 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955561 151,315 - 213,904 (+) NCBI ChiLan1.0 ChiLan1.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Lmcd1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955561 151,308 - 214,476 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955561 151,315 - 213,904 (+) NCBI ChiLan1.0 ChiLan1.0
LMCD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 8,501,823 - 8,574,668 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 8,501,807 - 8,574,668 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 8,543,509 - 8,616,354 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 8,518,511 - 8,584,806 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 8,518,510 - 8,584,805 NCBI Celera 3 8,480,112 - 8,546,564 (+) NCBI Celera Cytogenetic Map 3 p25.3 NCBI HuRef 3 8,478,394 - 8,544,846 (+) NCBI HuRef CHM1_1 3 8,493,836 - 8,560,461 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 8,492,967 - 8,566,009 (+) NCBI T2T-CHM13v2.0
Lmcd1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 112,250,747 - 112,307,384 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 112,250,719 - 112,307,386 (+) Ensembl GRCm39 Ensembl GRCm38 6 112,273,758 - 112,330,423 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 112,273,758 - 112,330,425 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 112,223,752 - 112,280,417 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 112,239,591 - 112,296,202 (+) NCBI MGSCv36 mm8 Celera 6 114,110,587 - 114,167,245 (+) NCBI Celera Cytogenetic Map 6 E3 NCBI cM Map 6 52.14 NCBI
Lmcd1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 146,948,993 - 147,007,878 (+) NCBI GRCr8 mRatBN7.2 4 145,393,153 - 145,452,049 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 145,393,145 - 145,452,046 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 150,785,843 - 150,844,729 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 146,566,657 - 146,625,523 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 145,187,941 - 145,246,815 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 144,192,989 - 144,252,554 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 144,192,989 - 144,252,551 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 207,494,655 - 207,554,220 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 148,071,431 - 148,130,313 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 148,316,271 - 148,375,153 (+) NCBI Celera 4 133,994,893 - 134,022,583 (+) NCBI Celera Cytogenetic Map 4 q41 NCBI
LMCD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 8,507,235 - 8,573,884 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 8,511,847 - 8,585,307 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 8,448,143 - 8,521,214 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 8,692,557 - 8,765,522 (+) NCBI panpan1.1 PanPan1.1 panPan2
LMCD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 9,524,393 - 9,582,939 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 9,524,413 - 9,583,529 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 9,557,871 - 9,616,422 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 9,555,858 - 9,614,448 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 9,555,878 - 9,614,921 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 9,276,475 - 9,335,001 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 9,622,849 - 9,681,370 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 9,595,563 - 9,654,153 (-) NCBI UU_Cfam_GSD_1.0
Lmcd1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404942 14,431,414 - 14,489,110 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936602 4,420,597 - 4,478,384 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936602 4,420,600 - 4,478,384 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LMCD1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 64,933,700 - 64,994,228 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 64,933,692 - 64,994,204 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 72,215,911 - 72,275,069 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LMCD1
Lmcd1
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSCLAT00000001749 ⟹ ENSCLAP00000001706
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 Ensembl NW_004955561 151,308 - 214,476 (+) Ensembl
RefSeq Acc Id:
XM_005412996 ⟹ XP_005413053
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955561 151,315 - 213,904 (+) NCBI
Sequence:
CCGGCTGCTCGCAGAGCTTCCCGCGGGGCGCGCGAACCTGGCCATTCAGCCTCCGGCAGCCCTGCCGCGCGCCGTGGCAGTCCTGCCGCGCCTCCTCGAGCCTCCACTCTCCACTGGACGAGCCCGGC
hide sequence
RefSeq Acc Id:
XM_013509111 ⟹ XP_013364565
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955561 151,315 - 213,904 (+) NCBI
Sequence:
CCGGCTGCTCGCAGAGCTTCCCGCGGGGCGCGCGAACCTGGCCATTCAGCCTCCGGCAGCCCTG
hide sequence
RefSeq Acc Id:
XP_005413053 ⟸ XM_005412996
- Peptide Label:
isoform X1
- UniProtKB:
A0A8C2UMS1 (UniProtKB/TrEMBL)
- Sequence:
MAKVAKDLNPRVQKMSLGQQQSARGVACLRCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQK
hide sequence
RefSeq Acc Id:
XP_013364565 ⟸ XM_013509111
- Peptide Label:
isoform X2
- Sequence:
MDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKERQPVTGTEGAYYRRRQLMHQLPIYDQDPSRCRGLSDNELKVMEEFVKQYKSEALGVGEVAL
hide sequence
Ensembl Acc Id:
ENSCLAP00000001706 ⟸ ENSCLAT00000001749
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-03
Lmcd1
LIM and cysteine rich domains 1
LIM and cysteine-rich domains 1
Symbol and/or name change
5135510 APPROVED
