Symbol:
Creb3l2
Name:
cAMP responsive element binding protein 3 like 2
RGD ID:
8835404
Description:
ENCODES a protein that exhibits cAMP response element binding (ortholog); DNA-binding transcription activator activity, RNA polymerase II-specific (ortholog); RNA polymerase II cis-regulatory region sequence-specific DNA binding (ortholog); INVOLVED IN cartilage development (ortholog); chondrocyte differentiation (ortholog); endoplasmic reticulum to Golgi vesicle-mediated transport (ortholog); PARTICIPATES IN endoplasmic reticulum stress - the unfolded protein response pathway; ASSOCIATED WITH pleomorphic xanthoastrocytoma (ortholog); FOUND IN chromatin (ortholog); endoplasmic reticulum (ortholog); nucleoplasm (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
cAMP responsive element binding protein 3-like 2; cyclic AMP-responsive element-binding protein 3-like protein 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
ChiLan1.0 - Chinchilla ChiLan1.0 Assembly
Position:
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955494 5,045,272 - 5,089,121 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955494 5,014,509 - 5,094,220 (+) NCBI ChiLan1.0 ChiLan1.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Creb3l2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955494 5,045,272 - 5,089,121 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955494 5,014,509 - 5,094,220 (+) NCBI ChiLan1.0 ChiLan1.0
CREB3L2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 137,874,979 - 138,002,086 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 137,874,979 - 138,002,086 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 137,559,725 - 137,686,832 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 137,210,265 - 137,337,386 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 137,016,979 - 137,144,101 NCBI Celera 7 132,298,692 - 132,425,654 (-) NCBI Celera Cytogenetic Map 7 q33 NCBI HuRef 7 131,867,554 - 131,994,857 (-) NCBI HuRef CHM1_1 7 137,493,293 - 137,620,361 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 139,184,080 - 139,311,621 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 136,905,109 - 137,032,069 (-) NCBI
Creb3l2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 37,307,956 - 37,419,083 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 37,304,190 - 37,419,081 (-) Ensembl GRCm39 Ensembl GRCm38 6 37,327,255 - 37,442,276 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 37,327,255 - 37,442,146 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 37,281,021 - 37,392,148 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 37,260,627 - 37,371,747 (-) NCBI MGSCv36 mm8 Celera 6 37,307,243 - 37,429,201 (-) NCBI Celera Cytogenetic Map 6 B1 NCBI cM Map 6 16.18 NCBI
Creb3l2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 66,874,623 - 66,990,962 (-) NCBI GRCr8 mRatBN7.2 4 65,907,570 - 66,112,078 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 65,907,655 - 66,023,763 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 70,849,613 - 70,965,757 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 66,770,691 - 66,886,837 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 65,160,628 - 65,276,768 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 64,869,285 - 64,981,519 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 64,869,026 - 64,981,384 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 64,691,125 - 64,803,069 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 64,703,458 - 64,816,668 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 64,979,587 - 65,092,798 (-) NCBI Celera 4 60,932,138 - 61,044,664 (-) NCBI Celera Cytogenetic Map 4 q22 NCBI
CREB3L2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 174,688,367 - 174,816,921 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 26,698,619 - 26,827,174 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 129,833,446 - 129,960,145 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 142,326,266 - 142,452,438 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 142,331,759 - 142,452,438 (-) Ensembl panpan1.1 panPan2
CREB3L2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 10,683,169 - 10,803,071 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 10,682,935 - 11,248,029 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 16 11,696,999 - 11,817,077 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 10,643,987 - 10,764,606 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 10,644,016 - 10,760,664 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 11,106,597 - 11,226,365 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 10,209,275 - 10,329,400 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 10,351,793 - 10,471,726 (+) NCBI UU_Cfam_GSD_1.0
Creb3l2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 16,806,312 - 16,916,844 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936592 2,308,156 - 2,413,510 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936592 2,302,921 - 2,413,486 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CREB3L2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 18 11,533,183 - 11,666,113 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 18 11,533,184 - 11,666,132 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 18 12,205,340 - 12,338,168 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CREB3L2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 106,572,893 - 106,705,080 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 106,578,422 - 106,705,089 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666072 3,436,572 - 3,563,264 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Creb3l2
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSCLAT00000001954 ⟹ ENSCLAP00000001910
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 Ensembl NW_004955494 5,045,272 - 5,089,121 (+) Ensembl
RefSeq Acc Id:
XM_013505001 ⟹ XP_013360455
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955494 5,014,509 - 5,094,220 (+) NCBI
Sequence:
TACAGGCATGCTGCCATGGCAACTGGTTCAGAATCCATATTCAAAATCACGTTGCTAGTTAGGAAACCAGGCTATGCTGGCCAGTGTGAGAGAAAGCAATGTCACTTCTCCGAGCTTCTGGATGAGTT
hide sequence
RefSeq Acc Id:
XP_013360455 ⟸ XM_013505001
- UniProtKB:
A0A8C2UN88 (UniProtKB/TrEMBL)
- Sequence:
MATGSESIFKITLLVRKPGYAGQCERKQCHFSELLDEFSQNVLGQLLNDPFLSEKSVSMDVEPSPTSPAPLIQAEHSYSLCEEPPAQSPFTHMATSDSFNDEEAESDKWYLSMDFPPATIKTEPITEE
hide sequence
Ensembl Acc Id:
ENSCLAP00000001910 ⟸ ENSCLAT00000001954
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-03
Creb3l2
cAMP responsive element binding protein 3 like 2
cAMP responsive element binding protein 3-like 2
Symbol and/or name change
5135510 APPROVED
