Advanced Search (OLGA)

Gene: Rras (RAS related) Chinchilla lanigera

Subscribe to Updates

Analyze

Symbol:

Rras

Name:

RAS related

RGD ID:

8781350

Description:

ENCODES a protein that exhibits GDP binding (ortholog); GTPase activity (ortholog); protein-containing complex binding (ortholog); INVOLVED IN cell migration (ortholog); face morphogenesis (ortholog); leukocyte differentiation (ortholog); PARTICIPATES IN ephrin - ephrin receptor bidirectional signaling axis; ASSOCIATED WITH COVID-19 (ortholog); developmental and epileptic encephalopathy 12 (ortholog); juvenile myelomonocytic leukemia (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

ras-related protein R-Ras; related RAS viral (r-ras) oncogene homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RRAS (RAS related)	NCBI	Ortholog
Mus musculus (house mouse):	Rras (related RAS viral (r-ras) oncogene)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Rras (RAS related)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RRAS (RAS related)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RRAS (RAS related)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rras (RAS related)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RRAS (RAS related)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RRAS (RAS related)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rras (RAS related)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

ChiLan1.0 - Chinchilla ChiLan1.0 Assembly

Position:

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955559	1,244,658 - 1,248,774 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955559	1,244,658 - 1,248,774 (+)	NCBI	ChiLan1.0	ChiLan1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rras	Chinchilla	COVID-19		ISO	RRAS (Homo sapiens)	9068941	mRNA:increased expression:peripheral blood mononuclear cell (human)	RGD	PMID:32228226 and REF_RGD_ID:28912744

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rras	Chinchilla	developmental and epileptic encephalopathy 12		ISO	RRAS (Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy and 12	ClinVar	PMID:28492532
Rras	Chinchilla	Noonan syndrome		ISO	RRAS (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:17576681 more ...
Rras	Chinchilla	Noonan syndrome		ISO	RRAS (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:17576681 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rras	Chinchilla	juvenile myelomonocytic leukemia		ISO	RRAS (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:26457647
Rras	Chinchilla	Prostatic Neoplasms		ISO	RRAS (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:17013881

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rras	Chinchilla	cell migration	acts_upstream_of	ISO	MGI:97306	9068941	PMID:14724565	MGI	PMID:14724565
Rras	Chinchilla	face morphogenesis	involved_in	ISO	RRAS (Homo sapiens)	9068941	PMID:24705357	UniProt	PMID:24705357
Rras	Chinchilla	leukocyte differentiation	involved_in	ISO	RRAS (Homo sapiens)	9068941	PMID:24705357	UniProt	PMID:24705357
Rras	Chinchilla	negative regulation of Schwann cell migration	acts_upstream_of_or_within	ISO	MGI:97306	9068941	PMID:14724565	MGI	PMID:14724565
Rras	Chinchilla	positive regulation of angiogenesis	involved_in	ISO	RRAS (Homo sapiens)	9068941	PMID:21393242	UniProt	PMID:21393242
Rras	Chinchilla	positive regulation of endothelial cell migration	involved_in	ISO	RRAS (Homo sapiens)	9068941	PMID:22825554	CACAO	PMID:22825554
Rras	Chinchilla	positive regulation of endothelial cell-matrix adhesion via fibronectin	involved_in	ISO	RRAS (Homo sapiens)	9068941	PMID:22825554	CACAO	PMID:22825554
Rras	Chinchilla	positive regulation of vasculogenesis	involved_in	ISO	RRAS (Homo sapiens)	9068941	PMID:22825554	CACAO	PMID:22825554
Rras	Chinchilla	regulation of ERK1 and ERK2 cascade	involved_in	ISO	RRAS (Homo sapiens)	9068941	PMID:24705357	UniProt	PMID:24705357
Rras	Chinchilla	regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	involved_in	ISO	RRAS (Homo sapiens)	9068941	PMID:24705357	UniProt	PMID:24705357
Rras	Chinchilla	Schwann cell migration	acts_upstream_of	ISO	MGI:97306	9068941	PMID:14724565	MGI	PMID:14724565

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rras	Chinchilla	GDP binding	enables	ISO	RRAS (Homo sapiens)	9068941	PMID:16773572	UniProt	PMID:16773572
Rras	Chinchilla	GDP binding	enables	ISO	RRAS (Homo sapiens)	9068941	PMID:24705357	UniProt	PMID:24705357
Rras	Chinchilla	GTPase activity	enables	ISO	RRAS (Homo sapiens)	9068941	PMID:24705357	UniProt	PMID:24705357
Rras	Chinchilla	GTPase activity	enables	ISO	RRAS (Homo sapiens)	9068941	PMID:16773572	UniProt	PMID:16773572
Rras	Chinchilla	protein binding	enables	ISO	UniProtKB:P52306-5	9068941	PMID:32296183	IntAct	PMID:32296183
Rras	Chinchilla	protein binding	enables	ISO	UniProtKB:P16333	9068941	PMID:17474147	IntAct	PMID:17474147
Rras	Chinchilla	protein binding	enables	ISO	UniProtKB:O43157	9068941	PMID:19843518	UniProt	PMID:19843518
Rras	Chinchilla	protein binding	enables	ISO	UniProtKB:O08773	9068941	PMID:19319189	UniProt	PMID:19319189 and REF_RGD_ID:8554645
Rras	Chinchilla	protein-containing complex binding	enables	ISO	RRAS (Homo sapiens)	9068941	PMID:23209302	MGI	PMID:23209302

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rras	Chinchilla	ephrin - ephrin receptor bidirectional signaling axis		ISO	RRAS (Homo sapiens)	9068941		PID	PID:200052

#	Reference Title	Reference Citation
1.	Transitive Annotation Pipeline	Automated assignment of GO, PW and RDO ISO annotations across species

PMID:22301074	PMID:30032202

Rras
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955559	1,244,658 - 1,248,774 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955559	1,244,658 - 1,248,774 (+)	NCBI	ChiLan1.0	ChiLan1.0

RRAS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	49,635,292 - 49,640,143 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	49,635,292 - 49,640,143 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	50,138,549 - 50,143,400 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	54,830,364 - 54,835,212 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	54,830,363 - 54,835,212	NCBI
Celera	19	47,007,883 - 47,012,731 (-)	NCBI		Celera
Cytogenetic Map	19	q13.33	NCBI
HuRef	19	46,515,612 - 46,520,460 (-)	NCBI		HuRef
CHM1_1	19	50,140,333 - 50,145,181 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	52,635,325 - 52,640,178 (-)	NCBI		T2T-CHM13v2.0

Rras
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	44,665,686 - 44,671,070 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	44,667,385 - 44,671,071 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	45,017,942 - 45,021,646 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	45,017,961 - 45,021,647 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	52,273,377 - 52,277,014 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	44,886,049 - 44,889,686 (+)	NCBI		MGSCv36	mm8
Celera	7	40,469,567 - 40,473,202 (+)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	29.08	NCBI

Rras
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	104,637,061 - 104,640,841 (+)	NCBI		GRCr8
mRatBN7.2	1	95,500,582 - 95,504,362 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	95,500,566 - 95,504,357 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	100,885,980 - 100,889,760 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	109,358,646 - 109,362,426 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	102,649,041 - 102,652,821 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	101,012,822 - 101,016,720 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	101,012,822 - 101,016,720 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	102,077,775 - 102,081,673 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	95,490,730 - 95,495,462 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	95,568,807 - 95,573,563 (+)	NCBI
Celera	1	89,761,925 - 89,765,705 (+)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

RRAS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	55,752,559 - 55,757,421 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	57,673,302 - 57,678,161 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	46,649,892 - 46,654,754 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	55,569,465 - 55,571,444 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	55,569,749 - 55,573,721 (-)	Ensembl	panpan1.1		panPan2

RRAS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	106,895,413 - 106,899,265 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	106,895,408 - 106,899,222 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	106,479,192 - 106,483,049 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	107,416,876 - 107,420,728 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	107,416,878 - 107,420,685 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	107,089,085 - 107,092,934 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	106,731,174 - 106,735,018 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	107,572,304 - 107,576,157 (+)	NCBI		UU_Cfam_GSD_1.0

Rras
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	21,838,491 - 21,842,354 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936664	3,456,290 - 3,460,788 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936664	3,456,681 - 3,460,537 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RRAS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	54,680,600 - 54,684,719 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	54,680,596 - 54,684,714 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	50,409,620 - 50,413,729 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RRAS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	42,810,411 - 42,815,504 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	42,810,339 - 42,815,479 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	22,754,154 - 22,759,266 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rras
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	4,633,326 - 4,637,938 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	4,632,812 - 4,637,938 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	XM_005412862	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AGCD01073638	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GBDF01188765	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSCLAT00000007098 ⟹ ENSCLAP00000006986

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0 Ensembl	NW_004955559	1,244,658 - 1,248,774 (+)	Ensembl

RefSeq Acc Id:

XM_005412862 ⟹ XP_005412919

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0	NW_004955559	1,244,658 - 1,248,774 (+)	NCBI

Sequence:

show sequence

AGAGCTCATGATTATGTAGTACCTTATTAGCGTAGCCCGCCTCTGGGTCCCGCCTGGTTCCCCCCGGCGTTAGCAGAGGCGGCGGCAGCGGTGGCGACATGAGCAGCGGGGCGGCGTCCGGGACTGGG
CGGGGGCGGCCCAGGGGCGGGGGGCCGGGACCCGGGGACCCCCCGCCCAGCGAGACACACAAGCTGGTGGTCGTGGGCGGCGGCGGCGTGGGCAAGAGCGCGCTGACCATCCAGTTCATCCAGTCCTA
CTTTGTGTCTGACTATGACCCCACCATCGAGGACTCCTACACGAAGATCTGCACTGTAGATGGCATTCCAGCCCGGCTGGACATCCTGGACACCGCGGGCCAAGAGGAGTTCGGGGCCATGCGGGAGC
AGTACATGCGTGCGGGCCATGGCTTCCTGCTGGTGTTTGCCATTAACGACAGGCAGAGCTTCAACGAGGTGGGCAAGCTCTTCACACAGATCCTCCGGGTCAAGGACCGCGACGACTTCCCCGTCGTG
CTGGTTGGGAACAAGGCAGATCTGGAGACACAGCGTCAGGTTCCCAGATCAGAAGCCTCCAGCTTTGGCGCCTCCCACCACGTGGCCTACTTCGAGGCTTCAGCCAAACTGCGGCTCAACGTGGACGA
GGCTTTTGAGCAGCTGGTGCGGGCCGTCCGGAAGTACCAGGAACAAGAGCTCCCACCCAGCCCGCCCAGCGCCCCCAGGAAGAAGGATGGGGGCTGCCCCTGCATCTTGCTGTAGCCCAGGGAAGTGA
CCAGCACAAGCTCGAGGGACCAGCTGCCTTGCACCCTGCCGTGTGGCCTGAGGCCCCAGCTGAGCCTGTTTTCTCCTCTGGGTCTTCCAGGACACACTATACCCTAACCCTGACTTGCTGGCCTCCTC
TGGGCCGTCGCCACTGTGTGCCTTCTGCCAATGCCTCCTTTCCCCACACAAGGCCCTGGTGCAGTGAGGGGCTCCCAGGTCACTGCTGTACATAACTCCCCTCCCTCAGAAAAATAAATGTCACTGCC
AACTTCA

hide sequence


Protein RefSeqs	XP_005412919	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSCLAP00000006986
	ENSCLAP00000006986.1

RefSeq Acc Id:

XP_005412919 ⟸ XM_005412862

- UniProtKB:

A0A8C2V3A8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVGKLFTQILR
VKDRDDFPVVLVGNKADLETQRQVPRSEASSFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKDGGCPCILL

hide sequence

Ensembl Acc Id:

ENSCLAP00000006986 ⟸ ENSCLAT00000007098

Database	Acc Id	Source(s)
Ensembl Genes	ENSCLAG00000004920	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSCLAT00000007098	ENTREZGENE
	ENSCLAT00000007098.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/TrEMBL
InterPro	P-loop_NTPase	UniProtKB/TrEMBL
	Small_GTP-bd_dom	UniProtKB/TrEMBL
	Small_GTPase	UniProtKB/TrEMBL
	Small_GTPase_Ras-type	UniProtKB/TrEMBL
NCBI Gene	Rras	ENTREZGENE
PANTHER	PTHR24070	UniProtKB/TrEMBL
Pfam	Ras	UniProtKB/TrEMBL
PRINTS	RASTRNSFRMNG	UniProtKB/TrEMBL
PROSITE	RAB	UniProtKB/TrEMBL
	RAS	UniProtKB/TrEMBL
	RHO	UniProtKB/TrEMBL
SMART	RAB	UniProtKB/TrEMBL
	RAN	UniProtKB/TrEMBL
	RAS	UniProtKB/TrEMBL
	RHO	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/TrEMBL
UniProt	A0A8C2V3A8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-08-08	Rras	RAS related		related RAS viral (r-ras) oncogene homolog	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)