Symbol: |
LOC102550708 |
Name: |
keratin-associated protein 19-3-like |
RGD ID: |
7616512 |
Description: |
|
Type: |
protein-coding
|
RefSeq Status: |
MODEL |
Previously known as: |
keratin-associated protein 19-8-like |
Latest Assembly: |
GRCr8 - GRCr8 Assembly |
Position: |
Rat Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
GRCr8 | 11 | 41,749,043 - 41,749,305 (-) | NCBI | | GRCr8 | | | mRatBN7.2 | 11 | 28,262,825 - 28,263,070 (-) | NCBI | mRatBN7.2 | mRatBN7.2 | | | Rnor_6.0 | 11 | 28,913,401 - 28,913,674 (-) | NCBI | Rnor6.0 | Rnor_6.0 | rn6 | Rnor6.0 | Rnor_5.0 | 11 | 32,532,545 - 32,532,790 (-) | NCBI | Rnor5.0 | Rnor_5.0 | rn5 | Rnor5.0 | Celera | 11 | 27,978,145 - 27,978,418 (-) | NCBI | | Celera | | | Cytogenetic Map | 11 | q11 | NCBI | | | | |
|
JBrowse: |
View Region in Genome Browser (JBrowse)
|
Model |
|
.
1300147 | Bp187 | Blood pressure QTL 187 | 3.67 | | arterial blood pressure trait (VT:2000000) | blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) | 11 | 1 | 69446234 | Rat | 724554 | Iddm17 | Insulin dependent diabetes mellitus QTL 17 | | 0.001 | blood glucose amount (VT:0000188) | blood glucose level (CMO:0000046) | 11 | 18976208 | 86241447 | Rat | 1598842 | Glom10 | Glomerulus QTL 10 | 3.4 | | kidney glomerulus morphology trait (VT:0005325) | index of glomerular damage (CMO:0001135) | 11 | 1 | 35331169 | Rat | 8694376 | Bw156 | Body weight QTL 156 | 2.25 | 0.001 | body lean mass (VT:0010483) | lean tissue morphological measurement (CMO:0002184) | 11 | 23280456 | 68280456 | Rat | 10755497 | Bp388 | Blood pressure QTL 388 | 2.76 | | arterial blood pressure trait (VT:2000000) | systolic blood pressure (CMO:0000004) | 11 | 19456205 | 76331918 | Rat | 724517 | Uae18 | Urinary albumin excretion QTL 18 | 3.7 | | urine albumin amount (VT:0002871) | urine albumin excretion rate (CMO:0000757) | 11 | 16472047 | 44285911 | Rat | 10058952 | Gmadr6 | Adrenal mass QTL 6 | 2.29 | 0.0072 | adrenal gland mass (VT:0010420) | both adrenal glands wet weight to body weight ratio (CMO:0002411) | 11 | 22959403 | 67959403 | Rat | 1558659 | Tescar1 | Testicular tumor resistance QTL 1 | 3.9 | | testis integrity trait (VT:0010572) | percentage of study population developing testis tumors during a period of time (CMO:0001261) | 11 | 1041931 | 66113562 | Rat | 724563 | Uae10 | Urinary albumin excretion QTL 10 | 6 | | urine albumin amount (VT:0002871) | urine albumin level (CMO:0000130) | 11 | 27672410 | 82846715 | Rat | 9589032 | Epfw10 | Epididymal fat weight QTL 10 | 9.29 | 0.001 | epididymal fat pad mass (VT:0010421) | epididymal fat pad weight to body weight ratio (CMO:0000658) | 11 | 23280456 | 68280456 | Rat | 9590313 | Scort20 | Serum corticosterone level QTL 20 | 6.51 | 0.001 | blood corticosterone amount (VT:0005345) | plasma corticosterone level (CMO:0001173) | 11 | 23280456 | 68280456 | Rat | 8694424 | Bw162 | Body weight QTL 162 | 3.8 | 0.001 | body lean mass (VT:0010483) | lean tissue morphological measurement (CMO:0002184) | 11 | 23280456 | 68280456 | Rat | 1641927 | Alcrsp10 | Alcohol response QTL 10 | | | alcohol metabolism trait (VT:0015089) | blood ethanol level (CMO:0000535) | 11 | 8436674 | 53436674 | Rat |
RefSeq Acc Id: |
XM_006248090 ⟹ XP_006248152 |
Type: |
CODING |
Position: |
Rat Assembly | Chr | Position (strand) | Source |
---|
GRCr8 | 11 | 41,749,043 - 41,749,305 (-) | NCBI | mRatBN7.2 | 11 | 28,262,825 - 28,263,070 (-) | NCBI | Rnor_6.0 | 11 | 28,913,401 - 28,913,674 (-) | NCBI | Rnor_5.0 | 11 | 32,532,545 - 32,532,790 (-) | NCBI |
|
Sequence: |
ACGAGAACTACTACTCCCAACACCATGAGCTACTACGGCGGCTACTACGGAGGTCTGGGCTATGGCTATGGTGGCTTCGGAGGCCTGGGCTGCGGCTATGGCTGTGGGTGTAGCAGCGTCCGCAGACT GGGCTACGGCTGTGGGTATGGAGGCTTTGGATATGGCTCTGGCTTCGGAGGCTACGGATATGGGTCTGGCTGTGGAGGCTACGGATATGGCTGCTGCCGCCCCTCATGCTATGGAGGATACGGGTTCT CCAGCTTCTATTGAATAA
hide sequence
|
RefSeq Acc Id: |
XM_039088731 ⟹ XP_038944659 |
Type: |
CODING |
Position: |
Rat Assembly | Chr | Position (strand) | Source |
---|
GRCr8 | 11 | 41,749,043 - 41,749,288 (-) | NCBI | mRatBN7.2 | 11 | 28,262,825 - 28,263,070 (-) | NCBI |
|
RefSeq Acc Id: |
XP_006248152 ⟸ XM_006248090 |
- Peptide Label: |
isoform X1 |
- Sequence: |
MSYYGGYYGGLGYGYGGFGGLGCGYGCGCSSVRRLGYGCGYGGFGYGSGFGGYGYGSGCGGYGYGCCRPSCYGGYGFSSFY
hide sequence
|
|
RefSeq Acc Id: |
XP_038944659 ⟸ XM_039088731 |
- Peptide Label: |
isoform X2 |
|
Date |
Current Symbol |
Current Name |
Previous Symbol |
Previous Name |
Description |
Reference |
Status |
2013-12-18 |
LOC102550708 |
keratin-associated protein 19-3-like |
|
|
Symbol and Name status set to provisional |
70820 |
PROVISIONAL |
|
|