Symbol:
Mbtps1
Name:
membrane-bound transcription factor peptidase, site 1
RGD ID:
737210
MGI Page
MGI
Description:
Enables serine-type endopeptidase activity. Involved in membrane protein intracellular domain proteolysis and mitotic G2 DNA damage checkpoint signaling. Acts upstream of or within lipid metabolic process. Located in Golgi stack. Is expressed in several structures, including ectoplacental cone; genitourinary system; liver; neural tube; and somite. Used to study idiopathic scoliosis. Human ortholog(s) of this gene implicated in spondyloepiphyseal dysplasia Kondo-Fu type. Orthologous to human MBTPS1 (membrane bound transcription factor peptidase, site 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
0610038M03Rik; AV003995; endopeptidase S1P; membrane-bound transcription factor protease, site 1; membrane-bound transcription factor site-1 protease; mKIAA0091; S; S1P; S1P endopeptidase; site-1 protease; SKI; SKI-1; Ski1; sterol-regulated luminal protease; subtilisin/kexin isozyme 1; subtilisin/kexin isozyme SKI-1; subtilisin/kexin isozyme-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MBTPS1 (membrane bound transcription factor peptidase, site 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Mbtps1 (membrane-bound transcription factor peptidase, site 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mbtps1 (membrane bound transcription factor peptidase, site 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MBTPS1 (membrane bound transcription factor peptidase, site 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MBTPS1 (membrane bound transcription factor peptidase, site 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mbtps1 (membrane bound transcription factor peptidase, site 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MBTPS1 (membrane bound transcription factor peptidase, site 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MBTPS1 (membrane bound transcription factor peptidase, site 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mbtps1 (membrane bound transcription factor peptidase, site 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Mbtps1 (membrane-bound transcription factor peptidase, site 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MBTPS1 (membrane bound transcription factor peptidase, site 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mbtps1 (membrane-bound transcription factor peptidase, site 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
S1P
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mbtps1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 120,234,890 - 120,285,603 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 120,234,895 - 120,285,474 (-) Ensembl GRCm39 Ensembl GRCm38 8 119,508,151 - 119,558,864 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 119,508,156 - 119,558,735 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 122,032,051 - 122,082,661 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 122,394,132 - 122,444,704 (-) NCBI MGSCv36 mm8 Celera 8 123,725,569 - 123,776,209 (-) NCBI Celera Cytogenetic Map 8 E1 NCBI cM Map 8 67.85 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mbtps1 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MBTPS1 mRNA CTD PMID:36331819 Mbtps1 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of MBTPS1 mRNA CTD PMID:22206623 Mbtps1 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of MBTPS1 mRNA CTD PMID:39298647 Mbtps1 Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO MBTPS1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Mbtps1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MBTPS1 mRNA CTD PMID:21570461 Mbtps1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Mbtps1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MBTPS1 mRNA CTD PMID:33387578 Mbtps1 Mouse 2,4,6-tribromophenol decreases expression ISO MBTPS1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Mbtps1 Mouse 3,3',5,5'-tetrabromobisphenol A decreases expression ISO MBTPS1 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of MBTPS1 protein CTD PMID:31675489 Mbtps1 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO MBTPS1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of MBTPS1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MBTPS1 mRNA CTD PMID:28628672 Mbtps1 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of MBTPS1 mRNA CTD PMID:39298647 Mbtps1 Mouse 4,4'-sulfonyldiphenol multiple interactions ISO Mbtps1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of MBTPS1 mRNA CTD PMID:36041667 Mbtps1 Mouse Aflatoxin B2 alpha increases methylation ISO MBTPS1 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of MBTPS1 intron CTD PMID:30157460 Mbtps1 Mouse all-trans-retinoic acid increases expression ISO MBTPS1 (Homo sapiens) 6480464 Tretinoin results in increased expression of MBTPS1 mRNA CTD PMID:23724009 Mbtps1 Mouse ammonium chloride affects expression ISO Mbtps1 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of MBTPS1 mRNA CTD PMID:16483693 Mbtps1 Mouse arsenite(3-) multiple interactions ISO MBTPS1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to MBTPS1 mRNA] CTD PMID:32406909 Mbtps1 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO MBTPS1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Mbtps1 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of MBTPS1 mRNA CTD PMID:33754040 Mbtps1 Mouse bisphenol A decreases expression ISO MBTPS1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of MBTPS1 mRNA and bisphenol A results in decreased expression of MBTPS1 protein CTD PMID:25047013 and PMID:31675489 Mbtps1 Mouse bisphenol A multiple interactions ISO Mbtps1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of MBTPS1 mRNA CTD PMID:36041667 Mbtps1 Mouse bisphenol A decreases methylation ISO MBTPS1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of MBTPS1 promoter CTD PMID:30352284 Mbtps1 Mouse bisphenol A increases expression ISO MBTPS1 (Homo sapiens) 6480464 bisphenol A results in increased expression of MBTPS1 mRNA CTD PMID:29275510 Mbtps1 Mouse bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of MBTPS1 promoter CTD PMID:27312807 Mbtps1 Mouse bisphenol A multiple interactions ISO MBTPS1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of MBTPS1 mRNA CTD PMID:28628672 Mbtps1 Mouse bisphenol A decreases expression ISO Mbtps1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of MBTPS1 mRNA CTD PMID:25181051 Mbtps1 Mouse bisphenol F multiple interactions ISO MBTPS1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MBTPS1 mRNA CTD PMID:28628672 Mbtps1 Mouse bisphenol F multiple interactions ISO Mbtps1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of MBTPS1 mRNA CTD PMID:36041667 Mbtps1 Mouse butanal decreases expression ISO MBTPS1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of MBTPS1 mRNA CTD PMID:26079696 Mbtps1 Mouse cadmium dichloride decreases expression ISO MBTPS1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of MBTPS1 mRNA CTD PMID:38568856 Mbtps1 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Mbtps1 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of MBTPS1 mRNA CTD PMID:32715474 and PMID:37019170 Mbtps1 Mouse cisplatin increases expression ISO MBTPS1 (Homo sapiens) 6480464 Cisplatin results in increased expression of MBTPS1 mRNA CTD PMID:27392435 Mbtps1 Mouse copper(II) sulfate decreases expression ISO MBTPS1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of MBTPS1 mRNA CTD PMID:19549813 Mbtps1 Mouse coumarin increases phosphorylation ISO MBTPS1 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of MBTPS1 protein CTD PMID:35688186 Mbtps1 Mouse crocidolite asbestos decreases expression EXP 6480464 Asbestos and Crocidolite results in decreased expression of MBTPS1 mRNA CTD PMID:29279043 Mbtps1 Mouse decabromodiphenyl ether decreases expression ISO MBTPS1 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of MBTPS1 protein CTD PMID:31675489 Mbtps1 Mouse deguelin decreases expression ISO MBTPS1 (Homo sapiens) 6480464 deguelin results in decreased expression of MBTPS1 mRNA CTD PMID:33512557 Mbtps1 Mouse dexamethasone multiple interactions ISO MBTPS1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of MBTPS1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MBTPS1 mRNA CTD PMID:28628672 Mbtps1 Mouse Dibutyl phosphate affects expression ISO MBTPS1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MBTPS1 mRNA CTD PMID:37042841 Mbtps1 Mouse dibutyl phthalate decreases expression ISO Mbtps1 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of MBTPS1 mRNA CTD PMID:21266533 Mbtps1 Mouse dicyclanil increases expression EXP 6480464 dicyclanil results in increased expression of MBTPS1 mRNA CTD PMID:15664270 Mbtps1 Mouse dimethylarsinic acid increases expression ISO Mbtps1 (Rattus norvegicus) 6480464 Cacodylic Acid results in increased expression of MBTPS1 mRNA CTD PMID:16122865 Mbtps1 Mouse doxorubicin decreases expression ISO Mbtps1 (Rattus norvegicus) 6480464 Doxorubicin results in decreased expression of MBTPS1 mRNA CTD PMID:39218162 Mbtps1 Mouse endosulfan affects expression ISO Mbtps1 (Rattus norvegicus) 6480464 Endosulfan affects the expression of MBTPS1 mRNA CTD PMID:31464424 Mbtps1 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of MBTPS1 mRNA CTD PMID:30319688 Mbtps1 Mouse flavonoids decreases expression ISO Mbtps1 (Rattus norvegicus) 6480464 Flavonoids results in decreased expression of MBTPS1 mRNA CTD PMID:18035473 Mbtps1 Mouse flutamide decreases expression ISO Mbtps1 (Rattus norvegicus) 6480464 Flutamide results in decreased expression of MBTPS1 mRNA CTD PMID:24793618 Mbtps1 Mouse gentamycin decreases expression ISO Mbtps1 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of MBTPS1 mRNA CTD PMID:33387578 Mbtps1 Mouse indometacin multiple interactions ISO MBTPS1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of MBTPS1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MBTPS1 mRNA CTD PMID:28628672 Mbtps1 Mouse isobutanol multiple interactions ISO MBTPS1 (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of MBTPS1 mRNA CTD PMID:29432896 Mbtps1 Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of MBTPS1 mRNA CTD PMID:35964746 Mbtps1 Mouse ozone multiple interactions ISO MBTPS1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of MBTPS1 mRNA CTD PMID:35430440 Mbtps1 Mouse paracetamol decreases expression ISO Mbtps1 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of MBTPS1 mRNA CTD PMID:33387578 Mbtps1 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MBTPS1 mRNA CTD PMID:36331819 Mbtps1 Mouse phenylpropanolamine decreases expression EXP 6480464 Phenylpropanolamine results in decreased expression of MBTPS1 mRNA CTD PMID:16465460 Mbtps1 Mouse pirinixic acid multiple interactions ISO MBTPS1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of MBTPS1 mRNA CTD PMID:19710929 Mbtps1 Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of MBTPS1 mRNA CTD PMID:18445702 Mbtps1 Mouse pyrogallol increases expression EXP 6480464 Pyrogallol results in increased expression of MBTPS1 mRNA CTD PMID:20362636 Mbtps1 Mouse rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of MBTPS1 mRNA CTD PMID:23186747 Mbtps1 Mouse rotenone decreases expression ISO MBTPS1 (Homo sapiens) 6480464 Rotenone results in decreased expression of MBTPS1 mRNA CTD PMID:33512557 Mbtps1 Mouse sodium arsenite decreases expression ISO MBTPS1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MBTPS1 mRNA CTD PMID:38568856 Mbtps1 Mouse T-2 toxin decreases expression ISO MBTPS1 (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of MBTPS1 mRNA CTD PMID:31863870 and PMID:34581912 Mbtps1 Mouse tert-butyl hydroperoxide decreases expression ISO MBTPS1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of MBTPS1 mRNA CTD PMID:15336504 Mbtps1 Mouse thiram decreases expression ISO MBTPS1 (Homo sapiens) 6480464 Thiram results in decreased expression of MBTPS1 mRNA CTD PMID:38568856 Mbtps1 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of MBTPS1 gene CTD PMID:35295148 Mbtps1 Mouse triphenyl phosphate affects expression ISO MBTPS1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MBTPS1 mRNA CTD PMID:37042841 Mbtps1 Mouse troglitazone increases expression EXP 6480464 troglitazone results in increased expression of MBTPS1 mRNA CTD PMID:28973697 Mbtps1 Mouse zinc atom increases expression ISO MBTPS1 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of MBTPS1 mRNA CTD PMID:18356318 Mbtps1 Mouse zinc(0) increases expression ISO MBTPS1 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of MBTPS1 mRNA CTD PMID:18356318
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (EXP) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) ammonium chloride (ISO) arsenite(3-) (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) cadmium dichloride (ISO) carbon nanotube (EXP) chlorpyrifos (EXP) cisplatin (ISO) copper(II) sulfate (ISO) coumarin (ISO) crocidolite asbestos (EXP) decabromodiphenyl ether (ISO) deguelin (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicyclanil (EXP) dimethylarsinic acid (ISO) doxorubicin (ISO) endosulfan (ISO) ethanol (EXP) flavonoids (ISO) flutamide (ISO) gentamycin (ISO) indometacin (ISO) isobutanol (ISO) nitrates (EXP) ozone (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (EXP) phenylpropanolamine (EXP) pirinixic acid (EXP,ISO) pyrogallol (EXP) rotenone (EXP,ISO) sodium arsenite (ISO) T-2 toxin (ISO) tert-butyl hydroperoxide (ISO) thiram (ISO) titanium dioxide (EXP) triphenyl phosphate (ISO) troglitazone (EXP) zinc atom (ISO) zinc(0) (ISO)
1.
Mouse brain organization revealed through direct genome-scale TF expression analysis.
Gray PA, etal., Science 2004 Dec 24;306(5705):2255-7.
2.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
3.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
MGD IEA
MGD IEA
6.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
7.
Evolutionary conservation and adaptation in the mechanism that regulates SREBP action: what a long, strange tRIP it's been.
Osborne TF and Espenshade PJ, Genes Dev. 2009 Nov 15;23(22):2578-91.
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Mammalian subtilisin/kexin isozyme SKI-1: A widely expressed proprotein convertase with a unique cleavage specificity and cellular localization.
Seidah NG, etal., Proc Natl Acad Sci U S A 1999 Feb 16;96(4):1321-6.
Mbtps1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 120,234,890 - 120,285,603 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 120,234,895 - 120,285,474 (-) Ensembl GRCm39 Ensembl GRCm38 8 119,508,151 - 119,558,864 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 119,508,156 - 119,558,735 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 122,032,051 - 122,082,661 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 122,394,132 - 122,444,704 (-) NCBI MGSCv36 mm8 Celera 8 123,725,569 - 123,776,209 (-) NCBI Celera Cytogenetic Map 8 E1 NCBI cM Map 8 67.85 NCBI
MBTPS1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 84,053,763 - 84,116,942 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 84,053,761 - 84,116,942 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 84,087,368 - 84,150,547 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 82,644,869 - 82,708,018 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 82,644,871 - 82,708,018 NCBI Celera 16 68,389,268 - 68,452,435 (-) NCBI Celera Cytogenetic Map 16 q23.3-q24.1 NCBI HuRef 16 69,841,352 - 69,904,502 (-) NCBI HuRef CHM1_1 16 85,498,381 - 85,561,902 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 90,119,889 - 90,190,524 (-) NCBI T2T-CHM13v2.0
Mbtps1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 64,470,245 - 64,521,438 (-) NCBI GRCr8 mRatBN7.2 19 47,561,598 - 47,612,769 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 47,561,598 - 47,612,791 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 54,356,280 - 54,407,076 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 55,037,157 - 55,087,952 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 57,250,566 - 57,301,596 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 52,146,507 - 52,206,310 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 52,146,808 - 52,206,310 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 62,894,989 - 62,954,792 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 49,751,424 - 49,802,700 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 49,756,304 - 49,807,581 (-) NCBI Celera 19 46,820,963 - 46,871,847 (-) NCBI Celera Cytogenetic Map 19 q12 NCBI
Mbtps1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955564 176,230 - 228,587 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955564 176,230 - 226,555 (+) NCBI ChiLan1.0 ChiLan1.0
MBTPS1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 93,800,904 - 93,863,994 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 99,718,041 - 99,781,111 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 64,719,971 - 64,783,119 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 84,063,508 - 84,126,000 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 84,063,508 - 84,126,000 (-) Ensembl panpan1.1 panPan2
MBTPS1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 68,228,176 - 68,281,175 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 68,228,238 - 68,280,515 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 68,242,379 - 68,295,248 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 68,526,299 - 68,579,190 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 68,526,329 - 68,579,190 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 68,474,058 - 68,526,939 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 68,310,640 - 68,363,509 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 68,726,354 - 68,779,243 (+) NCBI UU_Cfam_GSD_1.0
Mbtps1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 27,942,920 - 27,998,011 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936641 3,696,536 - 3,751,598 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936641 3,696,506 - 3,751,558 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MBTPS1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 4,503,565 - 4,558,609 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 4,503,530 - 4,558,601 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 5,085,217 - 5,140,266 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MBTPS1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 69,464,064 - 69,527,588 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 69,463,920 - 69,527,541 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 6,231,679 - 6,295,208 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mbtps1
.
Predicted Target Of
Count of predictions: 344 Count of miRNA genes: 158 Interacting mature miRNAs: 164 Transcripts: ENSMUST00000081381, ENSMUST00000098362 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1357494 Obsty2_m obesity 2 (mouse) Not determined 8 96245241 129745061 Mouse 4141435 Fbtq3_m femoral bone trait QTL 3 (mouse) Not determined 8 100965309 130127694 Mouse 12904960 Gmmq6_m gastrocnemius muscle mass QTL 6 (mouse) 8 111481497 130127694 Mouse 11252141 Fdr2_m fat response to dietary restriction 2 (mouse) 8 98390634 130127694 Mouse 10045619 Heal14_m wound healing/regeneration 14 (mouse) Not determined 8 86443553 120443701 Mouse 1302105 Im1_m Immunoregulatory 1 (mouse) Not determined 8 99828531 130127694 Mouse 12880431 Fgf23lq2_m FGF23 serum level QTL 2 (mouse) 8 97626632 130127694 Mouse 1301080 Sluc9_m susceptibility to lung cancer 9 (mouse) Not determined 8 99828531 130127694 Mouse 10412274 Leci1_m leukocyte endothelial cell interactions 1 (mouse) Not determined 8 110415083 130127694 Mouse 12904938 Edlmmq7_m extensor digitorum longus muscle mass QTL 7 (mouse) 8 111481497 130127694 Mouse 10412273 Fcd1_m functional capillary density 1 (mouse) Not determined 8 110415083 130127694 Mouse 1302049 Heal1_m wound healing/regeneration 1 (mouse) Not determined 8 86443553 120443701 Mouse 27226796 Scvln16_m sacral vertebrae length 2, 16 week (mouse) 8 89726628 130027694 Mouse 14746994 Manh65_m mandible shape 65 (mouse) 8 106489629 130127694 Mouse 27095912 Pglq14_m pelvic girdle length QTL 14, 16 week (mouse) 8 74126628 126826739 Mouse 4141546 Mrdq3_m modifier of retinal degeneration QTL 3 (mouse) Not determined 114439420 126055880 Mouse 1301253 Skmw2_m skeletal muscle weight 2 (mouse) Not determined 8 86443553 120443701 Mouse 1301316 Dntcs1_m dental caries susceptibility 1 (mouse) Not determined 8 103443553 127781786 Mouse 1357708 Orq1_m ovulation rate QTL 1 (mouse) Not determined 8 71740461 124622354 Mouse 4142023 W3q5_m weight 3 weeks QTL 5 (mouse) Not determined 71740461 124622354 Mouse 1301481 Lith11_m lithogenic gene 11 (mouse) Not determined 8 98563635 130127694 Mouse 11532692 Sluc38a_m susceptibility to lung cancer 38a (mouse) 8 105033977 130127694 Mouse 11532691 Sluc38_m susceptibility to lung cancer 38 (mouse) 8 105033977 130127694 Mouse
AV003995
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 119,547,241 - 119,547,343 UniSTS GRCm38 MGSCv37 8 122,071,141 - 122,071,243 UniSTS GRCm37 Celera 8 123,764,689 - 123,764,791 UniSTS Cytogenetic Map 8 E1 UniSTS Whitehead/MRC_RH 8 1411.74 UniSTS
UniSTS:225106
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 119,547,549 - 119,547,723 UniSTS GRCm38 MGSCv37 8 122,071,449 - 122,071,623 UniSTS GRCm37 Celera 8 123,764,997 - 123,765,171 UniSTS Cytogenetic Map 8 E1 UniSTS
PMC61088P1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 119,547,860 - 119,548,246 UniSTS GRCm38 MGSCv37 8 122,071,760 - 122,072,146 UniSTS GRCm37 Celera 8 123,765,308 - 123,765,694 UniSTS Cytogenetic Map 8 E1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000081381 ⟹ ENSMUSP00000080117
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 120,234,895 - 120,285,474 (-) Ensembl GRCm38.p6 Ensembl 8 119,508,156 - 119,558,735 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000098362 ⟹ ENSMUSP00000095965
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 120,234,895 - 120,285,466 (-) Ensembl GRCm38.p6 Ensembl 8 119,508,156 - 119,558,727 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000212082
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 120,240,389 - 120,242,394 (-) Ensembl GRCm38.p6 Ensembl 8 119,513,650 - 119,515,655 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000212244
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 120,264,650 - 120,265,705 (-) Ensembl GRCm38.p6 Ensembl 8 119,537,911 - 119,538,966 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000212290
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 120,248,155 - 120,252,136 (-) Ensembl GRCm38.p6 Ensembl 8 119,521,416 - 119,525,397 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000212601
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 120,234,895 - 120,285,444 (-) Ensembl GRCm38.p6 Ensembl 8 119,508,156 - 119,558,705 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000212685
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 120,234,895 - 120,285,474 (-) Ensembl GRCm38.p6 Ensembl 8 119,508,156 - 119,558,735 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000212736
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 120,237,004 - 120,242,582 (-) Ensembl GRCm38.p6 Ensembl 8 119,510,265 - 119,515,843 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000212813
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 120,273,828 - 120,285,180 (-) Ensembl GRCm38.p6 Ensembl 8 119,547,089 - 119,558,441 (-) Ensembl
RefSeq Acc Id:
NM_001167910 ⟹ NP_001161382
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 120,234,890 - 120,285,500 (-) NCBI GRCm38 8 119,508,151 - 119,558,761 (-) NCBI MGSCv37 8 122,032,051 - 122,082,661 (-) RGD Celera 8 123,725,569 - 123,776,209 (-) RGD cM Map 8 ENTREZGENE
Sequence:
GGCGTGGTCTCGCGAGACTTGCGAGTAAACATCCCCCGAATGGAGACCCGAGGCGTGTTCGCGGCGGAGCCGCCGTTCTCCCGGGTCCGCCGACCCCGAGCCTGAGGCGGACGCAGGTCCGCTACAGA
hide sequence
RefSeq Acc Id:
NM_019709 ⟹ NP_062683
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 120,234,890 - 120,285,500 (-) NCBI GRCm38 8 119,508,151 - 119,558,761 (-) NCBI MGSCv37 8 122,032,051 - 122,082,661 (-) RGD Celera 8 123,725,569 - 123,776,209 (-) RGD cM Map 8 ENTREZGENE
Sequence:
GGCGTGGTCTCGCGAGACTTGCGAGTAAACATCCCCCGAATGGAGACCCGAGGCGTGTTCGCGG
hide sequence
RefSeq Acc Id:
XM_011248449 ⟹ XP_011246751
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 120,234,894 - 120,285,554 (-) NCBI GRCm38 8 119,508,155 - 119,558,820 (-) NCBI
Sequence:
AGGTCGCGGGCGCGCAGAGCACGCCGGGCCGTCGTAACCCCCCCACGCCCCAGCGGCGTGGTCTCGCGAGACTTGCGAGTAAACATCCCCCGAATGGAGACCCGAGGCGTGTTCGCGGCGGAGCCGCC
hide sequence
RefSeq Acc Id:
XM_011248450 ⟹ XP_011246752
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 120,234,894 - 120,285,229 (-) NCBI GRCm38 8 119,508,155 - 119,558,491 (-) NCBI
Sequence:
GGTGCGCAAGCGCCGTTCGCCTCCGCAGGGCCCTGCGGTCGCGAGCCCCGGGGAACCGAGCTGC
hide sequence
RefSeq Acc Id:
XM_011248451 ⟹ XP_011246753
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 120,234,895 - 120,285,588 (-) NCBI GRCm38 8 119,508,158 - 119,558,845 (-) NCBI
Sequence:
CGCCTCGGTGCCGGGCCGTCAGGAGCGCGCACGCAGGTCGCGGGCGCGCAGAGCACGCCGGGCC
hide sequence
RefSeq Acc Id:
XM_030243691 ⟹ XP_030099551
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 120,234,894 - 120,285,207 (-) NCBI GRCm38 8 119,508,155 - 119,558,465 (-) NCBI
Sequence:
CCGCAGGGCCCTGCGGTCGCGAGCCCCGGGGAACCGAGCTGCAGCTCAGTGCACATCGCGGCTCGGACTCGCATTTGCTAATTCGGCCCCTGCCTAGTTTGTAAACATCAGCGATCTCTCCTGCACAG
hide sequence
RefSeq Acc Id:
XM_030243692 ⟹ XP_030099552
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 120,234,895 - 120,285,500 (-) NCBI GRCm38 8 119,508,158 - 119,558,761 (-) NCBI
Sequence:
GGCGTGGTCTCGCGAGACTTGCGAGTAAACATCCCCCGAATGGAGACCCGAGGCGTGTTCGCGGCGGAGCCGCCGTTCTCCCGGGTCCGCCGACCCCGAGCCTGAGGCGGACGCAGGTCCGCTACAGA
hide sequence
RefSeq Acc Id:
XM_036154193 ⟹ XP_036010086
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 120,234,895 - 120,285,229 (-) NCBI
Sequence:
GGTGCGCAAGCGCCGTTCGCCTCCGCAGGGCCCTGCGGTCGCGAGCCCCGGGGAACCGAGCTGC
hide sequence
RefSeq Acc Id:
XR_878851
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 120,234,890 - 120,285,603 (-) NCBI GRCm38 8 119,515,623 - 119,558,864 (-) NCBI
Sequence:
CTCCGCACAGCCTCTCGCCTCGGTGCCGGGCCGTCAGGAGCGCGCACGCAGGTCGCGGGCGCGC
hide sequence
RefSeq Acc Id:
NP_062683 ⟸ NM_019709
- Peptide Label:
precursor
- UniProtKB:
Q6PG67 (UniProtKB/Swiss-Prot), Q9WTZ2 (UniProtKB/Swiss-Prot), A3QWY0 (UniProtKB/TrEMBL)
- Sequence:
MKLVSTWLLVLVVLLCGKRHLGDRLGTRALEKAPCPSCSHLTLKVEFSSTVVEYEYIVAFNGYFTAKARNSFISSALKSSEVENWRIIPRNNPSSDYPSDFEVIQIKEKQKAGLLTLEDHPNIKRVTP
hide sequence
RefSeq Acc Id:
NP_001161382 ⟸ NM_001167910
- Peptide Label:
precursor
- UniProtKB:
Q6PG67 (UniProtKB/Swiss-Prot), Q9WTZ2 (UniProtKB/Swiss-Prot), A3QWY0 (UniProtKB/TrEMBL)
- Sequence:
MKLVSTWLLVLVVLLCGKRHLGDRLGTRALEKAPCPSCSHLTLKVEFSSTVVEYEYIVAFNGYF
hide sequence
RefSeq Acc Id:
XP_011246753 ⟸ XM_011248451
- Peptide Label:
isoform X2
- UniProtKB:
A3QWY0 (UniProtKB/TrEMBL)
- Sequence:
MKLVSTWLLVLVVLLCGKRHLGDRLGTRALEKAPCPSCSHLTLKVEFSSTVVEYEYIVAFNGYFTAKARNSFISSALKSSEVENWRIIPRNNPSSDYPSDFEVIQIKEKQKAGLLTLEDHPNIKRVTP
hide sequence
RefSeq Acc Id:
XP_011246751 ⟸ XM_011248449
- Peptide Label:
isoform X1
- UniProtKB:
Q6PG67 (UniProtKB/Swiss-Prot), Q9WTZ2 (UniProtKB/Swiss-Prot), A3QWY0 (UniProtKB/TrEMBL)
- Sequence:
MKLVSTWLLVLVVLLCGKRHLGDRLGTRALEKAPCPSCSHLTLKVEFSSTVVEYEYIVAFNGYF
hide sequence
RefSeq Acc Id:
XP_011246752 ⟸ XM_011248450
- Peptide Label:
isoform X1
- UniProtKB:
Q6PG67 (UniProtKB/Swiss-Prot), Q9WTZ2 (UniProtKB/Swiss-Prot), A3QWY0 (UniProtKB/TrEMBL)
- Sequence:
MKLVSTWLLVLVVLLCGKRHLGDRLGTRALEKAPCPSCSHLTLKVEFSSTVVEYEYIVAFNGYFTAKARNSFISSALKSSEVENWRIIPRNNPSSDYPSDFEVIQIKEKQKAGLLTLEDHPNIKRVTP
hide sequence
RefSeq Acc Id:
XP_030099551 ⟸ XM_030243691
- Peptide Label:
isoform X1
- UniProtKB:
Q9WTZ2 (UniProtKB/Swiss-Prot), Q6PG67 (UniProtKB/Swiss-Prot), A3QWY0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_030099552 ⟸ XM_030243692
- Peptide Label:
isoform X3
Ensembl Acc Id:
ENSMUSP00000080117 ⟸ ENSMUST00000081381
Ensembl Acc Id:
ENSMUSP00000095965 ⟸ ENSMUST00000098362
RefSeq Acc Id:
XP_036010086 ⟸ XM_036154193
- Peptide Label:
isoform X2
- UniProtKB:
A3QWY0 (UniProtKB/TrEMBL)
RGD ID: 8668417 Promoter ID: EPDNEW_M12239 Type: multiple initiation site Name: Mbtps1_1 Description: Mus musculus membrane-bound transcription factor peptidase, site1 , transcript variant 2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 8 119,558,747 - 119,558,807 EPDNEW
RGD ID: 6842607 Promoter ID: MM_KWN:55897 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000093102, NM_001167910, NM_019709 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 122,082,251 - 122,083,382 (-) MPROMDB
