Symbol:
Gjb5
Name:
gap junction protein, beta 5
RGD ID:
736420
MGI Page
MGI
Description:
Predicted to enable gap junction channel activity. Acts upstream of or within labyrinthine layer morphogenesis; spongiotrophoblast differentiation; and trophoblast giant cell differentiation. Predicted to be part of connexin complex. Is expressed in several structures, including early conceptus; reproductive system; sensory organ; and skin. Orthologous to human GJB5 (gap junction protein beta 5).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Cnx31.; Cnx31.1; connexin 31.1; connexin a; connexin-31.1; Cx31.1; Cxna; gap junction beta-5 protein; gap junction membrane channel protein beta 5; Gjb-5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GJB5 (gap junction protein beta 5) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Gjb5 (gap junction protein, beta 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gjb5 (gap junction protein beta 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GJB5 (gap junction protein beta 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GJB5 (gap junction protein beta 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gjb5 (gap junction protein beta 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GJB5 (gap junction protein beta 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GJB5 (gap junction protein beta 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gjb5 (gap junction protein beta 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GJB4 (gap junction protein beta 4) HGNC
OrthoDB
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Gjb5 (gap junction protein, beta 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GJB5 (gap junction protein beta 5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cx34.4 (connexin 34.4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PhylomeDB)
Danio rerio (zebrafish):
cx28.6 (connexin 28.6)
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
cx30.9 (connexin 30.9)
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
gjb4
Alliance
DIOPT (Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 127,248,600 - 127,251,957 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 127,248,602 - 127,251,974 (-) Ensembl GRCm39 Ensembl GRCm38 4 127,354,809 - 127,358,164 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 127,354,809 - 127,358,181 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 127,032,053 - 127,035,408 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 126,857,113 - 126,860,468 (-) NCBI MGSCv36 mm8 Celera 4 125,689,190 - 125,692,545 (-) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 61.51 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gjb5 Mouse 1,2,4-trimethylbenzene decreases expression ISO Gjb5 (Rattus norvegicus) 6480464 pseudocumene results in decreased expression of GJB5 protein CTD PMID:17337753 Gjb5 Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of GJB5 mRNA CTD PMID:28960355 Gjb5 Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of GJB5 mRNA CTD PMID:17555576 Gjb5 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GJB5 mRNA CTD PMID:17942748 Gjb5 Mouse 17alpha-ethynylestradiol increases expression ISO Gjb5 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in increased expression of GJB5 mRNA CTD PMID:15212814 Gjb5 Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of GJB5 mRNA CTD PMID:17942748 Gjb5 Mouse 17beta-estradiol multiple interactions ISO Gjb5 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of GJB5 mRNA CTD PMID:26496021 Gjb5 Mouse 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO Gjb5 (Rattus norvegicus) 6480464 2 more ... CTD PMID:27291303 Gjb5 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GJB5 mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to GJB5 promoter] CTD PMID:17942748 and PMID:19654925 Gjb5 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2 more ... CTD PMID:38648751 Gjb5 Mouse 6-propyl-2-thiouracil increases expression ISO Gjb5 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of GJB5 mRNA CTD PMID:24780913 Gjb5 Mouse 7,12-dimethyltetraphene multiple interactions EXP 6480464 [9 more ... CTD PMID:7586191 Gjb5 Mouse 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:32553695 Gjb5 Mouse all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of GJB5 mRNA CTD PMID:16604517 Gjb5 Mouse ammonium chloride affects expression ISO Gjb5 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of GJB5 mRNA CTD PMID:16483693 Gjb5 Mouse antirheumatic drug decreases expression ISO GJB5 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of GJB5 mRNA CTD PMID:24449571 Gjb5 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene metabolite results in increased expression of GJB5 mRNA CTD PMID:32553695 Gjb5 Mouse benzo[a]pyrene decreases expression ISO Gjb5 (Rattus norvegicus) 6480464 Benzo(a)pyrene results in decreased expression of GJB5 mRNA CTD PMID:34283317 Gjb5 Mouse benzo[a]pyrene decreases methylation ISO GJB5 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of GJB5 5' UTR CTD PMID:27901495 Gjb5 Mouse benzo[a]pyrene affects methylation ISO GJB5 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GJB5 promoter CTD PMID:27901495 Gjb5 Mouse Benzoyl peroxide decreases expression EXP 6480464 Benzoyl Peroxide results in decreased expression of GJB5 mRNA CTD PMID:8597533 Gjb5 Mouse bisphenol A multiple interactions ISO Gjb5 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of GJB5 mRNA CTD PMID:26496021 Gjb5 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GJB5 mRNA CTD PMID:32156529 Gjb5 Mouse bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of GJB5 promoter CTD PMID:27312807 Gjb5 Mouse bisphenol A affects methylation ISO Gjb5 (Rattus norvegicus) 6480464 bisphenol A affects the methylation of GJB5 promoter CTD PMID:27415467 Gjb5 Mouse bisphenol A increases expression ISO Gjb5 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of GJB5 mRNA CTD PMID:30816183 and PMID:32528016 Gjb5 Mouse bisphenol A decreases expression ISO Gjb5 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of GJB5 mRNA CTD PMID:25181051 Gjb5 Mouse C60 fullerene decreases expression ISO Gjb5 (Rattus norvegicus) 6480464 fullerene C60 results in decreased expression of GJB5 mRNA CTD PMID:19167457 Gjb5 Mouse cisplatin decreases expression ISO GJB5 (Homo sapiens) 6480464 Cisplatin results in decreased expression of GJB5 mRNA CTD PMID:27392435 Gjb5 Mouse cocaine decreases expression ISO Gjb5 (Rattus norvegicus) 6480464 Cocaine results in decreased expression of GJB5 mRNA CTD PMID:27899881 Gjb5 Mouse cyproconazole decreases expression EXP 6480464 cyproconazole results in decreased expression of GJB5 mRNA CTD PMID:22045034 Gjb5 Mouse DDE decreases expression ISO GJB5 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of GJB5 mRNA CTD PMID:38568856 Gjb5 Mouse decabromodiphenyl ether increases expression ISO Gjb5 (Rattus norvegicus) 6480464 decabromobiphenyl ether results in increased expression of GJB5 mRNA CTD PMID:23914054 Gjb5 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of GJB5 mRNA CTD PMID:25006883 Gjb5 Mouse genistein increases expression EXP 6480464 Genistein results in increased expression of GJB5 mRNA CTD PMID:32186404 Gjb5 Mouse graphite affects expression ISO Gjb5 (Rattus norvegicus) 6480464 Graphite affects the expression of GJB5 mRNA CTD PMID:29933104 Gjb5 Mouse hexaconazole decreases expression EXP 6480464 hexaconazole results in decreased expression of GJB5 mRNA CTD PMID:22045034 Gjb5 Mouse manganese(II) chloride increases expression ISO Gjb5 (Rattus norvegicus) 6480464 manganese chloride results in increased expression of GJB5 mRNA CTD PMID:28801915 Gjb5 Mouse methylmercury chloride affects expression EXP 6480464 methylmercuric chloride affects the expression of GJB5 mRNA CTD PMID:21613230 Gjb5 Mouse N-methyl-4-phenylpyridinium increases expression ISO Gjb5 (Rattus norvegicus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of GJB5 mRNA CTD PMID:28801915 Gjb5 Mouse naphthalene increases expression EXP 6480464 naphthalene results in increased expression of GJB5 mRNA CTD PMID:18978301 Gjb5 Mouse okadaic acid decreases expression EXP 6480464 Okadaic Acid results in decreased expression of GJB5 mRNA CTD PMID:8597533 Gjb5 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of GJB5 mRNA CTD PMID:34911549 Gjb5 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of GJB5 mRNA CTD PMID:17562736 Gjb5 Mouse paracetamol increases expression ISO GJB5 (Homo sapiens) 6480464 Acetaminophen results in increased expression of GJB5 mRNA CTD PMID:29067470 Gjb5 Mouse paraquat increases expression ISO Gjb5 (Rattus norvegicus) 6480464 Paraquat results in increased expression of GJB5 mRNA CTD PMID:32680482 Gjb5 Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of GJB5 mRNA CTD PMID:19136022 Gjb5 Mouse phorbol 13-acetate 12-myristate multiple interactions EXP 6480464 [9 more ... CTD PMID:7586191 Gjb5 Mouse phorbol 13-acetate 12-myristate decreases expression EXP 6480464 Tetradecanoylphorbol Acetate results in decreased expression of GJB5 mRNA and Tetradecanoylphorbol Acetate results in decreased expression of GJB5 protein CTD PMID:7586191 and PMID:8597533 Gjb5 Mouse pirinixic acid multiple interactions EXP 6480464 NCF1 protein inhibits the reaction [pirinixic acid results in decreased expression of GJB5 mRNA] CTD PMID:17950772 Gjb5 Mouse pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of GJB5 mRNA CTD PMID:19136022 Gjb5 Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of GJB5 mRNA CTD PMID:17950772 Gjb5 Mouse propanal increases expression ISO GJB5 (Homo sapiens) 6480464 propionaldehyde results in increased expression of GJB5 mRNA CTD PMID:26079696 Gjb5 Mouse sodium arsenite multiple interactions ISO GJB5 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of and affects the splicing of GJB5 mRNA CTD PMID:25879800 Gjb5 Mouse sodium arsenite decreases expression ISO GJB5 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of GJB5 mRNA CTD PMID:38568856 Gjb5 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of GJB5 mRNA CTD PMID:17555576 Gjb5 Mouse thiram decreases expression ISO GJB5 (Homo sapiens) 6480464 Thiram results in decreased expression of GJB5 mRNA CTD PMID:38568856 Gjb5 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of GJB5 mRNA CTD PMID:23557971 Gjb5 Mouse undecane decreases expression ISO Gjb5 (Rattus norvegicus) 6480464 undecane results in decreased expression of GJB5 protein CTD PMID:17337753 Gjb5 Mouse valproic acid increases methylation ISO GJB5 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of GJB5 gene CTD PMID:29154799
1,2,4-trimethylbenzene (ISO) 1,2-dichloroethane (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 6-propyl-2-thiouracil (ISO) 7,12-dimethyltetraphene (EXP) all-trans-retinoic acid (EXP) ammonium chloride (ISO) antirheumatic drug (ISO) benzo[a]pyrene (EXP,ISO) Benzoyl peroxide (EXP) bisphenol A (EXP,ISO) C60 fullerene (ISO) cisplatin (ISO) cocaine (ISO) cyproconazole (EXP) DDE (ISO) decabromodiphenyl ether (ISO) folic acid (EXP) genistein (EXP) graphite (ISO) hexaconazole (EXP) manganese(II) chloride (ISO) methylmercury chloride (EXP) N-methyl-4-phenylpyridinium (ISO) naphthalene (EXP) okadaic acid (EXP) ozone (EXP) paracetamol (EXP,ISO) paraquat (ISO) phenobarbital (EXP) phorbol 13-acetate 12-myristate (EXP) pirinixic acid (EXP) propanal (ISO) sodium arsenite (ISO) tamoxifen (EXP) thiram (ISO) titanium dioxide (EXP) undecane (ISO) valproic acid (ISO)
1.
Four novel members of the connexin family of gap junction proteins. Molecular cloning, expression, and chromosome mapping.
Haefliger JA, etal., J Biol Chem 1992 Jan 25;267(3):2057-64.
2.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
3.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
6.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Gjb5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 127,248,600 - 127,251,957 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 127,248,602 - 127,251,974 (-) Ensembl GRCm39 Ensembl GRCm38 4 127,354,809 - 127,358,164 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 127,354,809 - 127,358,181 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 127,032,053 - 127,035,408 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 126,857,113 - 126,860,468 (-) NCBI MGSCv36 mm8 Celera 4 125,689,190 - 125,692,545 (-) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 61.51 NCBI
GJB5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 34,755,047 - 34,758,512 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 34,755,047 - 34,758,512 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 35,220,648 - 35,224,113 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 34,993,308 - 34,996,699 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 34,889,813 - 34,893,205 NCBI Celera 1 33,494,445 - 33,497,836 (+) NCBI Celera Cytogenetic Map 1 p34.3 NCBI HuRef 1 33,338,163 - 33,341,628 (+) NCBI HuRef CHM1_1 1 35,336,342 - 35,339,807 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 34,617,685 - 34,621,150 (+) NCBI T2T-CHM13v2.0
Gjb5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 144,965,133 - 144,968,051 (-) NCBI GRCr8 mRatBN7.2 5 139,680,670 - 139,683,588 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 139,680,671 - 139,683,583 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 142,376,076 - 142,376,891 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 144,146,067 - 144,146,882 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 144,146,880 - 144,147,695 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 145,422,034 - 145,440,558 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 145,422,357 - 145,423,172 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 149,190,009 - 149,193,107 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 146,802,849 - 146,803,664 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 146,812,887 - 146,813,703 (-) NCBI Celera 5 138,175,690 - 138,176,505 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
Gjb5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 12,867,200 - 12,870,427 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 12,867,200 - 12,870,427 (+) NCBI ChiLan1.0 ChiLan1.0
GJB5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 192,087,232 - 192,090,729 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 191,208,376 - 191,211,883 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 34,022,109 - 34,025,606 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 35,203,658 - 35,207,134 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 35,205,953 - 35,206,774 (+) Ensembl panpan1.1 panPan2
GJB5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 7,196,720 - 7,199,652 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 7,436,219 - 7,439,149 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 7,342,877 - 7,345,807 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 7,343,120 - 7,343,941 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 7,205,189 - 7,208,117 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 7,253,201 - 7,256,124 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 7,267,421 - 7,270,351 (-) NCBI UU_Cfam_GSD_1.0
Gjb5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 51,577,747 - 51,581,737 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 17,405,000 - 17,405,809 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 17,402,804 - 17,406,080 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GJB5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 91,002,163 - 91,002,984 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 90,999,514 - 91,003,301 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 78,819,323 - 78,823,093 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GJB5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 98,128,901 - 98,132,640 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 98,129,262 - 98,130,083 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 18,708,932 - 18,712,511 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gjb5
.
Predicted Target Of
Count of predictions: 247 Count of miRNA genes: 200 Interacting mature miRNAs: 213 Transcripts: ENSMUST00000046498 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
4142139 Adip12_m adiposity 12 (mouse) Not determined 4 124621281 156860686 Mouse 10047132 Albq19_m albuminuria QTL 19 (mouse) Not determined 4 112824389 146824389 Mouse 1301525 Lmb1_m lupus in MRL and B6 F2 cross (mouse) Not determined 4 124264957 150676858 Mouse 14746982 Manh56_m mandible shape 56 (mouse) 4 117815917 151815917 Mouse 4141623 W6q13_m weight 6 weeks QTL 13 (mouse) Not determined 88982069 140468203 Mouse 12910797 Pwgrq4_m pre-weaning growth rate QTL 4 (mouse) 4 105835310 141433838 Mouse 25314312 Syncl2_m synaptonemal complex length 2 (mouse) 4 65718237 146584457 Mouse 12910794 Pwbwq8_m post-weaning body weight QTL 8 (mouse) 4 105835310 141433838 Mouse 1300743 Skull6_m skull morphology 6 (mouse) Not determined 4 111009051 145009280 Mouse 1301382 Arvm2_m autoimmune renal vasculitis 2 (mouse) Not determined 4 107791564 141791756 Mouse 1302149 Tlsr2_m thymic lymphoma suppressor region 2 (mouse) Not determined 4 124264957 142230960 Mouse 12910813 Pwbwq4_m pre-weaning body weight QTL 4 (mouse) 4 105835310 141433838 Mouse 4141093 W3q17_m weight 3 weeks QTL 17 (mouse) Not determined 88982069 140468203 Mouse 27226757 Femd1_m femur midshaft diameter 1, 5 week (mouse) 4 123993793 144326570 Mouse 12910808 Pwbwq9_m post-weaning body weight QTL 9 (mouse) 4 105835310 141433838 Mouse 1300621 Tpnr1_m thermal pain response 1 (mouse) Not determined 4 125230872 156860686 Mouse 11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 4142493 Femwf13_m femur work to failure 13 (mouse) Not determined 116154678 150154782 Mouse 1301815 Sles2_m systemic lupus erythmatosus suppressor 2 (mouse) Not determined 4 94957579 150676858 Mouse 1300663 Start2_m startle response 2 (mouse) Not determined 4 107264957 141265153 Mouse 1300917 Gasa1_m gastritis type A susceptibility locus 1 (mouse) Not determined 4 124055093 142438020 Mouse 1301823 Bmd7_m bone mineral density 7 (mouse) Not determined 4 88982069 151654550 Mouse 10412210 Cypr6_m cytokine production 6 (mouse) Not determined 4 120617848 154617995 Mouse 1302078 Sluc21_m susceptibility to lung cancer 21 (mouse) Not determined 4 117401141 151401275 Mouse 10045620 Heal22_m wound healing/regeneration 22 (mouse) Not determined 4 125230872 156860686 Mouse 10412072 Ssen1_m suseptibility to Sendai virus 1 (mouse) Not determined 4 109658132 133154782 Mouse 4141065 Shali2_m survival time to hyperoxic acute lung injury 2 (mouse) Not determined 124055093 141572792 Mouse 13503348 Bntq18_m bone traits QTL 18 (mouse) 4 120617848 154617995 Mouse 13208562 Wght7_m weight 7 (mouse) 4 90888237 148084457 Mouse 1300655 Nidds_m non-insulin-dependent diabetes mellitus in SJL (mouse) Not determined 4 115030777 129465915 Mouse 1300781 Lith8_m lithogenic gene 8 (mouse) Not determined 4 107264957 141265153 Mouse 39128212 Lwq21_m liver weight QTL 21 (mouse) 4 88982069 140468203 Mouse 4141180 Ssic1_m susceptibility to small intestinal cancer 1 (mouse) Not determined 120674005 154674151 Mouse 1301847 Fecq2_m fecundity QTL 2 (mouse) Not determined 4 100071971 134072206 Mouse 1302102 Bis1_m beta-carboline-induced seizures 1 (mouse) Not determined 4 119864433 153864536 Mouse 26884445 Sklq7_m skull length QTL 7, 10 week (mouse) 4 68018237 150884457 Mouse 10043985 Stheal12_m soft tissue heal 12 (mouse) Not determined 4 121342649 155342753 Mouse 1301982 Pltiq1_m phospholipid transfer protein inducibility QTL 1 (mouse) Not determined 4 124621281 156860686 Mouse 1301597 Anxty_m anxiety (mouse) Not determined 4 74137574 128009280 Mouse 26884437 Sklq13_m skull length QTL 13, 16 week (mouse) 4 57700000 155684457 Mouse 1300803 Sluc6_m susceptibility to lung cancer 6 (mouse) Not determined 4 120674005 154674151 Mouse 4141549 W10q10_m weight 10 weeks QTL 10 (mouse) Not determined 88982069 140468203 Mouse 4142061 Chlq16_m circulating hormone level QTL 16 (mouse) Not determined 4 121342649 155342753 Mouse 1357895 Ctrcts_m cataract severity (mouse) Not determined 4 45709925 138342753 Mouse 1300933 Cdcs9_m cytokine deficiency colitis susceptibility 9 (mouse) Not determined 4 125230872 156860686 Mouse 1300809 Ccrs2_m corpus callosum hemisphere surface size 2 (mouse) Not determined 4 107264957 141265153 Mouse 1301964 Bw8q2_m body weight at 8 weeks QTL 2 (mouse) Not determined 4 119864433 153864536 Mouse 1301452 Elsgp1_m elevated serum gp70 1 (mouse) Not determined 4 121342649 155342753 Mouse 1301106 Skts7_m skin tumor susceptibility 7 (mouse) Not determined 4 100071971 134072206 Mouse 1301233 Sbw2_m splenomegaly-NZB x NZW 2 (mouse) Not determined 4 94957579 128009280 Mouse 10755520 Rbc1_m red blood cell count 1 (mouse) 4 108477692 142477692 Mouse 10755521 Hct1_m hematocrit 1 (mouse) 4 108477692 142477692 Mouse 10755522 Hgb1_m hemoglobin 1 (mouse) 4 108477692 142477692 Mouse 27095924 Pglq2_m pelvic girdle length QTL 2, 5 week (mouse) 4 69118237 130727311 Mouse 1300858 Tafat_m tally ho associated mesenteric fat pad weight (mouse) Not determined 4 124621281 156860686 Mouse 10755531 Lymph3_m lymphocyte differential 3 (mouse) 4 124553483 156860686 Mouse 27095917 Scvln14_m sacral vertebrae length 2, 16 week (mouse) 4 68018237 130277062 Mouse 1301731 Cafq2_m caffeine metabolism QTL 2 (mouse) Not determined 4 94732255 128732454 Mouse 15039382 Ltgq7_m liver triglyceride QTL 7 (mouse) 4 105705794 139705794 Mouse 11533916 Mts1_m mammary tumor susceptibility 1 (mouse) 4 125289325 156860686 Mouse 15039377 Bw45_m body weight QTL 45 (mouse) 4 105705794 139705794 Mouse 1300839 Dyscalc2_m dystrophic cardiac calcinosis 2 (mouse) Not determined 4 111009051 145009280 Mouse 12880433 Fgf23lq1_m FGF23 serum level QTL 1 (mouse) 4 101157197 135157197 Mouse 4141001 Tgq17_m triglyceride QTL 17 (mouse) Not determined 112523489 146523489 Mouse 1300580 Lbw2_m lupus NZB x NZW 2 (mouse) Not determined 4 98545539 128009280 Mouse 15039378 Adip30_m adiposity 30 (mouse) 4 105705794 139705794 Mouse 26884449 Sklq2_m skull length QTL 2, 5 week (mouse) 4 36700000 128993793 Mouse 27095905 Scvln3_m sacral vertebrae length 2, 5 week (mouse) 4 55600000 128993793 Mouse 1357800 Tgq3_m triglyceride QTL 3 (mouse) Not determined 4 107055093 141055180 Mouse 15039385 Mvlq3_m macrovesicular liver lesion QTL 3 (mouse) 4 112182386 146182386 Mouse
Gjb5
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 127,355,407 - 127,356,277 UniSTS GRCm38 MGSCv37 4 127,032,651 - 127,033,521 UniSTS GRCm37 Celera 4 125,689,788 - 125,690,658 UniSTS Cytogenetic Map 4 D2.2 UniSTS cM Map 4 57.5 UniSTS
Gjb5
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 127,355,531 - 127,356,019 UniSTS GRCm38 MGSCv37 4 127,032,775 - 127,033,263 UniSTS GRCm37 Celera 4 125,689,912 - 125,690,400 UniSTS Cytogenetic Map 4 D2.2 UniSTS Cytogenetic Map 4 D1-D3 UniSTS cM Map 4 57.5 UniSTS
Gjb5
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 4 D2.2 UniSTS
Gjb5
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 4 D2.2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000046498 ⟹ ENSMUSP00000045325
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 127,248,602 - 127,251,974 (-) Ensembl GRCm38.p6 Ensembl 4 127,354,809 - 127,358,181 (-) Ensembl
RefSeq Acc Id:
NM_010291 ⟹ NP_034421
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 127,248,600 - 127,251,957 (-) NCBI GRCm38 4 127,354,809 - 127,358,164 (-) ENTREZGENE MGSCv37 4 127,032,053 - 127,035,408 (-) RGD Celera 4 125,689,190 - 125,692,545 (-) RGD cM Map 4 ENTREZGENE
Sequence:
GCTCAACAGCCTCTGCCCCAAGAATGAGCTTTACCAGAAACCCTTCCCTGATTCTGACATGAATTCTGATGCTTGCTGAACCCCAACTGCTGGCTTCCAGGAGCGGGTACTAAGGGAGCCCTAAGGAG
hide sequence
RefSeq Acc Id:
NP_034421 ⟸ NM_010291
- UniProtKB:
Q02739 (UniProtKB/Swiss-Prot), Q542M8 (UniProtKB/TrEMBL), Q91XA4 (UniProtKB/TrEMBL)
- Sequence:
MNWSVFEGLLSGVNKYSTAFGRIWLSLVFVFRVLVYLVTAERVWGDDQKDFDCNTRQPGCTNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYRKAREKKYQEKIGEGYLYPNPGKKRGGLWWT
hide sequence
Ensembl Acc Id:
ENSMUSP00000045325 ⟸ ENSMUST00000046498
RGD ID: 6884700 Promoter ID: EPDNEW_M5801 Type: initiation region Name: Gjb5_1 Description: Mus musculus gap junction protein, beta 5 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 127,358,164 - 127,358,224 EPDNEW
