Symbol:
Hspb7
Name:
heat shock protein family, member 7 (cardiovascular)
RGD ID:
736092
MGI Page
MGI
Description:
Enables filamin binding activity. Predicted to be involved in heart development. Located in actin cytoskeleton. Is expressed in several structures, including alimentary system; genitourinary system; integumental system; nervous system; and sensory organ. Orthologous to human HSPB7 (heat shock protein family B (small) member 7).
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
27kDa; cardiovascular heat shock protein; cv; cvHsp; heat shock 27kDa protein family, member 7 (cardiovascular); heat shock protein 25 kDa 2 (cardiovascular); heat shock protein beta-7; Hsp25; Hsp25-2; MGC107591; protein p19/6.8
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
HSPB7 (heat shock protein family B (small) member 7)
HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Rattus norvegicus (Norway rat):
Hspb7 (heat shock protein family B (small) member 7)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Hspb7 (heat shock protein family B (small) member 7)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
HSPB7 (heat shock protein family B (small) member 7)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HSPB7 (heat shock protein family B (small) member 7)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Hspb7 (heat shock protein family B (small) member 7)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
HSPB7 (heat shock protein family B (small) member 7)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
HSPB7 (heat shock protein family B (small) member 7)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Hspb7 (heat shock protein family B (small) member 7)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Hspb7 (heat shock protein family B (small) member 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Homo sapiens (human):
HSPB7 (heat shock protein family B (small) member 7)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
hspb7 (heat shock protein family, member 7 (cardiovascular))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 141,148,090 - 141,152,621 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 141,148,090 - 141,152,622 (+) Ensembl GRCm39 Ensembl GRCm38 4 141,420,779 - 141,425,310 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 141,420,779 - 141,425,311 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 140,976,694 - 140,981,225 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 140,692,855 - 140,697,386 (+) NCBI MGSCv36 mm8 Celera 4 143,237,268 - 143,241,799 (+) NCBI Celera Cytogenetic Map 4 D3 NCBI cM Map 4 74.08 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hspb7 Mouse (-)-epigallocatechin 3-gallate decreases expression ISO HSPB7 (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of HSPB7 mRNA CTD PMID:18851785 Hspb7 Mouse (R)-pantothenic acid increases expression ISO HSPB7 (Homo sapiens) 6480464 Pantothenic Acid results in increased expression of HSPB7 mRNA CTD PMID:19397697 Hspb7 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of HSPB7 mRNA CTD PMID:22206623 Hspb7 Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of HSPB7 mRNA CTD PMID:17942748 Hspb7 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HSPB7 mRNA CTD PMID:17942748 Hspb7 Mouse 2,2',5,5'-tetrachlorobiphenyl increases expression ISO Hspb7 (Rattus norvegicus) 6480464 2 more ... CTD PMID:23829299 Hspb7 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HSPB7 mRNA CTD PMID:17942748 Hspb7 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Hspb7 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of HSPB7 mRNA CTD PMID:33387578 Hspb7 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Hspb7 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of HSPB7 mRNA CTD PMID:32109520 Hspb7 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO HSPB7 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of HSPB7 mRNA CTD PMID:30096437 Hspb7 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of HSPB7 mRNA CTD PMID:21570461 Hspb7 Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Hspb7 (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 Hspb7 Mouse 2,4,6-trinitrobenzenesulfonic acid multiple interactions EXP 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of HSPB7 mRNA] CTD PMID:18200517 Hspb7 Mouse 2,4,6-trinitrobenzenesulfonic acid increases expression EXP 6480464 Trinitrobenzenesulfonic Acid results in increased expression of HSPB7 mRNA CTD PMID:18200517 Hspb7 Mouse 3-chloropropane-1,2-diol increases expression ISO Hspb7 (Rattus norvegicus) 6480464 alpha-Chlorohydrin results in increased expression of HSPB7 protein CTD PMID:26597043 Hspb7 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO HSPB7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression of HSPB7 mRNA CTD PMID:28628672 Hspb7 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of HSPB7 mRNA CTD PMID:30951980 Hspb7 Mouse 4,4'-sulfonyldiphenol increases methylation EXP 6480464 bisphenol S results in increased methylation of HSPB7 exon CTD PMID:33297965 Hspb7 Mouse acetamiprid decreases expression ISO Hspb7 (Rattus norvegicus) 6480464 acetamiprid results in decreased expression of HSPB7 mRNA CTD PMID:27782041 Hspb7 Mouse acrylamide decreases expression ISO Hspb7 (Rattus norvegicus) 6480464 Acrylamide results in decreased expression of HSPB7 mRNA CTD PMID:28959563 Hspb7 Mouse aflatoxin B1 increases methylation ISO HSPB7 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of HSPB7 gene CTD PMID:27153756 Hspb7 Mouse all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of HSPB7 mRNA CTD PMID:20117194 and PMID:36189433 Hspb7 Mouse alpha-Zearalanol multiple interactions ISO Hspb7 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of HSPB7 mRNA CTD PMID:35163327 Hspb7 Mouse alpha-Zearalanol decreases expression ISO Hspb7 (Rattus norvegicus) 6480464 Zeranol results in decreased expression of HSPB7 mRNA CTD PMID:35163327 Hspb7 Mouse amitrole decreases expression ISO Hspb7 (Rattus norvegicus) 6480464 Amitrole results in decreased expression of HSPB7 mRNA CTD PMID:30047161 Hspb7 Mouse ammonium chloride affects expression ISO Hspb7 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of HSPB7 mRNA CTD PMID:16483693 Hspb7 Mouse benzene-1,2,4-triol decreases expression ISO HSPB7 (Homo sapiens) 6480464 hydroxyhydroquinone results in decreased expression of HSPB7 mRNA CTD PMID:39245080 Hspb7 Mouse benzo[a]pyrene affects methylation ISO HSPB7 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HSPB7 promoter CTD PMID:27901495 Hspb7 Mouse bisphenol A increases expression ISO Hspb7 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of HSPB7 mRNA CTD PMID:18180321 Hspb7 Mouse bisphenol A increases expression ISO HSPB7 (Homo sapiens) 6480464 bisphenol A results in increased expression of HSPB7 protein CTD PMID:37567409 Hspb7 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HSPB7 mRNA CTD PMID:30951980 and PMID:32156529 Hspb7 Mouse bisphenol A decreases expression ISO HSPB7 (Homo sapiens) 6480464 bisphenol A results in decreased expression of HSPB7 mRNA CTD PMID:27685785 Hspb7 Mouse bisphenol A affects expression ISO Hspb7 (Rattus norvegicus) 6480464 bisphenol A affects the expression of HSPB7 mRNA CTD PMID:25181051 and PMID:32145629 Hspb7 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of HSPB7 mRNA CTD PMID:30951980 Hspb7 Mouse C60 fullerene decreases expression ISO Hspb7 (Rattus norvegicus) 6480464 fullerene C60 results in decreased expression of HSPB7 mRNA CTD PMID:19167457 Hspb7 Mouse cantharidin decreases expression EXP 6480464 Cantharidin results in decreased expression of HSPB7 mRNA CTD PMID:36907384 Hspb7 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Hspb7 Mouse chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of HSPB7 mRNA CTD PMID:23125180 Hspb7 Mouse chlorpyrifos increases expression ISO Hspb7 (Rattus norvegicus) 6480464 Chlorpyrifos results in increased expression of HSPB7 mRNA CTD PMID:20691718 Hspb7 Mouse copper atom increases expression ISO Hspb7 (Rattus norvegicus) 6480464 Copper deficiency results in increased expression of HSPB7 mRNA and Copper results in increased expression of HSPB7 mRNA CTD PMID:26033743 and PMID:30556269 Hspb7 Mouse copper(0) increases expression ISO Hspb7 (Rattus norvegicus) 6480464 Copper deficiency results in increased expression of HSPB7 mRNA and Copper results in increased expression of HSPB7 mRNA CTD PMID:26033743 and PMID:30556269 Hspb7 Mouse copper(II) sulfate increases expression ISO HSPB7 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of HSPB7 mRNA CTD PMID:19549813 Hspb7 Mouse Cuprizon decreases expression ISO Hspb7 (Rattus norvegicus) 6480464 Cuprizone results in decreased expression of HSPB7 mRNA CTD PMID:26577399 Hspb7 Mouse curcumin multiple interactions EXP 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of HSPB7 mRNA] CTD PMID:18200517 Hspb7 Mouse decabromodiphenyl ether increases expression ISO Hspb7 (Rattus norvegicus) 6480464 decabromobiphenyl ether results in increased expression of HSPB7 mRNA CTD PMID:23640034 Hspb7 Mouse dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of HSPB7 mRNA CTD PMID:22733784 Hspb7 Mouse dexamethasone multiple interactions ISO HSPB7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression of HSPB7 mRNA CTD PMID:28628672 Hspb7 Mouse dexamethasone increases expression ISO HSPB7 (Homo sapiens) 6480464 Dexamethasone results in increased expression of HSPB7 mRNA CTD PMID:25047013 Hspb7 Mouse dibutyl phthalate increases expression ISO Hspb7 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of HSPB7 mRNA CTD PMID:21266533 Hspb7 Mouse dichloroacetic acid decreases expression EXP 6480464 Dichloroacetic Acid results in decreased expression of HSPB7 mRNA CTD PMID:28962523 Hspb7 Mouse diisononyl phthalate increases expression EXP 6480464 diisononyl phthalate results in increased expression of HSPB7 mRNA CTD PMID:33391822 Hspb7 Mouse dimethylarsinic acid multiple interactions EXP 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of HSPB7 mRNA CTD PMID:34876320 Hspb7 Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of HSPB7 mRNA CTD PMID:30529165 Hspb7 Mouse doxorubicin affects expression ISO HSPB7 (Homo sapiens) 6480464 Doxorubicin affects the expression of HSPB7 mRNA and Doxorubicin affects the expression of HSPB7 protein CTD PMID:29385562 and PMID:29803840 Hspb7 Mouse doxorubicin decreases expression ISO Hspb7 (Rattus norvegicus) 6480464 Doxorubicin results in decreased expression of HSPB7 mRNA CTD PMID:30261314 Hspb7 Mouse epoxiconazole increases expression EXP 6480464 epoxiconazole results in increased expression of HSPB7 mRNA CTD PMID:35436446 Hspb7 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of HSPB7 mRNA CTD PMID:20871982 Hspb7 Mouse fenvalerate increases expression ISO Hspb7 (Rattus norvegicus) 6480464 fenvalerate results in increased expression of HSPB7 mRNA CTD PMID:30307764 Hspb7 Mouse folic acid affects expression ISO HSPB7 (Homo sapiens) 6480464 Folic Acid affects the expression of HSPB7 mRNA CTD PMID:17320366 Hspb7 Mouse genistein increases expression EXP 6480464 Genistein results in increased expression of HSPB7 mRNA CTD PMID:32186404 Hspb7 Mouse gentamycin decreases expression ISO Hspb7 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of HSPB7 mRNA CTD PMID:33387578 Hspb7 Mouse imidacloprid decreases expression ISO Hspb7 (Rattus norvegicus) 6480464 imidacloprid results in decreased expression of HSPB7 mRNA CTD PMID:27782041 Hspb7 Mouse indometacin multiple interactions ISO HSPB7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression of HSPB7 mRNA CTD PMID:28628672 Hspb7 Mouse isoprenaline increases expression ISO Hspb7 (Rattus norvegicus) 6480464 Isoproterenol results in increased expression of HSPB7 mRNA CTD PMID:24286936 Hspb7 Mouse methylarsonic acid multiple interactions EXP 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of HSPB7 mRNA CTD PMID:34876320 Hspb7 Mouse nickel atom decreases expression ISO HSPB7 (Homo sapiens) 6480464 Nickel results in decreased expression of HSPB7 mRNA CTD PMID:25583101 Hspb7 Mouse niclosamide increases expression ISO HSPB7 (Homo sapiens) 6480464 Niclosamide results in increased expression of HSPB7 mRNA CTD PMID:36318118 Hspb7 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of HSPB7 mRNA CTD PMID:34911549 Hspb7 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of HSPB7 mRNA CTD PMID:17562736 Hspb7 Mouse paraquat increases expression ISO Hspb7 (Rattus norvegicus) 6480464 Paraquat results in increased expression of HSPB7 mRNA CTD PMID:32680482 Hspb7 Mouse PCB138 decreases expression ISO Hspb7 (Rattus norvegicus) 6480464 2 more ... CTD PMID:23829299 Hspb7 Mouse perfluorohexanesulfonic acid increases expression EXP 6480464 perfluorohexanesulfonic acid results in increased expression of HSPB7 mRNA CTD PMID:37995155 Hspb7 Mouse perfluorooctanoic acid multiple interactions ISO Hspb7 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of HSPB7 mRNA CTD PMID:35163327 Hspb7 Mouse pioglitazone multiple interactions EXP 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of HSPB7 mRNA CTD PMID:27935865 Hspb7 Mouse resveratrol multiple interactions ISO HSPB7 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of HSPB7 mRNA CTD PMID:23557933 Hspb7 Mouse sodium arsenate increases expression EXP 6480464 sodium arsenate results in increased expression of HSPB7 mRNA CTD PMID:21795629 Hspb7 Mouse sodium arsenate multiple interactions EXP 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of HSPB7 mRNA CTD PMID:34876320 Hspb7 Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of HSPB7 mRNA CTD PMID:16014739 Hspb7 Mouse sodium arsenite multiple interactions EXP 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of HSPB7 mRNA CTD PMID:34876320 Hspb7 Mouse sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of HSPB7 mRNA CTD PMID:37682722 Hspb7 Mouse sulforaphane increases expression EXP 6480464 sulforaphane results in increased expression of HSPB7 mRNA CTD PMID:30529165 Hspb7 Mouse sulforaphane decreases expression ISO HSPB7 (Homo sapiens) 6480464 sulforaphane results in decreased expression of HSPB7 mRNA CTD PMID:31838189 Hspb7 Mouse sunitinib decreases expression ISO HSPB7 (Homo sapiens) 6480464 Sunitinib results in decreased expression of HSPB7 mRNA CTD PMID:31533062 Hspb7 Mouse tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of HSPB7 mRNA CTD PMID:17484886 Hspb7 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of HSPB7 mRNA CTD PMID:23557971 Hspb7 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of HSPB7 enhancer CTD PMID:35295148 Hspb7 Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of HSPB7 mRNA CTD PMID:35295148 Hspb7 Mouse triclosan decreases expression ISO HSPB7 (Homo sapiens) 6480464 Triclosan results in decreased expression of HSPB7 mRNA CTD PMID:30510588 Hspb7 Mouse trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of HSPB7 mRNA CTD PMID:35537566 Hspb7 Mouse tunicamycin increases expression EXP 6480464 Tunicamycin results in increased expression of HSPB7 mRNA CTD PMID:17127020 Hspb7 Mouse valproic acid increases methylation ISO HSPB7 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of HSPB7 gene CTD PMID:29154799
(-)-epigallocatechin 3-gallate (ISO) (R)-pantothenic acid (ISO) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4,6-trinitrobenzenesulfonic acid (EXP) 3-chloropropane-1,2-diol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP) acetamiprid (ISO) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP) alpha-Zearalanol (ISO) amitrole (ISO) ammonium chloride (ISO) benzene-1,2,4-triol (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) C60 fullerene (ISO) cantharidin (EXP) carbon nanotube (EXP) chloroprene (EXP) chlorpyrifos (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) Cuprizon (ISO) curcumin (EXP) decabromodiphenyl ether (ISO) dexamethasone (EXP,ISO) dibutyl phthalate (ISO) dichloroacetic acid (EXP) diisononyl phthalate (EXP) dimethylarsinic acid (EXP) dioxygen (EXP) doxorubicin (ISO) epoxiconazole (EXP) ethanol (EXP) fenvalerate (ISO) folic acid (ISO) genistein (EXP) gentamycin (ISO) imidacloprid (ISO) indometacin (ISO) isoprenaline (ISO) methylarsonic acid (EXP) nickel atom (ISO) niclosamide (ISO) ozone (EXP) paracetamol (EXP) paraquat (ISO) PCB138 (ISO) perfluorohexanesulfonic acid (EXP) perfluorooctanoic acid (ISO) pioglitazone (EXP) resveratrol (ISO) sodium arsenate (EXP) sodium arsenite (EXP) sulforaphane (EXP,ISO) sunitinib (ISO) tetrachloromethane (EXP) titanium dioxide (EXP) triclosan (ISO) trovafloxacin (EXP) tunicamycin (EXP) valproic acid (ISO)
Hspb7 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 141,148,090 - 141,152,621 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 141,148,090 - 141,152,622 (+) Ensembl GRCm39 Ensembl GRCm38 4 141,420,779 - 141,425,310 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 141,420,779 - 141,425,311 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 140,976,694 - 140,981,225 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 140,692,855 - 140,697,386 (+) NCBI MGSCv36 mm8 Celera 4 143,237,268 - 143,241,799 (+) NCBI Celera Cytogenetic Map 4 D3 NCBI cM Map 4 74.08 NCBI
HSPB7 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 16,014,029 - 16,019,594 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 16,014,028 - 16,019,594 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 16,340,524 - 16,346,089 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 16,213,111 - 16,217,538 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 16,085,830 - 16,090,257 NCBI Celera 1 14,820,429 - 14,825,190 (-) NCBI Celera Cytogenetic Map 1 p36.13 NCBI HuRef 1 14,859,583 - 14,864,344 (-) NCBI HuRef CHM1_1 1 16,139,026 - 16,143,787 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 15,455,340 - 15,460,905 (-) NCBI T2T-CHM13v2.0
Hspb7 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 159,010,759 - 159,014,245 (+) NCBI GRCr8 mRatBN7.2 5 153,727,782 - 153,731,268 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 153,727,588 - 153,731,266 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 156,414,594 - 156,418,080 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 158,187,880 - 158,191,366 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 158,177,061 - 158,180,547 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 159,968,077 - 159,971,563 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 159,967,839 - 159,971,562 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 163,688,616 - 163,692,102 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 160,311,908 - 160,315,394 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 160,322,230 - 160,322,989 (+) NCBI Celera 5 152,089,504 - 152,092,990 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
Hspb7 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955527 2,219,462 - 2,222,824 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955527 2,219,462 - 2,222,824 (+) NCBI ChiLan1.0 ChiLan1.0
HSPB7 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 210,902,785 - 210,906,988 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 210,151,188 - 210,155,577 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 15,151,471 - 15,156,234 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 16,144,200 - 16,148,959 (-) NCBI panpan1.1 PanPan1.1 panPan2
HSPB7 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 81,628,051 - 81,631,939 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 81,619,999 - 81,630,483 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 78,163,485 - 78,167,372 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 82,273,705 - 82,277,606 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 82,273,504 - 82,277,580 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 79,026,872 - 79,030,773 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 80,044,020 - 80,047,921 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 81,111,730 - 81,115,632 (+) NCBI UU_Cfam_GSD_1.0
Hspb7 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 37,759,259 - 37,762,650 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 3,583,509 - 3,587,508 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 3,583,999 - 3,587,316 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HSPB7 (Sus scrofa - pig)
HSPB7 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 116,280,155 - 116,284,982 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 116,280,704 - 116,285,133 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 19,806,487 - 19,811,415 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hspb7 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 515 Count of miRNA genes: 339 Interacting mature miRNAs: 397 Transcripts: ENSMUST00000102486 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301267 Bcmd2_m B cell maturation defect 2 (mouse) Not determined 4 133154678 150789451 Mouse 4142139 Adip12_m adiposity 12 (mouse) Not determined 4 124621281 156860686 Mouse 10047132 Albq19_m albuminuria QTL 19 (mouse) Not determined 4 112824389 146824389 Mouse 1301525 Lmb1_m lupus in MRL and B6 F2 cross (mouse) Not determined 4 124264957 150676858 Mouse 14746982 Manh56_m mandible shape 56 (mouse) 4 117815917 151815917 Mouse 12910797 Pwgrq4_m pre-weaning growth rate QTL 4 (mouse) 4 105835310 141433838 Mouse 25314312 Syncl2_m synaptonemal complex length 2 (mouse) 4 65718237 146584457 Mouse 12910794 Pwbwq8_m post-weaning body weight QTL 8 (mouse) 4 105835310 141433838 Mouse 1300743 Skull6_m skull morphology 6 (mouse) Not determined 4 111009051 145009280 Mouse 1301382 Arvm2_m autoimmune renal vasculitis 2 (mouse) Not determined 4 107791564 141791756 Mouse 1302149 Tlsr2_m thymic lymphoma suppressor region 2 (mouse) Not determined 4 124264957 142230960 Mouse 12910813 Pwbwq4_m pre-weaning body weight QTL 4 (mouse) 4 105835310 141433838 Mouse 1300874 Gasa2_m gastritis type A susceptibility locus 2 (mouse) Not determined 4 133010494 156860686 Mouse 27226757 Femd1_m femur midshaft diameter 1, 5 week (mouse) 4 123993793 144326570 Mouse 12910808 Pwbwq9_m post-weaning body weight QTL 9 (mouse) 4 105835310 141433838 Mouse 1300621 Tpnr1_m thermal pain response 1 (mouse) Not determined 4 125230872 156860686 Mouse 11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 4142493 Femwf13_m femur work to failure 13 (mouse) Not determined 116154678 150154782 Mouse 1301815 Sles2_m systemic lupus erythmatosus suppressor 2 (mouse) Not determined 4 94957579 150676858 Mouse 1300663 Start2_m startle response 2 (mouse) Not determined 4 107264957 141265153 Mouse 1300917 Gasa1_m gastritis type A susceptibility locus 1 (mouse) Not determined 4 124055093 142438020 Mouse 1300537 Ap3q_m alcohol preference 3 QTL (mouse) Not determined 4 134654451 156860686 Mouse 1301823 Bmd7_m bone mineral density 7 (mouse) Not determined 4 88982069 151654550 Mouse 10412210 Cypr6_m cytokine production 6 (mouse) Not determined 4 120617848 154617995 Mouse 1302078 Sluc21_m susceptibility to lung cancer 21 (mouse) Not determined 4 117401141 151401275 Mouse 10045620 Heal22_m wound healing/regeneration 22 (mouse) Not determined 4 125230872 156860686 Mouse 4142481 Gct1_m granulosa cell tumorigenesis 1 (mouse) Not determined 4 127784226 156860686 Mouse 4141065 Shali2_m survival time to hyperoxic acute lung injury 2 (mouse) Not determined 124055093 141572792 Mouse 13503348 Bntq18_m bone traits QTL 18 (mouse) 4 120617848 154617995 Mouse 13208562 Wght7_m weight 7 (mouse) 4 90888237 148084457 Mouse 1300781 Lith8_m lithogenic gene 8 (mouse) Not determined 4 107264957 141265153 Mouse 4141184 Tb2r1_m TGF-beta2 responsiveness 1 (mouse) Not determined 137674005 150676858 Mouse 1300780 Cocrb16_m cocaine related behavior 16 (mouse) Not determined 4 138943725 156860686 Mouse 4142077 Ignpq2_m IgA nephropathy QTL 2 (mouse) Not determined 4 133676733 156860686 Mouse 4141180 Ssic1_m susceptibility to small intestinal cancer 1 (mouse) Not determined 120674005 154674151 Mouse 1301584 Lrdg2_m light induced retinal degeneration 2 (mouse) Not determined 4 129465811 151654550 Mouse 1302102 Bis1_m beta-carboline-induced seizures 1 (mouse) Not determined 4 119864433 153864536 Mouse 10043996 Gct5_m granulosa cell tumorigenesis 5 (mouse) Not determined 4 127784226 156860686 Mouse 26884445 Sklq7_m skull length QTL 7, 10 week (mouse) 4 68018237 150884457 Mouse 10043985 Stheal12_m soft tissue heal 12 (mouse) Not determined 4 121342649 155342753 Mouse 1357534 Cinda3_m cytokine induced activation 3 (mouse) Not determined 4 137617848 142289472 Mouse 1301982 Pltiq1_m phospholipid transfer protein inducibility QTL 1 (mouse) Not determined 4 124621281 156860686 Mouse 26884437 Sklq13_m skull length QTL 13, 16 week (mouse) 4 57700000 155684457 Mouse 1300803 Sluc6_m susceptibility to lung cancer 6 (mouse) Not determined 4 120674005 154674151 Mouse 4142061 Chlq16_m circulating hormone level QTL 16 (mouse) Not determined 4 121342649 155342753 Mouse 1300933 Cdcs9_m cytokine deficiency colitis susceptibility 9 (mouse) Not determined 4 125230872 156860686 Mouse 1300809 Ccrs2_m corpus callosum hemisphere surface size 2 (mouse) Not determined 4 107264957 141265153 Mouse 1300553 Athsq1_m atherosclerosis susceptibility QTL 1 (mouse) Not determined 4 137617848 151654550 Mouse 1301964 Bw8q2_m body weight at 8 weeks QTL 2 (mouse) Not determined 4 119864433 153864536 Mouse 1301452 Elsgp1_m elevated serum gp70 1 (mouse) Not determined 4 121342649 155342753 Mouse 10755520 Rbc1_m red blood cell count 1 (mouse) 4 108477692 142477692 Mouse 10755521 Hct1_m hematocrit 1 (mouse) 4 108477692 142477692 Mouse 10755522 Hgb1_m hemoglobin 1 (mouse) 4 108477692 142477692 Mouse 1301108 Scon2_m sucrose consumption 2 (mouse) Not determined 4 134654451 156860686 Mouse 1300858 Tafat_m tally ho associated mesenteric fat pad weight (mouse) Not determined 4 124621281 156860686 Mouse 10755531 Lymph3_m lymphocyte differential 3 (mouse) 4 124553483 156860686 Mouse 11533916 Mts1_m mammary tumor susceptibility 1 (mouse) 4 125289325 156860686 Mouse 1300839 Dyscalc2_m dystrophic cardiac calcinosis 2 (mouse) Not determined 4 111009051 145009280 Mouse 4141001 Tgq17_m triglyceride QTL 17 (mouse) Not determined 112523489 146523489 Mouse 15039385 Mvlq3_m macrovesicular liver lesion QTL 3 (mouse) 4 112182386 146182386 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000102486 ⟹ ENSMUSP00000099544
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 141,148,090 - 141,152,622 (+) Ensembl GRCm38.p6 Ensembl 4 141,420,779 - 141,425,311 (+) Ensembl
RefSeq Acc Id:
NM_013868 ⟹ NP_038896
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 141,148,090 - 141,152,621 (+) NCBI GRCm38 4 141,420,779 - 141,425,310 (+) ENTREZGENE MGSCv37 4 140,976,694 - 140,981,225 (+) RGD Celera 4 143,237,268 - 143,241,799 (+) RGD cM Map 4 ENTREZGENE
Sequence:
AGCCATTCCAACGTACTTAGGTTCAGCCCACCCCTCCTAGGAGGCTGTATTTCCTGGTCTGGAAACTGGCCTCAAAGCTCCTCTTTTTGAGTTGTGTTAAGATCAAAGAGGGCTCTGCTGGGAAGAGA CAGCAGTGGCCAGAGACATCGTGGAAGCCGGAGCTAAGGCACCTGTCAGCGGTCGACCTTACCTGGATGTGAAATCATGTGACTAGGACGCTTGGGCAGACACCAACTCTGAGCCTGAGGTAGAGCGA GCAGACTGTTCCCAGCAACTTTGCCCCTTAGACCTTTCGTGTTATCTGCTCTTTCCCTGAAGCTGGGCCCAACCCCACCCCCACAGCCTCAACTCCAGCCGCCAGCTCTCTTTTCCTCTGCCTCTTAT GGTCCTGGGAGTGGGGATAAGGTGAAGAATCACCAGTCCCTGTGGCAGATGACAGGGGTCACCCACACGTTCTATCTCCCCTCCCTGGGCTTTCTCAGCCTTCCCTAAGAGATAGCTGGACCTGGAGC GCCTCGGAATCCCTCGGGGTACCTGCATGTATATACTCTCTCCTCAGGAGTCTAATAAGGGAGGCACAGGCCCTGGGGGGCACAGTACAAGAGGAGAGGAGGGTCCCAGGCTATCGAGGGGACCAACA AACCACGAAGTCCTGGGGACAGGCACAGGGCAGGACCCACCCCCTGCCCTGGCAGGTACAGAGGTCCTTGGGGCTGGAGCTCTGGACTAACAGTGCCAGGTGGTGAGCTCAGCCTTGCAACCCTGCCC TCCTGTGTCGGGCTGTCAGCAGAGCCGTTTCTCCCAAGAAGATTTCCAGGCCCCTCTGGGCAATGAAGAGGCCTAAATTTAGCCAGCAGACAAGGGGCTGGCCTCGAGCCCAGGGACAGTTGGGCCTT ATAAAGCGCTGGCAGTCAGGGGCCCCGGCACGCTTCCGTGGAGGCCTGGACCCACTCGTTTCTCCAGCCCAGCCCCTGCCCGTCTGGACAGGGACCCCCGCTGCCTGTGGATGAGCCATCGGACCTCC TCCGCCTTCAGAGCGGAGAGAAGCTTCCGTTCCTCTTCCTCCTCCTCCTCCTCCTCTTCTTCTTCGGCCTCCCGTGCCCTTCCAGCCCAGGACCCACCCATGGAGAAGGCTTTGAGCATGTTTTCAGA CGACTTTGGCAGTTTTATGCTGCCCCACTCGGAGCCCCTGGCCTTCCCAGCCCGTCCCGGGGGCCAAGGAAACATCAAGACCCTCGGGGATGCCTACGAGTTTACAGTGGACATGAGAGACTTCTCCC CTGAAGACATCATTGTCACCACCTTCAACAACCACATCGAGGTGCGGGCTGAGAAGCTGGCAGCTGATGGCACAGTCATGAACACCTTTGCTCACAAGTGCCAACTACCAGAGGATGTGGACCCAACA TCGGTGACCTCGGCCCTTCGAGAGGATGGTAGCCTCACCATCCGGGCGCGGCGCCACCCCCACACAGAACATGTCCAGCAGACCTTCCGGACTGAGATAAAAATCTGAGGGTCTCTCCACCCCTGGCC TCCCCCTTATCTCCTCCCCCACTGGCCTGCCGGTGAGGTCACCATGATCCCTGACAATGACCCCTCAGAACATCTCAGCCTAGGCCCCAGTCACTCCACACACTCTCAGGCCCCAGGTGGGTCACCCC TGCCCCAAACTAGGGCATCCCTCTCCATCCAACGCAGTCCAGGGACCTGTCTGCTCTCACCCAGATAGACCCTCCCTATCTAAGTTCACAATAGAGGGGCTGAGGTACCAACCTGGAGAGCAAGACGA GGGCAGAGTCTAACACAGAGTGGCGGCTTCAATGGCATTTCTGCAGGGCAGGGGACCAGAAGCCCCTTCCTGGCAAATGAGAGGCTGGCCACAAGCAGGGCTTCTGGCCTAGGTAGACTGCCTCAGGG AAGCCAGAGAGATAGCCATGACTGTTACCTTCCTTGTAACTCTCGAAACCTCAAACCCAGGGCTACCTGTCACCCTGAGGCTCTAACAGCTACATGTACCAGACAAAGACACCTGTACCTAGATGGGG TTTATTAAAATGACATGAGGCTCCTATCTCCAGCTGCTGGTGCATGAGGCCAGAGCCCAGGGCTCCTGGGTGGCTTCCCCTGCAGAGAGGGTCCTCTTTGGAAGTGAGAGGAAGAGCCAGGACTTGTA CACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACGCGCGCGCGCGCGCGCGCCATTGTCCTATGCCTTAAATACTCATTCCCACTGGTTGGAG CCCAATTCAAAGCATTCTAAGAGTCACAGTTAGCATCTCTGTTTTCATCAATGGAGACTGGCGTCTCTGAGCCAGTTGGATGCCCAGGTTTGTCTCTGAAGCCAGCGCTGCCTCAGCGGCTCTCAGAC TCTCCCCTCTGTGTACTGGGGACACTTCCCCCCCATTCCACCTCTCCTGAGCCACATGCCCTGCTTCGCCCTAACTGCAGATGGTGGCCACAAGAAGAACCCCAAACCAGATCTCTTCTGGCCCCCAA ATTCAGGGCAAAAACCCTTGTCAGCCTTAACCCTGGGGGACCTGGGCTCTGACTCAGTCTCTGCGTGTAGAATCGGGTGTAAAGGGGGAAGCTCACTGCTAATCGGGGTCCCAGGGGCCTCTACAGTC TTAGGACCCTGTGGAGGAGGGGGTGGGGTGGGGTCGTGGGAGTCTAGTCTATAACCTGTACACAATAAAAGGACAATATG
hide sequence
RefSeq Acc Id:
NP_038896 ⟸ NM_013868
- UniProtKB:
Q8CDI0 (UniProtKB/Swiss-Prot), Q5FW72 (UniProtKB/Swiss-Prot), Q9QUS2 (UniProtKB/Swiss-Prot), P35385 (UniProtKB/Swiss-Prot)
- Sequence:
MSHRTSSAFRAERSFRSSSSSSSSSSSSASRALPAQDPPMEKALSMFSDDFGSFMLPHSEPLAFPARPGGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTFNNHIEVRAEKLAADGTVMNTFAHKCQLP EDVDPTSVTSALREDGSLTIRARRHPHTEHVQQTFRTEIKI
hide sequence
Ensembl Acc Id:
ENSMUSP00000099544 ⟸ ENSMUST00000102486
RGD ID: 6835482
Promoter ID: MM_KWN:40481
Type: CpG-Island
SO ACC ID: SO:0000170
Source: MPROMDB
Tissues & Cell Lines: Lung
Transcripts: OTTMUST00000023971
Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 140,977,546 - 140,978,046 (+) MPROMDB
RGD ID: 6885310
Promoter ID: EPDNEW_M6106
Type: initiation region
Name: Hspb7_2
Description: Mus musculus heat shock protein family, member 7 , mRNA.
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Alternative Promoters: null; see alsoEPDNEW_M6107
Experiment Methods: Single-end sequencing.
Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 141,420,735 - 141,420,795 EPDNEW
RGD ID: 6885312
Promoter ID: EPDNEW_M6107
Type: multiple initiation site
Name: Hspb7_1
Description: Mus musculus heat shock protein family, member 7 , mRNA.
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Alternative Promoters: null; see alsoEPDNEW_M6106
Experiment Methods: Single-end sequencing.
Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 141,421,704 - 141,421,764 EPDNEW