Symbol:
VIPR1
Name:
vasoactive intestinal peptide receptor 1
RGD ID:
735637
HGNC Page
HGNC:12694
Description:
Enables peptide hormone binding activity; pituitary adenylate cyclase-activating polypeptide receptor activity; and vasoactive intestinal polypeptide receptor activity. Involved in G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger and adenylate cyclase-activating G protein-coupled receptor signaling pathway. Part of receptor complex. Is active in plasma membrane. Implicated in achalasia. Biomarker of Crohn's disease and ulcerative colitis.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
FLJ41949; HVR1; II; PACAP type II receptor; PACAP-R-2; PACAP-R2; pituitary adenylate cyclase activating polypeptide receptor, type II; pituitary adenylate cyclase-activating polypeptide type II receptor; RDC1; type 1 vasoactive intestinal peptide receptor; V1RG; VAPC1; vasoactive intestinal polypeptide receptor 1; VIP and PACAP receptor 1; VIP receptor, type I; VIP-R-1; VIPR; VIRG; VPAC1; VPAC1 receptor; VPAC1R; VPCAP1R
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Vipr1 (vasoactive intestinal peptide receptor 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Vipr1 (vasoactive intestinal peptide receptor 1) HGNC
HomoloGene, NCBI, Panther
Chinchilla lanigera (long-tailed chinchilla):
Vipr1 (vasoactive intestinal peptide receptor 1) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
VIPR1 (vasoactive intestinal peptide receptor 1) NCBI
Ortholog
Canis lupus familiaris (dog):
VIPR1 (vasoactive intestinal peptide receptor 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Vipr1 (vasoactive intestinal peptide receptor 1) NCBI
Ortholog
Sus scrofa (pig):
VIPR1 (vasoactive intestinal peptide receptor 1) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
VIPR1 (vasoactive intestinal peptide receptor 1) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Vipr1 (vasoactive intestinal peptide receptor 1) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Vipr1 (vasoactive intestinal peptide receptor 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Vipr1 (vasoactive intestinal peptide receptor 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
vipr1b (vasoactive intestinal peptide receptor 1b)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
vipr1a (vasoactive intestinal peptide receptor 1a)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
seb-2
Alliance
DIOPT (Ensembl Compara|OMA)
Caenorhabditis elegans (roundworm):
seb-3
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
Pdfr
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus laevis (African clawed frog):
vipr1.L
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
vipr1.S
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
vipr1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 42,489,299 - 42,537,568 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 42,489,299 - 42,537,573 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 42,530,791 - 42,579,060 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 42,519,121 - 42,554,064 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 42,519,120 - 42,554,064 NCBI Celera 3 42,484,508 - 42,519,469 (+) NCBI Celera Cytogenetic Map 3 p22.1 NCBI HuRef 3 42,574,992 - 42,623,180 (+) NCBI HuRef CHM1_1 3 42,481,967 - 42,530,261 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 42,507,314 - 42,555,561 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
VIPR1 Human (1->4)-beta-D-glucan multiple interactions ISO Vipr1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of VIPR1 mRNA CTD PMID:36331819 VIPR1 Human 1,2-dichloroethane decreases expression ISO Vipr1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of VIPR1 mRNA CTD PMID:28960355 VIPR1 Human 1,2-dimethylhydrazine multiple interactions ISO Vipr1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of VIPR1 mRNA CTD PMID:22206623 VIPR1 Human 1-naphthyl isothiocyanate decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 1-Naphthylisothiocyanate results in decreased expression of VIPR1 mRNA CTD PMID:25380136 and PMID:30723492 VIPR1 Human 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of VIPR1 mRNA CTD PMID:19619570 VIPR1 Human 17beta-estradiol decreases expression ISO Vipr1 (Mus musculus) 6480464 Estradiol results in decreased expression of VIPR1 mRNA CTD PMID:39298647 VIPR1 Human 17beta-estradiol increases expression ISO Vipr1 (Rattus norvegicus) 6480464 Estradiol results in increased expression of VIPR1 mRNA CTD PMID:32145629 VIPR1 Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of VIPR1 mRNA CTD PMID:19619570 VIPR1 Human 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Vipr1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 VIPR1 Human 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Vipr1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 VIPR1 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of VIPR1 mRNA CTD PMID:19619570 VIPR1 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of VIPR1 mRNA CTD PMID:12377990 more ... VIPR1 Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Vipr1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 VIPR1 Human 3,4-methylenedioxymethamphetamine increases expression ISO Vipr1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of VIPR1 mRNA CTD PMID:19285098 VIPR1 Human 3-methylcholanthrene multiple interactions EXP 6480464 Methylcholanthrene promotes the reaction [AHR protein binds to VIPR1 promoter] CTD PMID:20348232 VIPR1 Human 4,4'-diaminodiphenylmethane decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of VIPR1 mRNA CTD PMID:25380136 VIPR1 Human 4-nonylphenol multiple interactions EXP 6480464 [4-tert-octylphenol co-treated with 4-nonylphenol] results in decreased expression of VIPR1 mRNA CTD PMID:23626723 VIPR1 Human 4-tert-Octylphenol multiple interactions EXP 6480464 [4-tert-octylphenol co-treated with 4-nonylphenol] results in decreased expression of VIPR1 mRNA CTD PMID:23626723 VIPR1 Human 6-propyl-2-thiouracil increases expression ISO Vipr1 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of VIPR1 mRNA CTD PMID:24780913 VIPR1 Human 6-propyl-2-thiouracil decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of VIPR1 mRNA CTD PMID:30047161 VIPR1 Human 8-Br-cAMP decreases expression EXP 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of VIPR1 mRNA CTD PMID:22079614 VIPR1 Human 9-cis-retinoic acid multiple interactions EXP 6480464 Alitretinoin inhibits the reaction [GW 4064 results in increased expression of VIPR1] CTD PMID:16037943 VIPR1 Human acetamide increases expression ISO Vipr1 (Rattus norvegicus) 6480464 acetamide results in increased expression of VIPR1 mRNA CTD PMID:31881176 VIPR1 Human afimoxifene increases expression EXP 6480464 afimoxifene results in increased expression of VIPR1 mRNA CTD PMID:19901195 VIPR1 Human aflatoxin B1 increases methylation EXP 6480464 Aflatoxin B1 results in increased methylation of VIPR1 intron CTD PMID:30157460 VIPR1 Human Aflatoxin B2 alpha increases methylation EXP 6480464 aflatoxin B2 results in increased methylation of VIPR1 intron CTD PMID:30157460 VIPR1 Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of VIPR1 mRNA CTD PMID:23830798 VIPR1 Human all-trans-retinoic acid multiple interactions ISO Vipr1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of VIPR1 mRNA CTD PMID:36189433 VIPR1 Human amitrole decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 Amitrole results in decreased expression of VIPR1 mRNA CTD PMID:30047161 VIPR1 Human amphetamine decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 Amphetamine results in decreased expression of VIPR1 mRNA CTD PMID:30779732 VIPR1 Human arsane multiple interactions EXP 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of VIPR1 mRNA CTD PMID:32525701 VIPR1 Human arsenic atom multiple interactions EXP 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of VIPR1 mRNA CTD PMID:32525701 VIPR1 Human arsenite(3-) increases expression ISO Vipr1 (Mus musculus) 6480464 arsenite results in increased expression of VIPR1 mRNA CTD PMID:33053406 VIPR1 Human arsenite(3-) increases methylation EXP 6480464 arsenite results in increased methylation of VIPR1 promoter CTD PMID:23974009 VIPR1 Human Azoxymethane multiple interactions ISO Vipr1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of VIPR1 mRNA CTD PMID:29950665 VIPR1 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of VIPR1 promoter CTD PMID:27901495 VIPR1 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of VIPR1 3' UTR and Benzo(a)pyrene affects the methylation of VIPR1 intron CTD PMID:27901495 and PMID:30157460 VIPR1 Human Benzo[k]fluoranthene decreases expression ISO Vipr1 (Mus musculus) 6480464 benzo(k)fluoranthene results in decreased expression of VIPR1 mRNA CTD PMID:26377693 VIPR1 Human bisphenol A affects expression ISO Vipr1 (Rattus norvegicus) 6480464 bisphenol A affects the expression of VIPR1 mRNA CTD PMID:25181051 VIPR1 Human bisphenol A increases expression ISO Vipr1 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of VIPR1 mRNA CTD PMID:32145629 and PMID:34947998 VIPR1 Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of VIPR1 mRNA CTD PMID:25596134 VIPR1 Human carbon nanotube decreases expression ISO Vipr1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 VIPR1 Human chenodeoxycholic acid increases expression EXP 6480464 Chenodeoxycholic Acid results in increased expression of VIPR1 mRNA and Chenodeoxycholic Acid results in increased expression of VIPR1 protein CTD PMID:16037943 VIPR1 Human chloroacetaldehyde decreases expression EXP 6480464 chloroacetaldehyde results in decreased expression of VIPR1 mRNA CTD PMID:25596134 VIPR1 Human chlorpyrifos increases expression ISO Vipr1 (Rattus norvegicus) 6480464 Chlorpyrifos results in increased expression of VIPR1 mRNA CTD PMID:20682304 VIPR1 Human cidofovir anhydrous increases expression EXP 6480464 Cidofovir results in increased expression of VIPR1 mRNA CTD PMID:25596134 VIPR1 Human copper(II) sulfate increases expression EXP 6480464 Copper Sulfate results in increased expression of VIPR1 mRNA CTD PMID:19549813 VIPR1 Human cyclophosphamide increases expression ISO Vipr1 (Rattus norvegicus) 6480464 Cyclophosphamide results in increased expression of VIPR1 mRNA CTD PMID:18563302 VIPR1 Human dextran sulfate multiple interactions ISO Vipr1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of VIPR1 mRNA CTD PMID:29950665 VIPR1 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of VIPR1 mRNA CTD PMID:37042841 VIPR1 Human dichlorine multiple interactions ISO Vipr1 (Rattus norvegicus) 6480464 [Ozone co-treated with Chlorine] affects the expression of VIPR1 mRNA CTD PMID:18636392 VIPR1 Human dioxygen decreases expression EXP 6480464 Oxygen deficiency results in decreased expression of VIPR1 mRNA CTD PMID:25596134 VIPR1 Human elemental selenium increases expression EXP 6480464 Selenium results in increased expression of VIPR1 mRNA CTD PMID:19244175 VIPR1 Human flutamide decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 Flutamide results in decreased expression of VIPR1 mRNA CTD PMID:24136188 VIPR1 Human folic acid multiple interactions ISO Vipr1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of VIPR1 mRNA CTD PMID:22206623 VIPR1 Human folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of VIPR1 mRNA CTD PMID:21867686 VIPR1 Human gallic acid increases expression EXP 6480464 Gallic Acid results in increased expression of VIPR1 mRNA CTD PMID:34408198 VIPR1 Human glafenine decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 Glafenine results in decreased expression of VIPR1 mRNA CTD PMID:24136188 VIPR1 Human glycidol increases expression ISO Vipr1 (Rattus norvegicus) 6480464 glycidol results in increased expression of VIPR1 mRNA CTD PMID:24915197 VIPR1 Human GW 4064 multiple interactions EXP 6480464 alitretinoin inhibits the reaction [GW 4064 results in increased expression of VIPR1] CTD PMID:16037943 VIPR1 Human GW 4064 increases expression EXP 6480464 GW 4064 results in increased expression of VIPR1 CTD PMID:16037943 VIPR1 Human lipopolysaccharide multiple interactions EXP 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of VIPR1 mRNA CTD PMID:35811015 VIPR1 Human lipopolysaccharide decreases expression EXP 6480464 Lipopolysaccharides results in decreased expression of VIPR1 mRNA CTD PMID:35811015 VIPR1 Human methimazole decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 Methimazole results in decreased expression of VIPR1 mRNA CTD PMID:30047161 VIPR1 Human methotrexate affects expression ISO Vipr1 (Mus musculus) 6480464 Methotrexate affects the expression of VIPR1 mRNA CTD PMID:18502557 VIPR1 Human methoxychlor decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 Methoxychlor results in decreased expression of VIPR1 mRNA CTD PMID:21782745 VIPR1 Human mono(2-ethylhexyl) phthalate multiple interactions ISO Vipr1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of VIPR1 mRNA CTD PMID:36189433 VIPR1 Human Muraglitazar decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 muraglitazar results in decreased expression of VIPR1 mRNA CTD PMID:21515302 VIPR1 Human N-nitrosodiethylamine decreases expression ISO Vipr1 (Mus musculus) 6480464 Diethylnitrosamine results in decreased expression of VIPR1 mRNA CTD PMID:24535843 VIPR1 Human N-nitrosodiethylamine decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 Diethylnitrosamine results in decreased expression of VIPR1 mRNA CTD PMID:19041683 and PMID:19638242 VIPR1 Human N-nitrosodimethylamine decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 Dimethylnitrosamine results in decreased expression of VIPR1 mRNA CTD PMID:25380136 VIPR1 Human nebivolol increases expression EXP 6480464 Nebivolol results in increased expression of VIPR1 mRNA CTD PMID:17467819 VIPR1 Human nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of VIPR1 mRNA CTD PMID:24768652 and PMID:25583101 VIPR1 Human nimesulide decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 nimesulide results in decreased expression of VIPR1 mRNA CTD PMID:24136188 VIPR1 Human orphenadrine affects expression ISO Vipr1 (Rattus norvegicus) 6480464 Orphenadrine affects the expression of VIPR1 mRNA CTD PMID:23665939 VIPR1 Human ozone multiple interactions ISO Vipr1 (Rattus norvegicus) 6480464 [Ozone co-treated with Chlorine] affects the expression of VIPR1 mRNA CTD PMID:18636392 VIPR1 Human ozone multiple interactions ISO Vipr1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of VIPR1 mRNA CTD PMID:34911549 VIPR1 Human p-tert-Amylphenol multiple interactions EXP 6480464 [4-tert-octylphenol co-treated with 4-nonylphenol] results in decreased expression of VIPR1 mRNA CTD PMID:23626723 VIPR1 Human p-toluidine decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 4-toluidine results in decreased expression of VIPR1 mRNA CTD PMID:27638505 VIPR1 Human paracetamol affects expression ISO Vipr1 (Mus musculus) 6480464 Acetaminophen affects the expression of VIPR1 mRNA CTD PMID:17562736 VIPR1 Human PCB138 multiple interactions ISO Vipr1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 VIPR1 Human perfluorooctane-1-sulfonic acid multiple interactions ISO Vipr1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of VIPR1 mRNA CTD PMID:36331819 VIPR1 Human pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of VIPR1 mRNA CTD PMID:19710929 VIPR1 Human pirinixic acid decreases expression ISO Vipr1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of VIPR1 mRNA CTD PMID:20813756 VIPR1 Human propanal increases expression EXP 6480464 propionaldehyde results in increased expression of VIPR1 mRNA CTD PMID:26079696 VIPR1 Human quercetin increases expression EXP 6480464 Quercetin results in increased expression of VIPR1 mRNA CTD PMID:15309432 VIPR1 Human S-(1,2-dichlorovinyl)-L-cysteine multiple interactions EXP 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of VIPR1 mRNA CTD PMID:35811015 VIPR1 Human selenium atom increases expression EXP 6480464 Selenium results in increased expression of VIPR1 mRNA CTD PMID:19244175 VIPR1 Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide analog results in increased expression of VIPR1 mRNA CTD PMID:25895662 VIPR1 Human silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of VIPR1 mRNA CTD PMID:25351596 VIPR1 Human silicon dioxide decreases expression ISO Vipr1 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of VIPR1 mRNA CTD PMID:23221170 VIPR1 Human sodium arsenate multiple interactions EXP 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of VIPR1 mRNA CTD PMID:32525701 VIPR1 Human sulfadimethoxine decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 Sulfadimethoxine results in decreased expression of VIPR1 mRNA CTD PMID:30047161 VIPR1 Human tetrachloromethane affects expression ISO Vipr1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of VIPR1 mRNA CTD PMID:17484886 VIPR1 Human tetrachloromethane decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of VIPR1 mRNA CTD PMID:16644059 and PMID:31150632 VIPR1 Human thioacetamide decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of VIPR1 mRNA CTD PMID:34492290 VIPR1 Human titanium dioxide multiple interactions ISO Vipr1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of VIPR1 mRNA CTD PMID:29950665 VIPR1 Human titanium dioxide decreases methylation ISO Vipr1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of VIPR1 gene CTD PMID:35295148 VIPR1 Human triphenyl phosphate decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 triphenyl phosphate results in decreased expression of VIPR1 mRNA CTD PMID:30589522 VIPR1 Human troglitazone decreases expression ISO Vipr1 (Rattus norvegicus) 6480464 troglitazone results in decreased expression of VIPR1 mRNA CTD PMID:21515302 VIPR1 Human tunicamycin decreases expression ISO Vipr1 (Mus musculus) 6480464 Tunicamycin results in decreased expression of VIPR1 mRNA CTD PMID:17127020 VIPR1 Human valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of VIPR1 gene CTD PMID:29154799 VIPR1 Human vinclozolin affects expression ISO Vipr1 (Rattus norvegicus) 6480464 vinclozolin affects the expression of VIPR1 mRNA CTD PMID:19015723 VIPR1 Human zoledronic acid increases expression EXP 6480464 zoledronic acid results in increased expression of VIPR1 mRNA CTD PMID:25596134
(1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-methylcholanthrene (EXP) 4,4'-diaminodiphenylmethane (ISO) 4-nonylphenol (EXP) 4-tert-Octylphenol (EXP) 6-propyl-2-thiouracil (ISO) 8-Br-cAMP (EXP) 9-cis-retinoic acid (EXP) acetamide (ISO) afimoxifene (EXP) aflatoxin B1 (EXP) Aflatoxin B2 alpha (EXP) all-trans-retinoic acid (EXP,ISO) amitrole (ISO) amphetamine (ISO) arsane (EXP) arsenic atom (EXP) arsenite(3-) (EXP,ISO) Azoxymethane (ISO) benzo[a]pyrene (EXP) Benzo[k]fluoranthene (ISO) bisphenol A (ISO) cadmium dichloride (EXP) carbon nanotube (ISO) chenodeoxycholic acid (EXP) chloroacetaldehyde (EXP) chlorpyrifos (ISO) cidofovir anhydrous (EXP) copper(II) sulfate (EXP) cyclophosphamide (ISO) dextran sulfate (ISO) Dibutyl phosphate (EXP) dichlorine (ISO) dioxygen (EXP) elemental selenium (EXP) flutamide (ISO) folic acid (EXP,ISO) gallic acid (EXP) glafenine (ISO) glycidol (ISO) GW 4064 (EXP) lipopolysaccharide (EXP) methimazole (ISO) methotrexate (ISO) methoxychlor (ISO) mono(2-ethylhexyl) phthalate (ISO) Muraglitazar (ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (ISO) nebivolol (EXP) nickel atom (EXP) nimesulide (ISO) orphenadrine (ISO) ozone (ISO) p-tert-Amylphenol (EXP) p-toluidine (ISO) paracetamol (ISO) PCB138 (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (EXP,ISO) propanal (EXP) quercetin (EXP) S-(1,2-dichlorovinyl)-L-cysteine (EXP) selenium atom (EXP) silicon dioxide (EXP,ISO) sodium arsenate (EXP) sulfadimethoxine (ISO) tetrachloromethane (ISO) thioacetamide (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) troglitazone (ISO) tunicamycin (ISO) valproic acid (EXP) vinclozolin (ISO) zoledronic acid (EXP)
VIPR1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 42,489,299 - 42,537,568 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 42,489,299 - 42,537,573 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 42,530,791 - 42,579,060 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 42,519,121 - 42,554,064 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 42,519,120 - 42,554,064 NCBI Celera 3 42,484,508 - 42,519,469 (+) NCBI Celera Cytogenetic Map 3 p22.1 NCBI HuRef 3 42,574,992 - 42,623,180 (+) NCBI HuRef CHM1_1 3 42,481,967 - 42,530,261 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 42,507,314 - 42,555,561 (+) NCBI T2T-CHM13v2.0
Vipr1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 121,471,782 - 121,502,020 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 121,471,782 - 121,502,020 (+) Ensembl GRCm39 Ensembl GRCm38 9 121,642,716 - 121,672,954 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 121,642,716 - 121,672,954 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 121,551,834 - 121,582,072 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 121,491,414 - 121,519,332 (+) NCBI MGSCv36 mm8 Celera 9 122,116,040 - 122,146,512 (+) NCBI Celera Cytogenetic Map 9 F4 NCBI cM Map 9 72.5 NCBI
Vipr1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 130,181,219 - 130,217,098 (+) NCBI GRCr8 mRatBN7.2 8 121,303,739 - 121,339,587 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 121,310,248 - 121,339,585 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 126,909,204 - 126,938,516 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 125,108,275 - 125,137,587 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 122,937,779 - 122,967,104 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 130,283,453 - 130,313,431 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 8 129,467,937 - 129,496,866 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 8 120,444,918 - 120,474,479 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
Vipr1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955420 28,234,153 - 28,253,168 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955420 28,234,590 - 28,253,146 (-) NCBI ChiLan1.0 ChiLan1.0
VIPR1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 42,464,670 - 42,503,777 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 42,469,438 - 42,504,483 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 42,407,591 - 42,442,565 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 42,669,338 - 42,705,170 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 42,670,195 - 42,705,170 (+) Ensembl panpan1.1 panPan2
VIPR1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 11,635,809 - 11,666,926 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 11,635,394 - 11,666,936 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 11,609,898 - 11,641,322 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 11,924,939 - 11,956,370 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 11,924,529 - 11,957,534 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 11,726,543 - 11,757,961 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 11,868,801 - 11,900,208 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 11,873,062 - 11,904,503 (+) NCBI UU_Cfam_GSD_1.0
Vipr1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 200,208,554 - 200,255,619 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936695 2,564,890 - 2,607,676 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936695 2,564,917 - 2,597,009 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
VIPR1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 26,036,629 - 26,075,691 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 26,036,610 - 26,073,168 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 28,704,211 - 28,740,358 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
VIPR1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 3,950,129 - 3,984,849 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 3,950,193 - 3,984,948 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 163,214,473 - 163,249,573 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Vipr1
.
Predicted Target Of
Count of predictions: 7279 Count of miRNA genes: 1159 Interacting mature miRNAs: 1502 Transcripts: ENST00000325123, ENST00000433647, ENST00000436487, ENST00000438259, ENST00000439731, ENST00000439910, ENST00000443646, ENST00000446673, ENST00000450274, ENST00000465338, ENST00000473495, ENST00000473575, ENST00000487545, ENST00000490161, ENST00000495189, ENST00000498102, ENST00000543411 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597403307 GWAS1499381_H cerebrospinal fluid clusterin measurement QTL GWAS1499381 (human) 0.000003 cerebrospinal fluid clusterin measurement 3 42530054 42530055 Human 597061959 GWAS1158033_H BMI-adjusted hip circumference QTL GWAS1158033 (human) 0.000008 BMI-adjusted hip circumference hip circumference (CMO:0000014) 3 42523132 42523133 Human 1298487 BFD1_H Body fluid distribution QTL 1 (human) 3.94 Body fluid distribution impedance ratio 3 36380712 62380712 Human 1298489 RA4_H Rheumatoid arthritis QTL 4 (human) 0.0283 Joint/bone inflammation rheumatoid arthritis 3 36380712 62380712 Human 1643509 BW293_H Body Weight QTL 293 (human) 1.42 Body weight BMI 3 36380712 62380712 Human 597161418 GWAS1257492_H nucleotide measurement QTL GWAS1257492 (human) 0.000003 nucleotide metabolism trait (VT:0003806) 3 42531930 42531931 Human 2316061 GLUCO194_H Glucose level QTL 194 (human) 0.02 Glucose level 3 23380774 49380774 Human 2289308 BW392_H Body weight QTL 392 (human) 1.42 Body weight BMI 3 36380712 62380712 Human
SHGC-85073
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 42,556,410 - 42,556,680 UniSTS GRCh37 Build 36 3 42,531,414 - 42,531,684 RGD NCBI36 Celera 3 42,496,814 - 42,497,084 RGD Cytogenetic Map 3 p22 UniSTS HuRef 3 42,600,524 - 42,600,794 UniSTS TNG Radiation Hybrid Map 3 25957.0 UniSTS
G59451
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 42,571,450 - 42,571,643 UniSTS GRCh37 Build 36 3 42,546,454 - 42,546,647 RGD NCBI36 Celera 3 42,511,854 - 42,512,048 RGD Cytogenetic Map 3 p22 UniSTS HuRef 3 42,615,563 - 42,615,757 UniSTS TNG Radiation Hybrid Map 3 26006.0 UniSTS
D3S1497
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 42,565,072 - 42,565,188 UniSTS GRCh37 Build 36 3 42,540,076 - 42,540,192 RGD NCBI36 Celera 3 42,505,476 - 42,505,592 RGD Cytogenetic Map 3 p22 UniSTS HuRef 3 42,609,185 - 42,609,301 UniSTS
VIPR1_387
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 42,578,345 - 42,579,229 UniSTS GRCh37 Build 36 3 42,553,349 - 42,554,233 RGD NCBI36 Celera 3 42,518,749 - 42,519,633 RGD HuRef 3 42,622,460 - 42,623,344 UniSTS
RH68684
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 42,578,927 - 42,579,025 UniSTS GRCh37 Build 36 3 42,553,931 - 42,554,029 RGD NCBI36 Celera 3 42,519,331 - 42,519,429 RGD Cytogenetic Map 3 p22 UniSTS HuRef 3 42,623,042 - 42,623,140 UniSTS GeneMap99-GB4 RH Map 3 139.81 UniSTS NCBI RH Map 3 382.4 UniSTS
SHGC-76862
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 42,578,208 - 42,578,536 UniSTS GRCh37 Build 36 3 42,553,212 - 42,553,540 RGD NCBI36 Celera 3 42,518,612 - 42,518,940 RGD Cytogenetic Map 3 p22 UniSTS HuRef 3 42,622,323 - 42,622,651 UniSTS TNG Radiation Hybrid Map 3 26010.0 UniSTS GeneMap99-GB4 RH Map 3 143.16 UniSTS Whitehead-RH Map 3 171.2 UniSTS Whitehead-YAC Contig Map 3 UniSTS
MARC_17029-17030:1023294211:1
Human Assembly Chr Position (strand) Source JBrowse HuRef 3 42,613,031 - 42,613,696 UniSTS
GDB:455353
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 3 p22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2430
2788
2239
4903
1715
2309
6
618
1720
459
2221
7041
6248
42
3708
1
821
1728
1581
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000325123 ⟹ ENSP00000327246
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,502,643 - 42,537,568 (+) Ensembl
Ensembl Acc Id:
ENST00000433647 ⟹ ENSP00000394950
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,489,299 - 42,537,567 (+) Ensembl
Ensembl Acc Id:
ENST00000436487 ⟹ ENSP00000393215
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,502,612 - 42,532,310 (+) Ensembl
Ensembl Acc Id:
ENST00000438259 ⟹ ENSP00000415371
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,502,612 - 42,537,573 (+) Ensembl
Ensembl Acc Id:
ENST00000439731 ⟹ ENSP00000403478
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,502,623 - 42,530,932 (+) Ensembl
Ensembl Acc Id:
ENST00000439910 ⟹ ENSP00000403680
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,502,617 - 42,536,544 (+) Ensembl
Ensembl Acc Id:
ENST00000443646 ⟹ ENSP00000388479
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,502,612 - 42,536,394 (+) Ensembl
Ensembl Acc Id:
ENST00000446673 ⟹ ENSP00000396204
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,502,664 - 42,532,333 (+) Ensembl
Ensembl Acc Id:
ENST00000450274 ⟹ ENSP00000415013
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,501,912 - 42,527,496 (+) Ensembl
Ensembl Acc Id:
ENST00000465338
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,529,734 - 42,531,526 (+) Ensembl
Ensembl Acc Id:
ENST00000473495
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,489,480 - 42,500,416 (+) Ensembl
Ensembl Acc Id:
ENST00000473575
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,513,799 - 42,527,899 (+) Ensembl
Ensembl Acc Id:
ENST00000487545
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,489,494 - 42,519,314 (+) Ensembl
Ensembl Acc Id:
ENST00000490161
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,489,483 - 42,500,146 (+) Ensembl
Ensembl Acc Id:
ENST00000495189
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,527,653 - 42,530,897 (+) Ensembl
Ensembl Acc Id:
ENST00000498102
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,532,866 - 42,537,567 (+) Ensembl
Ensembl Acc Id:
ENST00000543411 ⟹ ENSP00000445701
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 42,502,612 - 42,537,573 (+) Ensembl
RefSeq Acc Id:
NM_001251882 ⟹ NP_001238811
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 42,489,299 - 42,537,568 (+) NCBI HuRef 3 42,574,992 - 42,623,180 (+) NCBI CHM1_1 3 42,481,967 - 42,530,261 (+) NCBI T2T-CHM13v2.0 3 42,507,314 - 42,555,561 (+) NCBI
Sequence:
ATTTTCCCAGCTTACTAGTGGAAAAGCAGCTTCTTTCCCACAGTTCCAGCAAAAGCCCCAGGGCTGATGCTCATTGGCCCAGGTTGGGGCATGTGACCATTGGCAAGACTCCCATTGGCCAGGCCTGG
hide sequence
RefSeq Acc Id:
NM_001251883 ⟹ NP_001238812
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 42,502,643 - 42,537,568 (+) NCBI GRCh37 3 42,530,791 - 42,579,065 (+) NCBI HuRef 3 42,574,992 - 42,623,180 (+) NCBI CHM1_1 3 42,495,280 - 42,530,261 (+) NCBI T2T-CHM13v2.0 3 42,520,639 - 42,555,561 (+) NCBI
Sequence:
ACTCTGCCAGGCTCCCGGCCATCGCCCGCCTGGTGCGCCGCCCGCCAGCTCTTTGCCCGCGCGGGGCCGCCCGCCGCGGGCTCAGGGCAGACCATGCGCCCGCCAAGTCCGCTGCCCGCCCGCTGGCT
hide sequence
RefSeq Acc Id:
NM_001251884 ⟹ NP_001238813
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 42,502,643 - 42,537,568 (+) NCBI GRCh37 3 42,530,791 - 42,579,065 (+) NCBI HuRef 3 42,574,992 - 42,623,180 (+) NCBI CHM1_1 3 42,495,280 - 42,530,261 (+) NCBI T2T-CHM13v2.0 3 42,520,639 - 42,555,561 (+) NCBI
Sequence:
ACTCTGCCAGGCTCCCGGCCATCGCCCGCCTGGTGCGCCGCCCGCCAGCTCTTTGCCCGCGCGGGGCCGCCCGCCGCGGGCTCAGGGCAGACCATGCGCCCGCCAAGTCCGCTGCCCGCCCGCTGGCT
hide sequence
RefSeq Acc Id:
NM_001251885 ⟹ NP_001238814
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 42,502,643 - 42,537,568 (+) NCBI GRCh37 3 42,530,791 - 42,579,065 (+) NCBI HuRef 3 42,574,992 - 42,623,180 (+) NCBI CHM1_1 3 42,495,280 - 42,530,261 (+) NCBI T2T-CHM13v2.0 3 42,520,639 - 42,555,561 (+) NCBI
Sequence:
ACTCTGCCAGGCTCCCGGCCATCGCCCGCCTGGTGCGCCGCCCGCCAGCTCTTTGCCCGCGCGGGGCCGCCCGCCGCGGGCTCAGGGCAGACCATGCGCCCGCCAAGTCCGCTGCCCGCCCGCTGGCT
hide sequence
RefSeq Acc Id:
NM_004624 ⟹ NP_004615
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 42,502,643 - 42,537,568 (+) NCBI GRCh37 3 42,530,791 - 42,579,065 (+) NCBI Build 36 3 42,519,121 - 42,554,064 (+) NCBI Archive HuRef 3 42,574,992 - 42,623,180 (+) NCBI CHM1_1 3 42,495,280 - 42,530,261 (+) NCBI T2T-CHM13v2.0 3 42,520,639 - 42,555,561 (+) NCBI
Sequence:
ACTCTGCCAGGCTCCCGGCCATCGCCCGCCTGGTGCGCCGCCCGCCAGCTCTTTGCCCGCGCGG
hide sequence
RefSeq Acc Id:
XM_005265437 ⟹ XP_005265494
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 42,502,643 - 42,537,568 (+) NCBI GRCh37 3 42,530,791 - 42,579,065 (+) NCBI
Sequence:
ACTCTGCCAGGCTCCCGGCCATCGCCCGCCTGGTGCGCCGCCCGCCAGCTCTTTGCCCGCGCGG
hide sequence
RefSeq Acc Id:
XM_005265439 ⟹ XP_005265496
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 42,502,643 - 42,537,568 (+) NCBI GRCh37 3 42,530,791 - 42,579,065 (+) NCBI
Sequence:
ACTCTGCCAGGCTCCCGGCCATCGCCCGCCTGGTGCGCCGCCCGCCAGCTCTTTGCCCGCGCGG
hide sequence
RefSeq Acc Id:
XM_011534080 ⟹ XP_011532382
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 42,502,643 - 42,532,742 (+) NCBI
Sequence:
ACAGCGCCAGCGCCACTCTGCCAGGCTCCCGGCCATCGCCCGCCTGGTGCGCCGCCCGCCAGCT
hide sequence
RefSeq Acc Id:
XM_047448850 ⟹ XP_047304806
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 42,502,643 - 42,532,742 (+) NCBI
RefSeq Acc Id:
XM_047448851 ⟹ XP_047304807
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 42,527,426 - 42,537,568 (+) NCBI
RefSeq Acc Id:
XM_054347745 ⟹ XP_054203720
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 42,520,639 - 42,555,561 (+) NCBI
RefSeq Acc Id:
XM_054347746 ⟹ XP_054203721
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 42,520,639 - 42,555,561 (+) NCBI
RefSeq Acc Id:
XM_054347747 ⟹ XP_054203722
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 42,520,639 - 42,553,054 (+) NCBI
RefSeq Acc Id:
XM_054347748 ⟹ XP_054203723
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 42,520,639 - 42,553,054 (+) NCBI
RefSeq Acc Id:
XM_054347749 ⟹ XP_054203724
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 42,545,419 - 42,555,561 (+) NCBI
RefSeq Acc Id:
XR_007095725
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 42,502,643 - 42,532,275 (+) NCBI
RefSeq Acc Id:
XR_008486791
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 42,520,639 - 42,550,268 (+) NCBI
RefSeq Acc Id:
XR_008486792
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 42,520,639 - 42,550,268 (+) NCBI
RefSeq Acc Id:
XR_940500
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 42,502,643 - 42,532,275 (+) NCBI
Sequence:
ACAGCGCCAGCGCCACTCTGCCAGGCTCCCGGCCATCGCCCGCCTGGTGCGCCGCCCGCCAGCTCTTTGCCCGCGCGGGGCCGCCCGCCGCGGGCTCAGGGCAGACCATGCGCCCGCCAAGTCCGCTG
hide sequence
RefSeq Acc Id:
NP_004615 ⟸ NM_004624
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q15871 (UniProtKB/Swiss-Prot), G3V0I1 (UniProtKB/Swiss-Prot), F5H1F5 (UniProtKB/Swiss-Prot), B4DGI4 (UniProtKB/Swiss-Prot), B4DEB5 (UniProtKB/Swiss-Prot), B3KPV1 (UniProtKB/Swiss-Prot), A5JUT9 (UniProtKB/Swiss-Prot), Q6P2M6 (UniProtKB/Swiss-Prot), P32241 (UniProtKB/Swiss-Prot)
- Sequence:
MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKA
hide sequence
RefSeq Acc Id:
NP_001238811 ⟸ NM_001251882
- Peptide Label:
isoform 2
- Sequence:
MIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGYTIGYGLSLATLLVATAILSLFRK
hide sequence
RefSeq Acc Id:
NP_001238813 ⟸ NM_001251884
- Peptide Label:
isoform 4
- UniProtKB:
P32241 (UniProtKB/Swiss-Prot), B4DNY6 (UniProtKB/TrEMBL)
- Sequence:
MRAGRRPRLGPWAGGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWT
hide sequence
RefSeq Acc Id:
NP_001238812 ⟸ NM_001251883
- Peptide Label:
isoform 3
- UniProtKB:
P32241 (UniProtKB/Swiss-Prot)
- Sequence:
MTRQRVWMRWAVRQPWSFSNIVSWLTSSGCWWRASTCTPCLPSPSSLSGSTSGGVPSTFTMVWTIARIHFEDYGCWDTINSSLWWIIKGPILTSILVNFILFICIIRILLQKLRPPDIRKSDSSPYSR
hide sequence
RefSeq Acc Id:
NP_001238814 ⟸ NM_001251885
- Peptide Label:
isoform 5
- UniProtKB:
B4DNY6 (UniProtKB/TrEMBL)
- Sequence:
MRAGRLQEECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGYTIGYGLSLA
hide sequence
RefSeq Acc Id:
XP_005265494 ⟸ XM_005265437
- Peptide Label:
isoform X1
- Sequence:
MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENETIGCS
hide sequence
RefSeq Acc Id:
XP_005265496 ⟸ XM_005265439
- Peptide Label:
isoform X2
- Sequence:
MRAGRRPRLGPWAGGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWT
hide sequence
RefSeq Acc Id:
XP_011532382 ⟸ XM_011534080
- Peptide Label:
isoform X3
- Sequence:
MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKA
hide sequence
Ensembl Acc Id:
ENSP00000415371 ⟸ ENST00000438259
Ensembl Acc Id:
ENSP00000403478 ⟸ ENST00000439731
Ensembl Acc Id:
ENSP00000415013 ⟸ ENST00000450274
Ensembl Acc Id:
ENSP00000403680 ⟸ ENST00000439910
Ensembl Acc Id:
ENSP00000445701 ⟸ ENST00000543411
Ensembl Acc Id:
ENSP00000327246 ⟸ ENST00000325123
Ensembl Acc Id:
ENSP00000388479 ⟸ ENST00000443646
Ensembl Acc Id:
ENSP00000396204 ⟸ ENST00000446673
Ensembl Acc Id:
ENSP00000394950 ⟸ ENST00000433647
Ensembl Acc Id:
ENSP00000393215 ⟸ ENST00000436487
RefSeq Acc Id:
XP_047304806 ⟸ XM_047448850
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_047304807 ⟸ XM_047448851
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_054203720 ⟸ XM_054347745
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_054203721 ⟸ XM_054347746
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_054203722 ⟸ XM_054347747
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_054203723 ⟸ XM_054347748
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_054203724 ⟸ XM_054347749
- Peptide Label:
isoform X5
RGD ID: 6864052 Promoter ID: EPDNEW_H5191 Type: initiation region Name: VIPR1_1 Description: vasoactive intestinal peptide receptor 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 3 42,502,643 - 42,502,703 EPDNEW
RGD ID: 6801937 Promoter ID: HG_KWN:44575 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, K562, Lymphoblastoid Transcripts: NM_004624, OTTHUMT00000343239, OTTHUMT00000343240, OTTHUMT00000343242, OTTHUMT00000343322, OTTHUMT00000343323, OTTHUMT00000343324, OTTHUMT00000343328 Position: Human Assembly Chr Position (strand) Source Build 36 3 42,518,776 - 42,519,276 (+) MPROMDB
RGD ID: 6801936 Promoter ID: HG_KWN:44577 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: NB4 Transcripts: OTTHUMT00000343417 Position: Human Assembly Chr Position (strand) Source Build 36 3 42,543,311 - 42,543,811 (+) MPROMDB
