Symbol:
Serpinb6a
Name:
serpin family B member 6A
RGD ID:
735108
Description:
Predicted to enable protease binding activity and serine-type endopeptidase inhibitor activity. Predicted to be involved in cellular response to osmotic stress; negative regulation of endopeptidase activity; and sensory perception of sound. Predicted to be part of serine protease inhibitor complex. Predicted to be active in cytoplasm and extracellular space. Human ortholog(s) of this gene implicated in autosomal recessive nonsyndromic deafness 91. Orthologous to human SERPINB6 (serpin family B member 6); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
MGC72983; serine (or cysteine) peptidase inhibitor, clade B, member 6; serine (or cysteine) peptidase inhibitor, clade B, member 6a; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 6; serpin B6; serpin family B member 6; serpin peptidase inhibitor, clade B (ovalbumin), member 6; Serpinb6
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SERPINB6 (serpin family B member 6) RGD
RGD
Mus musculus (house mouse):
Serpinb6a (serine (or cysteine) peptidase inhibitor, clade B, member 6a) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
HMSD (histocompatibility minor serpin domain containing) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LOC106504299 (serpin B6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SERPINB6 (serpin family B member 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
HMSD (histocompatibility minor serpin domain containing) HGNC
PhylomeDB
Alliance orthologs 3
Homo sapiens (human):
SERPINB6 (serpin family B member 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Serpinb6a (serine (or cysteine) peptidase inhibitor, clade B, member 6a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
serpinb1l1 (serpin peptidase inhibitor, clade B (ovalbumin), member 1, like 1)
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
serpinb1l4 (serpin peptidase inhibitor, clade B (ovalbumin), member 1, like 4)
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
zgc:173729
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
serpinb1l3 (serpin peptidase inhibitor, clade B (ovalbumin), member 1, like 3)
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
serpinb14 (serpin peptidase inhibitor, clade B (ovalbumin), member 14)
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
srp-7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Spn28Da
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PhylomeDB)
Drosophila melanogaster (fruit fly):
Spn55B
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
serpinb6
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 31,076,811 - 31,195,035 (+) NCBI GRCr8 mRatBN7.2 17 30,871,468 - 30,989,703 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 30,871,468 - 31,014,427 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 30,685,617 - 30,804,168 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 32,289,360 - 32,407,916 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 30,681,350 - 30,799,899 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 32,154,747 - 32,209,598 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 32,190,801 - 32,209,590 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 34,084,076 - 34,102,920 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 37,316,389 - 37,335,124 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 37,319,229 - 37,337,965 (+) NCBI Celera 17 30,535,108 - 30,553,843 (+) NCBI Celera Cytogenetic Map 17 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Serpinb6a Rat (1->4)-beta-D-glucan multiple interactions ISO Serpinb6a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SERPINB6A mRNA CTD PMID:36331819 Serpinb6a Rat 1,1-dichloroethene increases expression ISO Serpinb6a (Mus musculus) 6480464 vinylidene chloride results in increased expression of SERPINB6A mRNA CTD PMID:26682919 Serpinb6a Rat 1,2-dimethylhydrazine decreases expression ISO Serpinb6a (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SERPINB6A mRNA CTD PMID:22206623 Serpinb6a Rat 17beta-hydroxy-5alpha-androstan-3-one decreases expression ISO Serpinb6a (Mus musculus) 6480464 Dihydrotestosterone results in decreased expression of SERPINB6A mRNA CTD PMID:17023530 Serpinb6a Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Serpinb6a (Mus musculus) 6480464 2 more ... CTD PMID:21851831 Serpinb6a Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Serpinb6a (Mus musculus) 6480464 2 more ... CTD PMID:21851831 Serpinb6a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO SERPINB6 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of SERPINB6 mRNA CTD PMID:20106945 Serpinb6a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Serpinb6a (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SERPINB6A mRNA CTD PMID:19770486 more ... Serpinb6a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Serpinb6a (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SERPINB6A mRNA CTD PMID:18343893 more ... Serpinb6a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SERPINB6A mRNA CTD PMID:22298810 and PMID:34747641 Serpinb6a Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Serpinb6a (Mus musculus) 6480464 2 more ... CTD PMID:18343893 Serpinb6a Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of SERPINB6A mRNA CTD PMID:21346803 Serpinb6a Rat 2,6-dimethoxyphenol multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Serpinb6a Rat 4,4'-sulfonyldiphenol increases expression ISO Serpinb6a (Mus musculus) 6480464 bisphenol S results in increased expression of SERPINB6A mRNA CTD PMID:30951980 Serpinb6a Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SERPINB6A mRNA CTD PMID:36041667 Serpinb6a Rat 4-hydroxyphenyl retinamide decreases expression ISO Serpinb6a (Mus musculus) 6480464 Fenretinide results in decreased expression of SERPINB6 mRNA CTD PMID:28973697 Serpinb6a Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SERPINB6 mRNA CTD PMID:30047161 Serpinb6a Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of SERPINB6A mRNA CTD PMID:31881176 Serpinb6a Rat actinomycin D multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of SERPINB6 protein CTD PMID:38460933 Serpinb6a Rat Aflatoxin B2 alpha decreases methylation ISO SERPINB6 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of SERPINB6 intron CTD PMID:30157460 Serpinb6a Rat all-trans-retinoic acid increases expression ISO SERPINB6 (Homo sapiens) 6480464 Tretinoin results in increased expression of SERPINB6 mRNA CTD PMID:21934132 and PMID:33167477 Serpinb6a Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SERPINB6 mRNA CTD PMID:30047161 Serpinb6a Rat ampicillin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of SERPINB6 protein CTD PMID:30545405 Serpinb6a Rat Aroclor 1254 decreases expression ISO Serpinb6a (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of SERPINB6A mRNA CTD PMID:23650126 Serpinb6a Rat Aroclor 1254 increases expression ISO Serpinb6a (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of SERPINB6A mRNA CTD PMID:25270620 Serpinb6a Rat arsane multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SERPINB6 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SERPINB6 mRNA CTD PMID:39836092 Serpinb6a Rat arsenic atom multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SERPINB6 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SERPINB6 mRNA CTD PMID:39836092 Serpinb6a Rat benzo[a]pyrene increases expression ISO Serpinb6a (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SERPINB6A mRNA CTD PMID:19770486 and PMID:21715664 Serpinb6a Rat benzo[a]pyrene increases methylation ISO SERPINB6 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SERPINB6 promoter CTD PMID:27901495 Serpinb6a Rat beta-lapachone increases expression ISO SERPINB6 (Homo sapiens) 6480464 beta-lapachone results in increased expression of SERPINB6 mRNA CTD PMID:38218311 Serpinb6a Rat bis(2-ethylhexyl) phthalate decreases expression ISO Serpinb6a (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of SERPINB6A mRNA CTD PMID:33754040 Serpinb6a Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SERPINB6 mRNA CTD PMID:25181051 Serpinb6a Rat bisphenol A affects expression ISO SERPINB6 (Homo sapiens) 6480464 bisphenol A affects the expression of SERPINB6 protein CTD PMID:37567409 Serpinb6a Rat bisphenol A increases expression ISO SERPINB6 (Homo sapiens) 6480464 bisphenol A results in increased expression of SERPINB6 protein CTD PMID:34186270 Serpinb6a Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SERPINB6A mRNA CTD PMID:36041667 Serpinb6a Rat bisphenol A increases expression ISO Serpinb6a (Mus musculus) 6480464 bisphenol A results in increased expression of SERPINB6A mRNA CTD PMID:30951980 Serpinb6a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SERPINB6A mRNA CTD PMID:30816183 and PMID:34947998 Serpinb6a Rat bisphenol AF increases expression ISO SERPINB6 (Homo sapiens) 6480464 bisphenol AF results in increased expression of SERPINB6 protein CTD PMID:34186270 Serpinb6a Rat Bisphenol B increases expression ISO SERPINB6 (Homo sapiens) 6480464 bisphenol B results in increased expression of SERPINB6 protein CTD PMID:34186270 Serpinb6a Rat bisphenol F increases expression ISO Serpinb6a (Mus musculus) 6480464 bisphenol F results in increased expression of SERPINB6A mRNA CTD PMID:30951980 and PMID:38685157 Serpinb6a Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SERPINB6A mRNA CTD PMID:36041667 Serpinb6a Rat bisphenol F increases expression ISO SERPINB6 (Homo sapiens) 6480464 bisphenol F results in increased expression of SERPINB6 protein CTD PMID:34186270 Serpinb6a Rat cadmium dichloride increases expression ISO SERPINB6 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of SERPINB6 protein CTD PMID:24527689 Serpinb6a Rat calcitriol increases expression ISO SERPINB6 (Homo sapiens) 6480464 Calcitriol results in increased expression of SERPINB6 mRNA CTD PMID:16002434 Serpinb6a Rat calyculin a increases expression ISO Serpinb6a (Mus musculus) 6480464 calyculin A results in increased expression of SERPINB6A mRNA CTD PMID:25270620 Serpinb6a Rat choline multiple interactions ISO Serpinb6a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SERPINB6A mRNA CTD PMID:20938992 Serpinb6a Rat cisplatin increases expression ISO SERPINB6 (Homo sapiens) 6480464 Cisplatin results in increased expression of SERPINB6 mRNA CTD PMID:27594783 Serpinb6a Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of SERPINB6 mRNA CTD PMID:30556269 Serpinb6a Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of SERPINB6 mRNA CTD PMID:30556269 Serpinb6a Rat copper(II) sulfate decreases expression ISO SERPINB6 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SERPINB6 mRNA CTD PMID:19549813 Serpinb6a Rat cyclosporin A increases expression ISO Serpinb6a (Mus musculus) 6480464 Cyclosporine results in increased expression of SERPINB6 mRNA CTD PMID:23308384 Serpinb6a Rat cytarabine decreases expression ISO SERPINB6 (Homo sapiens) 6480464 Cytarabine results in decreased expression of SERPINB6 mRNA CTD PMID:21198554 Serpinb6a Rat Dibutyl phosphate affects expression ISO SERPINB6 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SERPINB6 mRNA CTD PMID:37042841 Serpinb6a Rat dibutyl phthalate increases expression ISO Serpinb6a (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of SERPINB6A mRNA CTD PMID:21266533 Serpinb6a Rat dicrotophos decreases expression ISO SERPINB6 (Homo sapiens) 6480464 dicrotophos results in decreased expression of SERPINB6 mRNA CTD PMID:28302478 Serpinb6a Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of SERPINB6A mRNA CTD PMID:21551480 Serpinb6a Rat dorsomorphin multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Serpinb6a Rat doxorubicin decreases expression ISO SERPINB6 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SERPINB6 mRNA CTD PMID:29803840 Serpinb6a Rat entinostat increases expression ISO SERPINB6 (Homo sapiens) 6480464 entinostat results in increased expression of SERPINB6 mRNA CTD PMID:26272509 Serpinb6a Rat entinostat multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SERPINB6 mRNA CTD PMID:27188386 Serpinb6a Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of SERPINB6A mRNA CTD PMID:23962444 Serpinb6a Rat folic acid multiple interactions ISO Serpinb6a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SERPINB6A mRNA CTD PMID:20938992 Serpinb6a Rat fumonisin B1 increases expression ISO Serpinb6a (Mus musculus) 6480464 fumonisin B1 results in increased expression of SERPINB6 mRNA CTD PMID:16221962 Serpinb6a Rat furan increases expression EXP 6480464 furan results in increased expression of SERPINB6 mRNA CTD PMID:27387713 Serpinb6a Rat furfural multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Serpinb6a Rat gentamycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of SERPINB6 protein CTD PMID:30545405 Serpinb6a Rat ivermectin decreases expression ISO SERPINB6 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SERPINB6 protein CTD PMID:32959892 Serpinb6a Rat L-methionine multiple interactions ISO Serpinb6a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SERPINB6A mRNA CTD PMID:20938992 Serpinb6a Rat lead(0) affects expression ISO SERPINB6 (Homo sapiens) 6480464 Lead affects the expression of SERPINB6 mRNA CTD PMID:28903495 Serpinb6a Rat lipopolysaccharide increases expression ISO Serpinb6a (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of SERPINB6A mRNA CTD PMID:27339419 Serpinb6a Rat manganese atom multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SERPINB6 mRNA CTD PMID:39836092 Serpinb6a Rat manganese(0) multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SERPINB6 mRNA CTD PMID:39836092 Serpinb6a Rat manganese(II) chloride multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SERPINB6 mRNA CTD PMID:39836092 Serpinb6a Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of SERPINB6 mRNA CTD PMID:30047161 Serpinb6a Rat methylseleninic acid decreases expression ISO SERPINB6 (Homo sapiens) 6480464 methylselenic acid results in decreased expression of SERPINB6 mRNA CTD PMID:18548127 Serpinb6a Rat metronidazole multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of SERPINB6 protein CTD PMID:30545405 Serpinb6a Rat microcystin-LR increases expression ISO Serpinb6a (Mus musculus) 6480464 cyanoginosin LR results in increased expression of SERPINB6A mRNA CTD PMID:17654400 Serpinb6a Rat N-methyl-4-phenylpyridinium increases expression ISO SERPINB6 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of SERPINB6 mRNA CTD PMID:24810058 Serpinb6a Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of SERPINB6A mRNA CTD PMID:19638242 Serpinb6a Rat N-nitrosodiethylamine multiple interactions ISO Serpinb6a (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of SERPINB6A mRNA CTD PMID:24535843 Serpinb6a Rat neomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of SERPINB6 protein CTD PMID:30545405 Serpinb6a Rat nitrates multiple interactions ISO Serpinb6a (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SERPINB6A mRNA CTD PMID:35964746 Serpinb6a Rat Nutlin-3 multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of SERPINB6 protein CTD PMID:38460933 Serpinb6a Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SERPINB6 mRNA CTD PMID:25729387 Serpinb6a Rat ozone increases expression EXP 6480464 Ozone results in increased expression of SERPINB6A protein CTD PMID:33146391 Serpinb6a Rat paracetamol affects expression ISO Serpinb6a (Mus musculus) 6480464 Acetaminophen affects the expression of SERPINB6A mRNA CTD PMID:17562736 Serpinb6a Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of SERPINB6 mRNA CTD PMID:32680482 Serpinb6a Rat perfluorohexanesulfonic acid increases expression ISO Serpinb6a (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of SERPINB6A mRNA CTD PMID:37995155 Serpinb6a Rat perfluorooctane-1-sulfonic acid decreases expression ISO Serpinb6a (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of SERPINB6A protein CTD PMID:26178269 Serpinb6a Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Serpinb6a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SERPINB6A mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of SERPINB6A mRNA CTD PMID:36331819 Serpinb6a Rat perfluorooctanoic acid increases expression ISO SERPINB6 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of SERPINB6 protein CTD PMID:26879310 Serpinb6a Rat phenobarbital multiple interactions ISO Serpinb6a (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of SERPINB6A mRNA CTD PMID:24535843 Serpinb6a Rat phenylmercury acetate multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SERPINB6 mRNA CTD PMID:27188386 Serpinb6a Rat phenylmercury acetate increases expression ISO SERPINB6 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of SERPINB6 mRNA CTD PMID:26272509 Serpinb6a Rat pirinixic acid increases expression ISO Serpinb6a (Mus musculus) 6480464 pirinixic acid results in increased expression of SERPINB6A mRNA CTD PMID:23811191 Serpinb6a Rat potassium dichromate decreases expression ISO Serpinb6a (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of SERPINB6A mRNA CTD PMID:23608068 Serpinb6a Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of SERPINB6 mRNA CTD PMID:30047161 Serpinb6a Rat raloxifene multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with ESR2 protein] results in decreased expression of SERPINB6 mRNA CTD PMID:19059307 Serpinb6a Rat rimonabant affects expression ISO Serpinb6a (Mus musculus) 6480464 Rimonabant affects the expression of SERPINB6A mRNA CTD PMID:19030233 Serpinb6a Rat rimonabant multiple interactions ISO Serpinb6a (Mus musculus) 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of SERPINB6A mRNA] CTD PMID:19030233 Serpinb6a Rat SB 431542 multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Serpinb6a Rat sodium arsenite increases expression ISO Serpinb6a (Mus musculus) 6480464 sodium arsenite results in increased expression of SERPINB6A mRNA CTD PMID:16014739 Serpinb6a Rat sodium arsenite decreases expression ISO Serpinb6a (Mus musculus) 6480464 sodium arsenite results in decreased expression of SERPINB6A mRNA CTD PMID:37682722 Serpinb6a Rat sodium arsenite multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SERPINB6 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SERPINB6 mRNA CTD PMID:39836092 Serpinb6a Rat sodium chloride multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of SERPINB6 protein more ... CTD PMID:38598786 Serpinb6a Rat sodium fluoride increases expression ISO Serpinb6a (Mus musculus) 6480464 Sodium Fluoride results in increased expression of SERPINB6A mRNA and Sodium Fluoride results in increased expression of SERPINB6A protein CTD PMID:27862939 and PMID:28918527 Serpinb6a Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of SERPINB6 mRNA CTD PMID:30047161 Serpinb6a Rat tamoxifen multiple interactions ISO SERPINB6 (Homo sapiens) 6480464 [Tamoxifen co-treated with ESR2 protein] results in decreased expression of SERPINB6 mRNA CTD PMID:19059307 Serpinb6a Rat temozolomide increases expression ISO SERPINB6 (Homo sapiens) 6480464 Temozolomide results in increased expression of SERPINB6 mRNA CTD PMID:31758290 Serpinb6a Rat testosterone increases expression ISO Serpinb6a (Mus musculus) 6480464 Testosterone results in increased expression of SERPINB6A mRNA CTD PMID:20403060 Serpinb6a Rat tetrachloromethane increases expression ISO Serpinb6a (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of SERPINB6A mRNA CTD PMID:27339419 and PMID:31919559 Serpinb6a Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SERPINB6A mRNA CTD PMID:23411599 Serpinb6a Rat thiram decreases expression ISO SERPINB6 (Homo sapiens) 6480464 Thiram results in decreased expression of SERPINB6 mRNA CTD PMID:38568856 Serpinb6a Rat titanium dioxide increases methylation ISO Serpinb6a (Mus musculus) 6480464 titanium dioxide results in increased methylation of SERPINB6A gene CTD PMID:35295148 Serpinb6a Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of SERPINB6 mRNA CTD PMID:25729387 Serpinb6a Rat triphenyl phosphate affects expression ISO SERPINB6 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SERPINB6 mRNA CTD PMID:37042841 Serpinb6a Rat triptonide increases expression ISO Serpinb6a (Mus musculus) 6480464 triptonide results in increased expression of SERPINB6A mRNA CTD PMID:33045310 Serpinb6a Rat urethane decreases expression ISO SERPINB6 (Homo sapiens) 6480464 Urethane results in decreased expression of SERPINB6 mRNA CTD PMID:28818685 Serpinb6a Rat vancomycin decreases expression ISO Serpinb6a (Mus musculus) 6480464 Vancomycin results in decreased expression of SERPINB6A mRNA CTD PMID:18930951 Serpinb6a Rat vancomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of SERPINB6 protein CTD PMID:30545405 Serpinb6a Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of SERPINB6 mRNA CTD PMID:19015723
(1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) actinomycin D (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ampicillin (EXP) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) cadmium dichloride (ISO) calcitriol (ISO) calyculin a (ISO) choline (ISO) cisplatin (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) cytarabine (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) fipronil (EXP) folic acid (ISO) fumonisin B1 (ISO) furan (EXP) furfural (ISO) gentamycin (EXP) ivermectin (ISO) L-methionine (ISO) lead(0) (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methimazole (EXP) methylseleninic acid (ISO) metronidazole (EXP) microcystin-LR (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP,ISO) neomycin (EXP) nitrates (ISO) Nutlin-3 (ISO) oxaliplatin (EXP) ozone (EXP) paracetamol (ISO) paraquat (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) raloxifene (ISO) rimonabant (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) tamoxifen (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) triphenyl phosphate (ISO) triptonide (ISO) urethane (ISO) vancomycin (EXP,ISO) vinclozolin (EXP)
Serpinb6a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 31,076,811 - 31,195,035 (+) NCBI GRCr8 mRatBN7.2 17 30,871,468 - 30,989,703 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 30,871,468 - 31,014,427 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 30,685,617 - 30,804,168 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 32,289,360 - 32,407,916 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 30,681,350 - 30,799,899 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 32,154,747 - 32,209,598 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 32,190,801 - 32,209,590 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 34,084,076 - 34,102,920 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 37,316,389 - 37,335,124 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 37,319,229 - 37,337,965 (+) NCBI Celera 17 30,535,108 - 30,553,843 (+) NCBI Celera Cytogenetic Map 17 p12 NCBI
SERPINB6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 2,948,159 - 2,971,793 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 2,948,159 - 2,972,165 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 2,948,393 - 2,972,027 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 2,893,392 - 2,917,089 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 2,893,391 - 2,917,089 NCBI Celera 6 4,177,451 - 4,201,136 (-) NCBI Celera Cytogenetic Map 6 p25.2 NCBI HuRef 6 2,821,595 - 2,845,591 (-) NCBI HuRef CHM1_1 6 2,950,764 - 2,974,758 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 2,817,071 - 2,840,707 (-) NCBI T2T-CHM13v2.0
Serpinb6a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 34,101,901 - 34,186,777 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 34,101,901 - 34,186,777 (-) Ensembl GRCm39 Ensembl GRCm38 13 33,917,918 - 34,002,794 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 33,917,918 - 34,002,794 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 34,009,787 - 34,094,618 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 33,925,392 - 33,943,461 (-) NCBI MGSCv36 mm8 Celera 13 35,047,258 - 35,132,241 (-) NCBI Celera Cytogenetic Map 13 A3.3 NCBI cM Map 13 14.0 NCBI
HMSD Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 17 81,458,498 - 81,466,877 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 18 67,145,099 - 67,159,622 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 18 57,306,835 - 57,315,231 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 18 60,613,877 - 60,624,559 (+) NCBI panpan1.1 PanPan1.1 panPan2
LOC106504299 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 1,752,689 - 1,776,087 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 1,755,252 - 1,776,144 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 1,832,151 - 1,836,133 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SERPINB6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 69,204,019 - 69,219,020 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 69,207,684 - 69,219,016 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 2,881,786 - 2,896,484 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Assembly: mRatBN7.2
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
17
30915036
30915037
T
A
snv
European Variation Archive Release 3 , FXLE21/StmMcwi (2023), European Variation Archive Release 6, FXLE12/StmMcwi (2023), ACI/EurMcwi (2019), ACI/N (2020), BXH2/CubMcwi (2020), BXH3/CubMcwi (2020), DA/OlaHsd (2019), GK/FarMcwi (2019), HXB20/IpcvMcwi (2020), HXB2/IpcvMcwi (2019), HXB31/IpcvMcwi (2019), HXB4/IpcvMcwi (2020), LEW/Crl (2019), LEXF1A/Stm (2019), LEXF4/Stm (2020), LE/Stm (2019), MR/N (2020), MWF/Hsd (2019), PVG/Seac (2019), SHRSP/A3NCrl (2019), SHR/OlalpcvMcwi (2019), WAG/RijCrl (2020), WKY/NCrl (2019), WKY/N (2020), WN/N (2020), ACI/EurMcwi (2019NG), BDIX/NemOdaMcwi (2022), BUF/MnaMcwi (2022), DA/OlaHsd (2019NG), FXLE12/StmMcwi (2021), FXLE12/Stm (2019NG), FXLE13/Stm (2019NG), FXLE14/Stm (2019NG), FXLE17/Stm (2019NG), FXLE20/Stm (2019NG), FXLE26/Stm (2022), GK/FarMcwi (2019NG), HXB23/IpcvMcwi (2021), LEW/Crl (2019NG), LEXF7A/Stm (2019NG), LEXF7B/StmMcwi (2022), LEXF7C/StmMcwi (2022), LEXF8D/Stm (2022), LEXF9/StmMcwi (2022), MR/NRrrc (2022), MWF/SimwMcwi (2019NG), MWF/SimwMcwi (2019), RCS/LavRrrcMcwi (2021), SHRSP/A3NCrl (2019NG), SHR/NCrl (2021), SHR/NHsd (2021), SHR/NHsd (2021), SHR/OlalpcvMcwi (2019NG), WKY/NCrl (2019NG), FXLE26/StmMcwi (2023), FXLE13/StmMcwi (2023), FXLE22/StmMcwi (2023), FXLE20/StmMcwi (2023), LEXF8D/StmMcwi (2023), FXLE17/StmMcwi (2023), FXLE14/StmMcwi (2023), European Variation Archive Release 4 View more Information
Predicted Target Of
Count of predictions: 88 Count of miRNA genes: 80 Interacting mature miRNAs: 85 Transcripts: ENSRNOT00000024161 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1354581 Bp247 Blood pressure QTL 247 4.5 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 17 1 69599340 Rat 2300002 Iddm36 Insulin dependent diabetes mellitus QTL 36 1.98 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 17 9991286 40540197 Rat 1354640 Scl32 Serum cholesterol level QTL 32 5.4 blood HDL cholesterol amount (VT:0000184) blood high density lipoprotein cholesterol level (CMO:0000052) 17 15781592 60781592 Rat 152023626 Bp403 Blood pressure QTL 403 3.86 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 1300123 Bp194 Blood pressure QTL 194 2.82 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 2115149 34551001 Rat 9590107 Sffal7 Serum free fatty acids level QTL 7 4.81 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 17 28409147 73409147 Rat 2302377 Scl61 Serum cholesterol level QTL 61 4.36 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 17 27389946 53481766 Rat 70157 Niddm32 Non-insulin dependent diabetes mellitus QTL 32 4.34 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 17 22454924 50909196 Rat 1354651 Lmblg2 Limb length QTL 2 6 tibia length (VT:0004357) tibia length (CMO:0000450) 17 4299130 69599340 Rat 1354628 Stl13 Serum triglyceride level QTL 13 3.8 blood triglyceride amount (VT:0002644) blood triglyceride level (CMO:0000118) 17 21293039 60781592 Rat 1581512 Cm55 Cardiac mass QTL 55 2.8 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 27027949 56836890 Rat 10401807 Kidm52 Kidney mass QTL 52 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 1 31701463 Rat 10054088 Scort28 Serum corticosterone level QTL 28 2.04 0.0102 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 4528038 49528038 Rat 1354630 Cm34 Cardiac mass QTL 34 8.7 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 4299130 69599340 Rat 61394 Bp8 Blood pressure QTL 8 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 23080567 59555013 Rat 1559055 Bp278 Blood pressure QTL 278 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 68653184 Rat 152025238 Slep14 Serum leptin concentration QTL 14 4.62 blood leptin amount (VT:0005667) 17 24184890 79524188 Rat 1354638 Insul1 Insulin level QTL 1 4.8 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 17 4299130 69599340 Rat 1354613 Kidm14 Kidney mass QTL 14 6.2 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 17 4299130 35837242 Rat 1331765 Hrtrt15 Heart rate QTL 15 4.094 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 17 15330613 55836425 Rat 8552928 Pigfal9 Plasma insulin-like growth factor 1 level QTL 9 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 17 28409147 73409147 Rat 2303627 Vencon8 Ventilatory control QTL 8 0.001 respiration trait (VT:0001943) tidal volume (CMO:0000222) 17 4528038 49528038 Rat 12903980 Cm120 Cardiac mass QTL 120 0.002 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 17 23653184 68653184 Rat 70184 BpQTLcluster14 Blood pressure QTL cluster 14 3.38 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 1 31990913 Rat 12903981 Am17 Aortic mass QTL 17 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 17 23653184 68653184 Rat 4889891 Eae32 Experimental allergic encephalomyelitis QTL 32 4.8 0.0002 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 17 27027949 36146731 Rat 4889955 Bss93 Bone structure and strength QTL 93 4.4 tibia size trait (VT:0100001) tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727) 17 27027949 60463643 Rat 2303561 Bw91 Body weight QTL 91 2 body mass (VT:0001259) body weight (CMO:0000012) 17 8868462 53868462 Rat 12903982 Kidm70 Kidney mass QTL 70 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 17 23653184 70974005 Rat 631207 Niddm41 Non-insulin dependent diabetes mellitus QTL 41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 17 1 37830672 Rat 12903978 Cm118 Cardiac mass QTL 118 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 17 23653184 68653184 Rat 12903979 Cm119 Cardiac mass QTL 119 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 23653184 68653184 Rat 1354619 Bp242 Blood pressure QTL 242 6.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 24599340 69599340 Rat 1354596 Bw32 Body weight QTL 32 4.5 body mass (VT:0001259) body weight (CMO:0000012) 17 4299130 60781592 Rat 1354662 Rf49 Renal function QTL 49 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 17 1 69599340 Rat 152023740 Bp406 Blood pressure QTL 406 6.06 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 7488966 Bp370 Blood pressure QTL 370 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 57246843 Rat 1354658 Spl8 Serum phospholipid level QTL 8 3.8 blood VLDL phospholipid amount (VT:0010507) blood very low density lipoprotein phospholipid level (CMO:0001571) 17 1 60781592 Rat 152023737 Bp405 Blood pressure QTL 405 5.06 arterial blood pressure trait (VT:2000000) 23930421 79524188 Rat 1354659 Scl68 Serum cholesterol level QTL 68 3.9 blood VLDL cholesterol amount (VT:0005144) blood very low density lipoprotein cholesterol level (CMO:0000648) 17 15781592 60781592 Rat 152023736 Bp404 Blood pressure QTL 404 3.78 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat
RH129867
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 30,989,458 - 30,989,648 (+) MAPPER mRatBN7.2 Rnor_6.0 17 32,209,354 - 32,209,543 NCBI Rnor6.0 Rnor_5.0 17 34,102,676 - 34,102,865 UniSTS Rnor5.0 RGSC_v3.4 17 37,334,888 - 37,335,077 UniSTS RGSC3.4 Celera 17 30,553,607 - 30,553,796 UniSTS RH 3.4 Map 17 326.02 UniSTS Cytogenetic Map 17 p12 UniSTS
Serpinb6
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 31,874,506 - 31,875,418 (+) MAPPER mRatBN7.2 Rnor_6.0 8 34,714,297 - 34,715,208 NCBI Rnor6.0 Rnor_5.0 8 34,745,725 - 34,746,636 UniSTS Rnor5.0 RGSC_v3.4 8 33,282,598 - 33,283,509 UniSTS RGSC3.4 Celera 8 33,306,736 - 33,307,646 UniSTS Cytogenetic Map 8 q21 UniSTS Cytogenetic Map 17 p12 UniSTS
Serpinb6c
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 30,978,000 - 30,978,060 (+) MAPPER mRatBN7.2 Rnor_6.0 17 32,197,843 - 32,197,902 NCBI Rnor6.0 Rnor_5.0 17 34,091,165 - 34,091,224 UniSTS Rnor5.0 RGSC_v3.4 17 37,323,431 - 37,323,490 UniSTS RGSC3.4 RGSC_v3.4 17 37,826,272 - 37,826,332 UniSTS RGSC3.4 Celera 17 31,029,328 - 31,029,388 UniSTS Celera 17 30,542,150 - 30,542,209 UniSTS Cytogenetic Map 17 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024161 ⟹ ENSRNOP00000024161
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 30,970,957 - 30,989,694 (+) Ensembl Rnor_6.0 Ensembl 17 32,190,801 - 32,209,590 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102782 ⟹ ENSRNOP00000089104
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 30,970,845 - 31,014,427 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000118879 ⟹ ENSRNOP00000090303
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 30,871,468 - 30,989,694 (+) Ensembl
RefSeq Acc Id:
NM_001395026 ⟹ NP_001381955
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 31,076,811 - 31,195,035 (+) NCBI mRatBN7.2 17 30,871,468 - 30,989,697 (+) NCBI
RefSeq Acc Id:
NM_001395027 ⟹ NP_001381956
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 31,176,255 - 31,195,035 (+) NCBI mRatBN7.2 17 30,970,915 - 30,989,697 (+) NCBI
RefSeq Acc Id:
NM_199085 ⟹ NP_954516
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 31,176,255 - 31,195,035 (+) NCBI mRatBN7.2 17 30,970,915 - 30,989,697 (+) NCBI Rnor_6.0 17 32,190,801 - 32,209,590 (+) NCBI Rnor_5.0 17 34,084,076 - 34,102,920 (+) NCBI RGSC_v3.4 17 37,316,389 - 37,335,124 (+) RGD Celera 17 30,535,108 - 30,553,843 (+) RGD
Sequence:
TCCCATCTCTTCTCTGCCTGCCACTGGTCCGGAAATCCAGAGTCTAGGGTACGTTCTGCTGTAGGCTAACTGCGGCCGGGACTGTGGACACGGGCAGGTTCACCATCATGGATCATCTACAGGAAGGA
hide sequence
RefSeq Acc Id:
XM_006253871 ⟹ XP_006253933
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 31,176,550 - 31,195,035 (+) NCBI mRatBN7.2 17 30,971,210 - 30,989,703 (+) NCBI Rnor_6.0 17 32,190,911 - 32,209,598 (+) NCBI Rnor_5.0 17 34,084,076 - 34,102,920 (+) NCBI
Sequence:
AGAGAGCTCTGTGGTCCCGGCTCGGGTTCCCTCTGCTGCACAGGGCCTCAGCGGACCGTGACGCAGCCGACTGAGTCGCCTTGTGGTCCCGGCCATCTGGTGGCATCTCCGCCCACCCAGATCTGCCA
hide sequence
RefSeq Acc Id:
XM_039095492 ⟹ XP_038951420
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 31,076,961 - 31,195,035 (+) NCBI mRatBN7.2 17 30,871,622 - 30,989,697 (+) NCBI
RefSeq Acc Id:
NP_954516 ⟸ NM_199085
- UniProtKB:
Q6P9U0 (UniProtKB/TrEMBL), A6J7I2 (UniProtKB/TrEMBL), F7EUC3 (UniProtKB/TrEMBL), A0A8I6ABJ3 (UniProtKB/TrEMBL)
- Sequence:
MDHLQEGNGIFALKLLKTLSEDSSNNIFLSPISISAALTMVFMGAKGMTASQMVQTLSLDKCSGNGGGDVHQGFQSLLAEVNKTGTQYLLKTANRLFGEKTCDILASFKDACRKFYEAEMEELDFKGD
hide sequence
RefSeq Acc Id:
XP_006253933 ⟸ XM_006253871
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A6H8 (UniProtKB/TrEMBL), F7EUC3 (UniProtKB/TrEMBL)
- Sequence:
MGAAWSRPGCCAGSGGYRFTIMDHLQEGNGIFALKLLKTLSEDSSNNIFLSPISISAALTMVFMGAKGMTASQMVQTLSLDKCSGNGGGDVHQGFQSLLAEVNKTGTQYLLKTANRLFGEKTCDILAS
hide sequence
Ensembl Acc Id:
ENSRNOP00000024161 ⟸ ENSRNOT00000024161
RefSeq Acc Id:
XP_038951420 ⟸ XM_039095492
- Peptide Label:
isoform X1
- UniProtKB:
Q6P9U0 (UniProtKB/TrEMBL), A6J7I2 (UniProtKB/TrEMBL), F7EUC3 (UniProtKB/TrEMBL), A0A8I6ABJ3 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000089104 ⟸ ENSRNOT00000102782
Ensembl Acc Id:
ENSRNOP00000090303 ⟸ ENSRNOT00000118879
RefSeq Acc Id:
NP_001381955 ⟸ NM_001395026
- UniProtKB:
Q6P9U0 (UniProtKB/TrEMBL), A6J7I2 (UniProtKB/TrEMBL), F7EUC3 (UniProtKB/TrEMBL), A0A8I6ABJ3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001381956 ⟸ NM_001395027
- UniProtKB:
Q6P9U0 (UniProtKB/TrEMBL), A6J7I2 (UniProtKB/TrEMBL), F7EUC3 (UniProtKB/TrEMBL), A0A8I6ABJ3 (UniProtKB/TrEMBL)
RGD ID: 13700417 Promoter ID: EPDNEW_R10941 Type: multiple initiation site Name: Serpinb6a_1 Description: serpin family B member 6A SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 17 32,190,802 - 32,190,862 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-06-19
Serpinb6a
serpin family B member 6A
Serpinb6
serpin family B member 6
Name and Symbol changed
629549 APPROVED
2016-04-13
Serpinb6
serpin family B member 6
Serpinb6
serpin peptidase inhibitor, clade B (ovalbumin), member 6
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-02-02
Serpinb6
serpin peptidase inhibitor, clade B (ovalbumin), member 6
Serpinb6a
serine (or cysteine) peptidase inhibitor, clade B, member 6a
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Serpinb6a
serine (or cysteine) peptidase inhibitor, clade B, member 6a
Serpinb6
serine (or cysteine) peptidase inhibitor, clade B, member 6
Symbol and Name updated
1299863 APPROVED
2005-07-08
Serpinb6
serine (or cysteine) peptidase inhibitor, clade B, member 6
serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 6
Name updated
1299863 APPROVED
