Symbol:
Bicd2
Name:
BICD cargo adaptor 2
RGD ID:
735093
Description:
Predicted to enable several functions, including dynactin binding activity; dynein complex binding activity; and dynein light intermediate chain binding activity. Predicted to be involved in several processes, including microtubule anchoring at microtubule organizing center; minus-end-directed organelle transport along microtubule; and retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum. Predicted to be located in several cellular components, including annulate lamellae; centrosome; and nuclear envelope. Predicted to be part of nuclear pore. Predicted to be active in Golgi apparatus and cytosol. Human ortholog(s) of this gene implicated in spinal muscular atrophy with lower extremity predominant 2A and spinal muscular atrophy with lower extremity predominant 2B. Orthologous to human BICD2 (BICD cargo adaptor 2); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
bicaudal D homolog 2; bicaudal D homolog 2 (Drosophila); bicaudal D protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BICD2 (BICD cargo adaptor 2) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Bicd2 (BICD cargo adaptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Bicd2 (BICD cargo adaptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BICD2 (BICD cargo adaptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BICD2 (BICD cargo adaptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bicd2 (BICD cargo adaptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BICD2 (BICD cargo adaptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BICD2 (BICD cargo adaptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Bicd2 (BICD cargo adaptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
BICD2 (BICD cargo adaptor 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Bicd2 (BICD cargo adaptor 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
zgc:171572
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Danio rerio (zebrafish):
bicd2 (bicaudal D homolog 2 (Drosophila))
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
BicD
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
bicd-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fgd3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
bicd2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 15,449,011 - 15,511,423 (-) NCBI GRCr8 mRatBN7.2 17 15,259,773 - 15,304,889 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 15,259,773 - 15,304,889 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 15,146,828 - 15,191,665 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 16,751,888 - 16,796,726 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 15,073,624 - 15,118,460 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 15,673,649 - 15,718,035 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 15,673,650 - 15,718,035 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 17,731,018 - 17,775,611 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 21,214,977 - 21,260,729 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 21,214,995 - 21,260,709 (-) NCBI Celera 17 14,990,557 - 15,035,504 (-) NCBI Celera Cytogenetic Map 17 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bicd2 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO BICD2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of BICD2 mRNA CTD PMID:22079256 Bicd2 Rat 1,2-dichloroethane decreases expression ISO Bicd2 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of BICD2 mRNA CTD PMID:28960355 Bicd2 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of BICD2 mRNA CTD PMID:25380136 Bicd2 Rat 17alpha-ethynylestradiol affects expression ISO Bicd2 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of BICD2 mRNA CTD PMID:17555576 Bicd2 Rat 17alpha-ethynylestradiol multiple interactions ISO Bicd2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BICD2 mRNA CTD PMID:17942748 Bicd2 Rat 17alpha-ethynylestradiol increases expression ISO Bicd2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of BICD2 mRNA CTD PMID:17942748 Bicd2 Rat 17beta-estradiol affects expression ISO BICD2 (Homo sapiens) 6480464 Estradiol affects the expression of BICD2 mRNA CTD PMID:22574217 Bicd2 Rat 17beta-estradiol decreases expression ISO Bicd2 (Mus musculus) 6480464 Estradiol results in decreased expression of BICD2 mRNA CTD PMID:39298647 Bicd2 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of BICD2 mRNA CTD PMID:26496021 Bicd2 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO BICD2 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of BICD2 mRNA CTD PMID:29581250 Bicd2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO BICD2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of BICD2 mRNA CTD PMID:19684285 Bicd2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Bicd2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BICD2 mRNA CTD PMID:21570461 Bicd2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Bicd2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BICD2 mRNA CTD PMID:17942748 Bicd2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Bicd2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of BICD2 mRNA CTD PMID:19684285 Bicd2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of BICD2 mRNA CTD PMID:21346803 Bicd2 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Bicd2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of BICD2 mRNA CTD PMID:20188158 Bicd2 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of BICD2 mRNA CTD PMID:25380136 Bicd2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Bicd2 (Mus musculus) 6480464 bisphenol S results in decreased expression of BICD2 mRNA CTD PMID:39298647 Bicd2 Rat 4-hydroxyphenyl retinamide decreases expression ISO Bicd2 (Mus musculus) 6480464 Fenretinide results in decreased expression of BICD2 mRNA CTD PMID:28973697 Bicd2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of BICD2 mRNA CTD PMID:24780913 and PMID:30047161 Bicd2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of BICD2 mRNA CTD PMID:31881176 Bicd2 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of BICD2 mRNA CTD PMID:28959563 Bicd2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of BICD2 mRNA CTD PMID:30047161 Bicd2 Rat arsenite(3-) increases expression ISO Bicd2 (Mus musculus) 6480464 arsenite results in increased expression of BICD2 protein CTD PMID:37955338 Bicd2 Rat benzo[a]pyrene decreases expression ISO Bicd2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of BICD2 mRNA CTD PMID:19770486 Bicd2 Rat benzo[a]pyrene affects methylation ISO BICD2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of BICD2 intron CTD PMID:30157460 Bicd2 Rat benzo[a]pyrene increases expression ISO Bicd2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of BICD2 mRNA CTD PMID:22228805 Bicd2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO BICD2 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Bicd2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Bicd2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of BICD2 mRNA CTD PMID:34319233 Bicd2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of BICD2 mRNA CTD PMID:26496021 Bicd2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BICD2 mRNA CTD PMID:25181051 more ... Bicd2 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of BICD2 mRNA CTD PMID:33453195 Bicd2 Rat cadmium dichloride increases expression ISO BICD2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of BICD2 mRNA CTD PMID:26472689 Bicd2 Rat cadmium dichloride decreases expression ISO BICD2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of BICD2 mRNA and Cadmium Chloride results in decreased expression of BICD2 protein CTD PMID:24527689 and PMID:38568856 Bicd2 Rat caffeine affects phosphorylation ISO BICD2 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of BICD2 protein CTD PMID:35688186 Bicd2 Rat calcium dichloride increases expression ISO BICD2 (Homo sapiens) 6480464 Calcium Chloride results in increased expression of BICD2 protein CTD PMID:25824407 Bicd2 Rat clothianidin decreases expression ISO BICD2 (Homo sapiens) 6480464 clothianidin results in decreased expression of BICD2 mRNA CTD PMID:31626844 Bicd2 Rat clotrimazole increases expression EXP 6480464 Clotrimazole results in increased expression of BICD2 mRNA CTD PMID:30047161 Bicd2 Rat copper(II) chloride increases expression ISO BICD2 (Homo sapiens) 6480464 cupric chloride results in increased expression of BICD2 mRNA CTD PMID:38568856 Bicd2 Rat cyclosporin A increases expression ISO BICD2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of BICD2 mRNA CTD PMID:25562108 Bicd2 Rat dibutyl phthalate increases expression ISO Bicd2 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of BICD2 mRNA CTD PMID:21266533 Bicd2 Rat dicrotophos increases expression ISO BICD2 (Homo sapiens) 6480464 dicrotophos results in increased expression of BICD2 mRNA CTD PMID:28302478 Bicd2 Rat ethanol affects splicing ISO Bicd2 (Mus musculus) 6480464 Ethanol affects the splicing of BICD2 mRNA CTD PMID:30319688 Bicd2 Rat FR900359 increases phosphorylation ISO BICD2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of BICD2 protein CTD PMID:37730182 Bicd2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of BICD2 mRNA CTD PMID:33387578 Bicd2 Rat ivermectin decreases expression ISO BICD2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of BICD2 protein CTD PMID:32959892 Bicd2 Rat leflunomide decreases expression ISO BICD2 (Homo sapiens) 6480464 leflunomide results in decreased expression of BICD2 mRNA CTD PMID:28988120 Bicd2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of BICD2 mRNA CTD PMID:30047161 Bicd2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of BICD2 gene CTD PMID:35440735 Bicd2 Rat nitrates multiple interactions ISO Bicd2 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of BICD2 mRNA CTD PMID:35964746 Bicd2 Rat paracetamol increases expression ISO BICD2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of BICD2 mRNA CTD PMID:22230336 Bicd2 Rat pirinixic acid increases expression ISO Bicd2 (Mus musculus) 6480464 pirinixic acid results in increased expression of BICD2 mRNA CTD PMID:18301758 Bicd2 Rat potassium chromate increases expression ISO BICD2 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of BICD2 mRNA CTD PMID:22079256 Bicd2 Rat potassium chromate multiple interactions ISO BICD2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of BICD2 mRNA CTD PMID:22079256 Bicd2 Rat resveratrol multiple interactions ISO BICD2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of BICD2 mRNA CTD PMID:23557933 Bicd2 Rat sodium arsenite decreases expression ISO BICD2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of BICD2 protein CTD PMID:30528433 Bicd2 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of BICD2 mRNA CTD PMID:30047161 Bicd2 Rat tamoxifen affects expression ISO Bicd2 (Mus musculus) 6480464 Tamoxifen affects the expression of BICD2 mRNA CTD PMID:17555576 Bicd2 Rat tetrachloromethane increases expression ISO Bicd2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of BICD2 mRNA CTD PMID:17484886 Bicd2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of BICD2 mRNA CTD PMID:23411599 and PMID:34492290 Bicd2 Rat titanium dioxide decreases expression ISO Bicd2 (Mus musculus) 6480464 titanium dioxide results in decreased expression of BICD2 mRNA CTD PMID:23557971 Bicd2 Rat titanium dioxide increases methylation ISO Bicd2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of BICD2 gene and titanium dioxide results in increased methylation of BICD2 promoter CTD PMID:35295148 Bicd2 Rat torcetrapib increases expression ISO BICD2 (Homo sapiens) 6480464 torcetrapib results in increased expression of BICD2 mRNA CTD PMID:23228038 Bicd2 Rat tungsten decreases expression ISO Bicd2 (Mus musculus) 6480464 Tungsten results in decreased expression of BICD2 mRNA CTD PMID:30912803 Bicd2 Rat valproic acid increases expression ISO BICD2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of BICD2 mRNA CTD PMID:23179753 Bicd2 Rat valproic acid affects expression ISO BICD2 (Homo sapiens) 6480464 Valproic Acid affects the expression of BICD2 mRNA CTD PMID:25979313 Bicd2 Rat valproic acid increases methylation ISO BICD2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of BICD2 gene CTD PMID:29154799 Bicd2 Rat vitamin E decreases expression ISO BICD2 (Homo sapiens) 6480464 Vitamin E results in decreased expression of BICD2 mRNA CTD PMID:19244175
(-)-epigallocatechin 3-gallate (ISO) 1,2-dichloroethane (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) amitrole (EXP) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) cadmium dichloride (EXP,ISO) caffeine (ISO) calcium dichloride (ISO) clothianidin (ISO) clotrimazole (EXP) copper(II) chloride (ISO) cyclosporin A (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) ethanol (ISO) FR900359 (ISO) gentamycin (EXP) ivermectin (ISO) leflunomide (ISO) methimazole (EXP) methoxychlor (EXP) nitrates (ISO) paracetamol (ISO) pirinixic acid (ISO) potassium chromate (ISO) resveratrol (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) tamoxifen (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) torcetrapib (ISO) tungsten (ISO) valproic acid (ISO) vitamin E (ISO)
Bicd2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 15,449,011 - 15,511,423 (-) NCBI GRCr8 mRatBN7.2 17 15,259,773 - 15,304,889 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 15,259,773 - 15,304,889 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 15,146,828 - 15,191,665 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 16,751,888 - 16,796,726 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 15,073,624 - 15,118,460 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 15,673,649 - 15,718,035 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 15,673,650 - 15,718,035 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 17,731,018 - 17,775,611 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 21,214,977 - 21,260,729 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 21,214,995 - 21,260,709 (-) NCBI Celera 17 14,990,557 - 15,035,504 (-) NCBI Celera Cytogenetic Map 17 p14 NCBI
BICD2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 92,711,363 - 92,764,833 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 92,711,363 - 92,764,833 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 95,473,645 - 95,527,115 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 94,513,466 - 94,566,904 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 92,553,199 - 92,606,638 NCBI Celera 9 65,915,700 - 65,969,136 (-) NCBI Celera Cytogenetic Map 9 q22.31 NCBI HuRef 9 65,151,961 - 65,205,073 (-) NCBI HuRef CHM1_1 9 95,620,081 - 95,673,514 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 104,877,924 - 104,931,411 (-) NCBI T2T-CHM13v2.0
Bicd2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 49,495,025 - 49,540,502 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 49,495,061 - 49,540,502 (+) Ensembl GRCm39 Ensembl GRCm38 13 49,341,549 - 49,387,026 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 49,341,585 - 49,387,026 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 49,436,918 - 49,482,394 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 49,353,486 - 49,398,962 (+) NCBI MGSCv36 mm8 Celera 13 50,431,086 - 50,476,523 (+) NCBI Celera Cytogenetic Map 13 A5 NCBI cM Map 13 25.22 NCBI
Bicd2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955515 5,061,005 - 5,103,179 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955515 5,060,176 - 5,105,298 (+) NCBI ChiLan1.0 ChiLan1.0
BICD2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 46,660,629 - 46,717,041 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 46,663,017 - 46,719,493 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 63,834,515 - 63,890,904 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 91,905,982 - 91,959,186 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 91,909,771 - 91,959,131 (-) Ensembl panpan1.1 panPan2
BICD2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 98,697,050 - 98,736,296 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 98,697,075 - 98,734,240 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 99,091,059 - 99,130,138 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 99,313,974 - 99,353,079 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 99,313,980 - 99,353,078 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 98,927,112 - 98,966,197 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 98,662,724 - 98,701,758 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 99,418,306 - 99,457,372 (+) NCBI UU_Cfam_GSD_1.0
Bicd2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404944 8,071,268 - 8,119,191 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936487 2,255,882 - 2,335,731 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936487 2,287,736 - 2,335,674 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BICD2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 42,393,277 - 42,456,782 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 42,393,270 - 42,456,821 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 43,627,163 - 43,647,661 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BICD2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 103,232,602 - 103,281,317 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 103,232,327 - 103,281,288 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 91,504,437 - 91,553,420 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bicd2
.
Predicted Target Of
Count of predictions: 380 Count of miRNA genes: 231 Interacting mature miRNAs: 295 Transcripts: ENSRNOT00000048653 Prediction methods: Miranda, Pita, Targetscan Result types: miRGate_prediction
1354581 Bp247 Blood pressure QTL 247 4.5 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 17 1 69599340 Rat 2300002 Iddm36 Insulin dependent diabetes mellitus QTL 36 1.98 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 17 9991286 40540197 Rat 631499 Stl1 Serum triglyceride level QTL 1 3.6 blood triglyceride amount (VT:0002644) blood triglyceride level (CMO:0000118) 17 3271398 27389946 Rat 2293664 Bmd28 Bone mineral density QTL 28 5.1 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 17 4354487 27028127 Rat 1300123 Bp194 Blood pressure QTL 194 2.82 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 2115149 34551001 Rat 1582224 Epfw4 Epididymal fat weight QTL 4 3.5 0.0058 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 17 9201365 23653323 Rat 1582225 Bw67 Body weight QTL 67 6.2 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 17 9201365 23653323 Rat 1582226 Bw64 Body weight QTL 64 4.2 0.0017 body mass (VT:0001259) body weight (CMO:0000012) 17 9201365 23653323 Rat 1354651 Lmblg2 Limb length QTL 2 6 tibia length (VT:0004357) tibia length (CMO:0000450) 17 4299130 69599340 Rat 10401807 Kidm52 Kidney mass QTL 52 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 1 31701463 Rat 10054088 Scort28 Serum corticosterone level QTL 28 2.04 0.0102 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 4528038 49528038 Rat 1354630 Cm34 Cardiac mass QTL 34 8.7 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 4299130 69599340 Rat 1582208 Kidm32 Kidney mass QTL 32 3.9 0.0018 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 9201365 23653323 Rat 1354638 Insul1 Insulin level QTL 1 4.8 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 17 4299130 69599340 Rat 1549900 Iddm20 Insulin dependent diabetes mellitus QTL 20 3.7 pancreas integrity trait (VT:0010560) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 17 13986773 21975515 Rat 1354613 Kidm14 Kidney mass QTL 14 6.2 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 17 4299130 35837242 Rat 2324619 Coatc4 Coat color QTL 4 0.001 coat/hair pigmentation trait (VT:0010463) pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811) 17 4299130 21293263 Rat 2303627 Vencon8 Ventilatory control QTL 8 0.001 respiration trait (VT:0001943) tidal volume (CMO:0000222) 17 4528038 49528038 Rat 70184 BpQTLcluster14 Blood pressure QTL cluster 14 3.38 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 1 31990913 Rat 1581553 Pur14 Proteinuria QTL 14 5.3 0.0001 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 17 7979968 16317111 Rat 2303561 Bw91 Body weight QTL 91 2 body mass (VT:0001259) body weight (CMO:0000012) 17 8868462 53868462 Rat 1582258 Bw76 Body weight QTL 76 4.6 0.0005 body mass (VT:0001259) body weight (CMO:0000012) 17 9201365 23653323 Rat 631207 Niddm41 Non-insulin dependent diabetes mellitus QTL 41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 17 1 37830672 Rat 1582199 Insul5 Insulin level QTL 5 3.4 0.0119 blood insulin amount (VT:0001560) calculated serum insulin level (CMO:0000359) 17 9201365 23653323 Rat 1354596 Bw32 Body weight QTL 32 4.5 body mass (VT:0001259) body weight (CMO:0000012) 17 4299130 60781592 Rat 1354662 Rf49 Renal function QTL 49 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 17 1 69599340 Rat 2293648 Bmd31 Bone mineral density QTL 31 4.5 0.0001 femur size trait (VT:1000369) femoral neck cortical cross-sectional area (CMO:0001702) 17 4354487 27028127 Rat 1354658 Spl8 Serum phospholipid level QTL 8 3.8 blood VLDL phospholipid amount (VT:0010507) blood very low density lipoprotein phospholipid level (CMO:0001571) 17 1 60781592 Rat 1641902 Colcr7 Colorectal carcinoma resistance QTL 7 3.35 0.0044 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 17 2115149 21881669 Rat 1582241 Bw70 Body weight QTL 70 4.6 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 17 9201365 23653323 Rat 1582245 Bw73 Body weight QTL 73 4.6 0.0004 body mass (VT:0001259) body weight (CMO:0000012) 17 9201365 23653323 Rat 9590316 Scort21 Serum corticosterone level QTL 21 4.75 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 1 22871563 Rat
D17Rat70
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 17 15,488,286 - 15,488,482 (+) Marker Load Pipeline mRatBN7.2 17 15,281,866 - 15,282,062 (+) MAPPER mRatBN7.2 Rnor_6.0 17 15,695,017 - 15,695,212 NCBI Rnor6.0 Rnor_5.0 17 17,752,672 - 17,752,867 UniSTS Rnor5.0 RGSC_v3.4 17 21,237,691 - 21,237,887 RGD RGSC3.4 RGSC_v3.4 17 21,237,692 - 21,237,887 UniSTS RGSC3.4 RGSC_v3.1 17 21,237,692 - 21,237,887 RGD Celera 17 15,012,473 - 15,012,680 UniSTS RH 3.4 Map 17 178.02 UniSTS RH 3.4 Map 17 178.02 RGD SHRSP x BN Map 17 11.64 UniSTS SHRSP x BN Map 17 11.64 RGD FHH x ACI Map 17 11.2699 RGD Cytogenetic Map 17 p14 UniSTS
RH91165
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 15,259,818 - 15,259,997 (+) MAPPER mRatBN7.2 Rnor_6.0 17 15,673,695 - 15,673,873 NCBI Rnor6.0 Rnor_5.0 17 17,731,064 - 17,731,242 UniSTS Rnor5.0 RGSC_v3.4 17 21,215,023 - 21,215,201 UniSTS RGSC3.4 Celera 17 14,990,603 - 14,990,781 UniSTS Cytogenetic Map 17 p14 UniSTS
RH131216
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 15,305,256 - 15,305,473 (+) MAPPER mRatBN7.2 Rnor_6.0 17 15,718,403 - 15,718,619 NCBI Rnor6.0 Rnor_5.0 17 17,775,979 - 17,776,195 UniSTS Rnor5.0 RGSC_v3.4 17 21,261,097 - 21,261,313 UniSTS RGSC3.4 Celera 17 15,035,872 - 15,036,088 UniSTS RH 3.4 Map 17 160.8 UniSTS Cytogenetic Map 17 p14 UniSTS
AA891724
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 15,259,949 - 15,260,179 (+) MAPPER mRatBN7.2 Rnor_6.0 17 15,673,826 - 15,674,055 NCBI Rnor6.0 Rnor_5.0 17 17,731,195 - 17,731,424 UniSTS Rnor5.0 RGSC_v3.4 17 21,215,154 - 21,215,383 UniSTS RGSC3.4 Celera 17 14,990,734 - 14,990,963 UniSTS RH 3.4 Map 17 176.2 UniSTS Cytogenetic Map 17 p14 UniSTS
G06234
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 15,259,794 - 15,260,055 (+) MAPPER mRatBN7.2 Rnor_6.0 17 15,673,671 - 15,673,931 NCBI Rnor6.0 Rnor_5.0 17 17,731,040 - 17,731,300 UniSTS Rnor5.0 RGSC_v3.4 17 21,214,999 - 21,215,259 UniSTS RGSC3.4 Celera 17 14,990,579 - 14,990,839 UniSTS Cytogenetic Map 17 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000048653 ⟹ ENSRNOP00000047890
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 15,259,775 - 15,304,889 (-) Ensembl Rnor_6.0 Ensembl 17 15,673,650 - 15,718,015 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000090647 ⟹ ENSRNOP00000069365
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 15,259,773 - 15,304,889 (-) Ensembl Rnor_6.0 Ensembl 17 15,673,650 - 15,718,035 (-) Ensembl
RefSeq Acc Id:
NM_001033674 ⟹ NP_001028846
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 15,466,193 - 15,511,305 (-) NCBI mRatBN7.2 17 15,259,773 - 15,304,889 (-) NCBI Rnor_6.0 17 15,673,649 - 15,718,035 (-) NCBI Rnor_5.0 17 17,731,018 - 17,775,611 (-) NCBI RGSC_v3.4 17 21,214,977 - 21,260,729 (-) RGD Celera 17 14,990,557 - 15,035,504 (-) RGD
Sequence:
CGGCCGTCGGGGCTGGGCGGCGGCGGCGGCGGCTAAGAGGGCCCGGCTTGTGGGAGCCAAGGTGGGAGCGGGCCTCGGCGCGCGGCCACCATGTCCGCGCCGTCGGAGGAGGAGGAGTATGCGCGTCT
hide sequence
RefSeq Acc Id:
NM_198765 ⟹ NP_942060
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 15,466,193 - 15,511,305 (-) NCBI mRatBN7.2 17 15,259,773 - 15,304,889 (-) NCBI Rnor_6.0 17 15,673,649 - 15,718,035 (-) NCBI Rnor_5.0 17 17,731,018 - 17,775,611 (-) NCBI RGSC_v3.4 17 21,214,977 - 21,260,729 (-) RGD Celera 17 14,990,557 - 15,035,504 (-) RGD
Sequence:
CGGCCGTCGGGGCTGGGCGGCGGCGGCGGCGGCTAAGAGGGCCCGGCTTGTGGGAGCCAAGGTG
hide sequence
RefSeq Acc Id:
XR_010058861
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 15,449,011 - 15,511,423 (-) NCBI
RefSeq Acc Id:
NP_001028846 ⟸ NM_001033674
- Peptide Label:
isoform 1
- UniProtKB:
Q496Z1 (UniProtKB/TrEMBL), A0A8J8Y893 (UniProtKB/TrEMBL)
- Sequence:
MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAIRSEMEQLKEAFGQAHTNHKKVAADGESREESLIQESASKEQYYVRKVLELQTELKQL
hide sequence
RefSeq Acc Id:
NP_942060 ⟸ NM_198765
- Peptide Label:
isoform 2
- UniProtKB:
Q712J3 (UniProtKB/TrEMBL), F7FC29 (UniProtKB/TrEMBL), A0A8J8Y893 (UniProtKB/TrEMBL)
- Sequence:
MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAIRSEMEQLKEAFGQAHTNHKKVAADGESREESLIQESASKEQYYVRKVLELQTELKQL
hide sequence
Ensembl Acc Id:
ENSRNOP00000047890 ⟸ ENSRNOT00000048653
Ensembl Acc Id:
ENSRNOP00000069365 ⟸ ENSRNOT00000090647
RGD ID: 13700354 Promoter ID: EPDNEW_R10877 Type: initiation region Name: Bicd2_1 Description: BICD cargo adaptor 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 17 15,718,027 - 15,718,087 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-05
Bicd2
BICD cargo adaptor 2
Bicd2
bicaudal D homolog 2 (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-11-17
Bicd2
bicaudal D homolog 2 (Drosophila)
Symbol updated
1299863 APPROVED
2004-09-10
BicD2
bicaudal D homolog 2 (Drosophila)
bicaudal D protein
Name updated
1299863 APPROVED
