Symbol:
NAE1
Name:
NEDD8 activating enzyme E1 subunit 1
RGD ID:
733941
HGNC Page
HGNC:621
Description:
Enables protein heterodimerization activity and ubiquitin protein ligase binding activity. Contributes to NEDD8 activating enzyme activity. Involved in several processes, including mitotic DNA replication checkpoint signaling; neuron apoptotic process; and protein neddylation. Part of protein-containing complex. Biomarker of Alzheimer's disease.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
A-116A10.1; amyloid beta precursor protein binding protein 1, 59kDa; amyloid beta precursor protein-binding protein 1, 59 kDa; amyloid beta precursor protein-binding protein 1, 59kD; amyloid protein-binding protein 1; app-binding protein 1; APP-BP1; APPBP1; HPP1; NEDD8-activating enzyme E1 regulatory subunit; NEDD8-activating enzyme E1 subunit; NEDFIH; proto-oncogene protein 1; protooncogene protein 1; ula-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Nae1 (NEDD8 activating enzyme E1 subunit 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Nae1 (NEDD8 activating enzyme E1 subunit 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Nae1 (NEDD8 activating enzyme E1 subunit 1) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
NAE1 (NEDD8 activating enzyme E1 subunit 1) NCBI
Ortholog
Canis lupus familiaris (dog):
NAE1 (NEDD8 activating enzyme E1 subunit 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nae1 (NEDD8 activating enzyme E1 subunit 1) NCBI
Ortholog
Sus scrofa (pig):
NAE1 (NEDD8 activating enzyme E1 subunit 1) HGNC
Ensembl, NCBI, OrthoDB
Chlorocebus sabaeus (green monkey):
NAE1 (NEDD8 activating enzyme E1 subunit 1) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Nae1 (NEDD8 activating enzyme E1 subunit 1) NCBI
Ortholog
Other homologs 2
Sus scrofa (pig):
TERB1 (telomere repeat binding bouquet formation protein 1) HGNC
OMA, OrthoDB
Rattus norvegicus (Norway rat):
Fam180a (family with sequence similarity 180, member A) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Nae1 (NEDD8 activating enzyme E1 subunit 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nae1 (NEDD8 activating enzyme E1 subunit 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nae1 (nedd8 activating enzyme E1 subunit 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
APP-BP1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ULA1
Alliance
DIOPT (Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ula-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
nae1.S
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
nae1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
AC024341.1
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 66,802,878 - 66,830,976 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 66,802,875 - 66,873,256 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 66,836,781 - 66,864,879 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 65,394,282 - 65,422,380 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 65,394,282 - 65,422,370 NCBI Celera 16 51,345,091 - 51,373,189 (-) NCBI Celera Cytogenetic Map 16 q22.1 NCBI HuRef 16 52,710,930 - 52,739,089 (-) NCBI HuRef CHM1_1 16 68,243,864 - 68,271,962 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 72,597,172 - 72,625,270 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
NAE1 Human (-)-epigallocatechin 3-gallate multiple interactions EXP 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of NAE1 mRNA CTD PMID:22079256 NAE1 Human 1,2-dimethylhydrazine decreases expression ISO Nae1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of NAE1 mRNA CTD PMID:22206623 NAE1 Human 1,3,5-trinitro-1,3,5-triazinane decreases expression ISO Nae1 (Rattus norvegicus) 6480464 cyclonite results in decreased expression of NAE1 mRNA CTD PMID:25559034 NAE1 Human 1-chloro-2,4-dinitrobenzene affects binding EXP 6480464 Dinitrochlorobenzene binds to NAE1 protein CTD PMID:32991956 NAE1 Human 17alpha-ethynylestradiol increases expression ISO Nae1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of NAE1 mRNA CTD PMID:17942748 NAE1 Human 17alpha-ethynylestradiol decreases expression ISO Nae1 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in decreased expression of NAE1 mRNA CTD PMID:17557909 NAE1 Human 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:31675489 NAE1 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Nae1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of NAE1 mRNA CTD PMID:17942748 and PMID:19465110 NAE1 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nae1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NAE1 mRNA CTD PMID:21570461 NAE1 Human 2,4,6-tribromophenol increases expression EXP 6480464 2 more ... CTD PMID:31675489 NAE1 Human 2,4-dinitrotoluene affects expression ISO Nae1 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of NAE1 mRNA CTD PMID:21346803 NAE1 Human 2-hydroxypropanoic acid decreases expression EXP 6480464 Lactic Acid results in decreased expression of NAE1 mRNA CTD PMID:30851411 NAE1 Human 3,3',5,5'-tetrabromobisphenol A increases expression EXP 6480464 tetrabromobisphenol A results in increased expression of NAE1 protein CTD PMID:31675489 NAE1 Human 3H-1,2-dithiole-3-thione increases expression ISO Nae1 (Rattus norvegicus) 6480464 1 and 2-dithiol-3-thione results in increased expression of NAE1 mRNA CTD PMID:19162173 NAE1 Human 4,4'-sulfonyldiphenol increases expression ISO Nae1 (Mus musculus) 6480464 bisphenol S results in increased expression of NAE1 mRNA CTD PMID:39298647 NAE1 Human 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of NAE1 protein CTD PMID:34186270 NAE1 Human actinomycin D multiple interactions EXP 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of NAE1 protein CTD PMID:38460933 NAE1 Human afimoxifene affects response to substance EXP 6480464 NAE1 gene affects the susceptibility to afimoxifene CTD PMID:21482774 NAE1 Human all-trans-retinoic acid multiple interactions EXP 6480464 Thiophenes analog promotes the reaction [Tretinoin results in decreased expression of NAE1 mRNA] CTD PMID:16140955 NAE1 Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of NAE1 mRNA CTD PMID:16140955 and PMID:33167477 NAE1 Human antirheumatic drug increases expression EXP 6480464 Antirheumatic Agents results in increased expression of NAE1 mRNA CTD PMID:24449571 NAE1 Human aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of NAE1 protein CTD PMID:33212167 NAE1 Human aristolochic acid A decreases expression EXP 6480464 aristolochic acid I results in decreased expression of NAE1 mRNA CTD PMID:33212167 NAE1 Human Aroclor 1254 decreases expression ISO Nae1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of NAE1 mRNA CTD PMID:23650126 NAE1 Human azoxystrobin multiple interactions ISO Nae1 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of NAE1 mRNA CTD PMID:33854195 NAE1 Human benzo[a]pyrene increases expression ISO Nae1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of NAE1 mRNA CTD PMID:19770486 and PMID:22228805 NAE1 Human bis(2-ethylhexyl) phthalate multiple interactions ISO Nae1 (Mus musculus) 6480464 PPARA protein inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of NAE1 mRNA] CTD PMID:19850644 NAE1 Human bis(2-ethylhexyl) phthalate increases expression ISO Nae1 (Rattus norvegicus) 6480464 Diethylhexyl Phthalate results in increased expression of NAE1 mRNA CTD PMID:21318169 NAE1 Human bis(2-ethylhexyl) phthalate decreases expression ISO Nae1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of NAE1 mRNA CTD PMID:19850644 and PMID:33754040 NAE1 Human bisphenol A increases expression ISO Nae1 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of NAE1 mRNA CTD PMID:25181051 and PMID:34947998 NAE1 Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NAE1 protein CTD PMID:34186270 and PMID:37567409 NAE1 Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NAE1 mRNA CTD PMID:29275510 NAE1 Human bisphenol A increases methylation ISO Nae1 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of NAE1 gene CTD PMID:28505145 NAE1 Human cadmium dichloride increases methylation ISO Nae1 (Rattus norvegicus) 6480464 Cadmium Chloride results in increased methylation of NAE1 promoter CTD PMID:22457795 NAE1 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to NAE1 gene] CTD PMID:28238834 NAE1 Human chlordecone increases expression ISO Nae1 (Mus musculus) 6480464 Chlordecone results in increased expression of NAE1 mRNA CTD PMID:29980752 NAE1 Human chlorpyrifos multiple interactions ISO Nae1 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of NAE1 mRNA CTD PMID:33854195 NAE1 Human choline multiple interactions ISO Nae1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NAE1 gene CTD PMID:20938992 NAE1 Human cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of NAE1 mRNA CTD PMID:19376846 NAE1 Human copper(II) sulfate decreases expression EXP 6480464 Copper Sulfate results in decreased expression of NAE1 mRNA CTD PMID:19549813 NAE1 Human crocidolite asbestos decreases expression ISO Nae1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of NAE1 mRNA CTD PMID:29279043 NAE1 Human decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of NAE1 protein CTD PMID:31675489 NAE1 Human dicrotophos decreases expression EXP 6480464 dicrotophos results in decreased expression of NAE1 mRNA CTD PMID:28302478 NAE1 Human ethanol increases expression ISO Nae1 (Mus musculus) 6480464 Ethanol results in increased expression of NAE1 mRNA CTD PMID:30319688 NAE1 Human finasteride increases expression ISO Nae1 (Rattus norvegicus) 6480464 Finasteride results in increased expression of NAE1 mRNA CTD PMID:24136188 NAE1 Human flutamide increases expression ISO Nae1 (Rattus norvegicus) 6480464 Flutamide results in increased expression of NAE1 mRNA CTD PMID:24136188 NAE1 Human folic acid multiple interactions ISO Nae1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NAE1 gene CTD PMID:20938992 NAE1 Human folic acid decreases expression ISO Nae1 (Mus musculus) 6480464 Folic Acid results in decreased expression of NAE1 mRNA CTD PMID:25629700 NAE1 Human glyphosate multiple interactions ISO Nae1 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of NAE1 mRNA CTD PMID:33854195 NAE1 Human hydrogen peroxide affects expression EXP 6480464 Hydrogen Peroxide affects the expression of NAE1 mRNA CTD PMID:20044591 NAE1 Human imidacloprid multiple interactions ISO Nae1 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of NAE1 mRNA CTD PMID:33854195 NAE1 Human indole-3-methanol affects expression ISO Nae1 (Rattus norvegicus) 6480464 indole-3-carbinol affects the expression of NAE1 mRNA CTD PMID:21396975 NAE1 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of NAE1 protein CTD PMID:32959892 NAE1 Human L-methionine multiple interactions ISO Nae1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NAE1 gene CTD PMID:20938992 NAE1 Human nefazodone increases expression ISO Nae1 (Rattus norvegicus) 6480464 nefazodone results in increased expression of NAE1 mRNA CTD PMID:24136188 NAE1 Human Nutlin-3 multiple interactions EXP 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of NAE1 protein CTD PMID:38460933 NAE1 Human ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of NAE1 mRNA CTD PMID:35430440 NAE1 Human pentachlorophenol increases expression ISO Nae1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of NAE1 mRNA CTD PMID:23892564 NAE1 Human perfluorohexanesulfonic acid increases expression ISO Nae1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of NAE1 mRNA CTD PMID:37995155 NAE1 Human potassium chromate decreases expression EXP 6480464 potassium chromate(VI) results in decreased expression of NAE1 mRNA CTD PMID:22079256 NAE1 Human potassium chromate multiple interactions EXP 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of NAE1 mRNA CTD PMID:22079256 NAE1 Human pregnenolone 16alpha-carbonitrile increases expression ISO Nae1 (Rattus norvegicus) 6480464 Pregnenolone Carbonitrile results in increased expression of NAE1 mRNA CTD PMID:19162173 NAE1 Human rac-lactic acid decreases expression EXP 6480464 Lactic Acid results in decreased expression of NAE1 mRNA CTD PMID:30851411 NAE1 Human resveratrol multiple interactions EXP 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of NAE1 mRNA CTD PMID:23557933 NAE1 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of NAE1 mRNA CTD PMID:38568856 NAE1 Human thapsigargin decreases expression ISO Nae1 (Rattus norvegicus) 6480464 Thapsigargin results in decreased expression of NAE1 protein CTD PMID:35544339 NAE1 Human thiabendazole multiple interactions ISO Nae1 (Rattus norvegicus) 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of NAE1 mRNA CTD PMID:33854195 NAE1 Human thiophenes multiple interactions EXP 6480464 Thiophenes analog promotes the reaction [Tretinoin results in decreased expression of NAE1 mRNA] CTD PMID:16140955 NAE1 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of NAE1 mRNA CTD PMID:37042841 NAE1 Human triptonide affects expression ISO Nae1 (Mus musculus) 6480464 triptonide affects the expression of NAE1 mRNA CTD PMID:33045310 NAE1 Human uranium atom affects expression EXP 6480464 Uranium affects the expression of NAE1 mRNA CTD PMID:15672453 NAE1 Human valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of NAE1 gene CTD PMID:29154799 NAE1 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of NAE1 mRNA CTD PMID:25979313 NAE1 Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of NAE1 mRNA CTD PMID:28001369
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (EXP) 1,2-dimethylhydrazine (ISO) 1,3,5-trinitro-1,3,5-triazinane (ISO) 1-chloro-2,4-dinitrobenzene (EXP) 17alpha-ethynylestradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (EXP) 2,4-dinitrotoluene (ISO) 2-hydroxypropanoic acid (EXP) 3,3',5,5'-tetrabromobisphenol A (EXP) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) actinomycin D (EXP) afimoxifene (EXP) all-trans-retinoic acid (EXP) antirheumatic drug (EXP) aristolochic acid A (EXP) Aroclor 1254 (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) CGP 52608 (EXP) chlordecone (ISO) chlorpyrifos (ISO) choline (ISO) cobalt dichloride (EXP) copper(II) sulfate (EXP) crocidolite asbestos (ISO) decabromodiphenyl ether (EXP) dicrotophos (EXP) ethanol (ISO) finasteride (ISO) flutamide (ISO) folic acid (ISO) glyphosate (ISO) hydrogen peroxide (EXP) imidacloprid (ISO) indole-3-methanol (ISO) ivermectin (EXP) L-methionine (ISO) nefazodone (ISO) Nutlin-3 (EXP) ozone (EXP) pentachlorophenol (ISO) perfluorohexanesulfonic acid (ISO) potassium chromate (EXP) pregnenolone 16alpha-carbonitrile (ISO) rac-lactic acid (EXP) resveratrol (EXP) sodium arsenite (EXP) thapsigargin (ISO) thiabendazole (ISO) thiophenes (EXP) triphenyl phosphate (EXP) triptonide (ISO) uranium atom (EXP) valproic acid (EXP)
1.
APP-BP1 mediates APP-induced apoptosis and DNA synthesis and is increased in Alzheimer's disease brain.
Chen Y, etal., J Cell Biol. 2003 Oct 13;163(1):27-33.
2.
APP-BP1, a novel protein that binds to the carboxyl-terminal region of the amyloid precursor protein.
Chow N, etal., J Biol Chem 1996 May 10;271(19):11339-46.
3.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
4.
Focal transient ischemia increases APP-BP1 expression in neural progenitor cells.
Joo Y, etal., Neuroreport. 2011 Mar 30;22(5):200-5. doi: 10.1097/WNR.0b013e32834449cf.
5.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
6.
A new NEDD8-ligating system for cullin-4A.
Osaka F, etal., Genes Dev. 1998 Aug 1;12(15):2263-8. doi: 10.1101/gad.12.15.2263.
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Insights into the ubiquitin transfer cascade from the structure of the activating enzyme for NEDD8.
Walden H, etal., Nature 2003 Mar 20;422(6929):330-4.
NAE1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 66,802,878 - 66,830,976 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 66,802,875 - 66,873,256 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 66,836,781 - 66,864,879 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 65,394,282 - 65,422,380 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 65,394,282 - 65,422,370 NCBI Celera 16 51,345,091 - 51,373,189 (-) NCBI Celera Cytogenetic Map 16 q22.1 NCBI HuRef 16 52,710,930 - 52,739,089 (-) NCBI HuRef CHM1_1 16 68,243,864 - 68,271,962 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 72,597,172 - 72,625,270 (-) NCBI T2T-CHM13v2.0
Nae1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 105,237,660 - 105,261,269 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 105,237,660 - 105,261,269 (-) Ensembl GRCm39 Ensembl GRCm38 8 104,511,028 - 104,534,656 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 104,511,028 - 104,534,637 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 107,034,928 - 107,058,537 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 107,400,153 - 107,423,744 (-) NCBI MGSCv36 mm8 Celera 8 108,742,436 - 108,767,075 (-) NCBI Celera Cytogenetic Map 8 D3 NCBI cM Map 8 53.04 NCBI
Nae1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 452,462 - 478,591 (+) NCBI GRCr8 mRatBN7.2 19 446,015 - 472,145 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 446,000 - 472,371 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 441,827 - 468,061 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 1,208,624 - 1,234,856 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 483,838 - 510,076 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 653,510 - 680,378 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 653,510 - 680,378 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 646,826 - 673,676 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 382,556 - 408,667 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 382,555 - 408,667 (+) NCBI Celera 19 446,357 - 467,621 (+) NCBI Celera Cytogenetic Map 19 p14 NCBI
Nae1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955433 23,333,742 - 23,358,579 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955433 23,333,797 - 23,358,255 (-) NCBI ChiLan1.0 ChiLan1.0
NAE1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 76,304,088 - 76,332,248 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 82,216,589 - 82,244,743 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 47,119,548 - 47,147,679 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 66,221,829 - 66,246,648 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 66,221,829 - 66,246,865 (-) Ensembl panpan1.1 panPan2
NAE1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 82,462,690 - 82,486,097 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 82,462,744 - 82,486,100 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 82,451,391 - 82,474,791 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 82,899,329 - 82,922,733 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 82,899,354 - 82,922,729 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 82,722,479 - 82,745,880 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 82,409,395 - 82,433,102 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 83,048,382 - 83,071,880 (+) NCBI UU_Cfam_GSD_1.0
Nae1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 42,483,986 - 42,505,936 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 17,083,077 - 17,105,133 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 17,083,175 - 17,105,098 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NAE1
NAE1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 52,502,729 - 52,531,447 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 52,502,546 - 52,525,262 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 23,380,340 - 23,409,070 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nae1
.
Predicted Target Of
Count of predictions: 2584 Count of miRNA genes: 976 Interacting mature miRNAs: 1166 Transcripts: ENST00000290810, ENST00000359087, ENST00000379463, ENST00000394074, ENST00000561579, ENST00000562074, ENST00000562428, ENST00000562757, ENST00000563185, ENST00000563221, ENST00000563253, ENST00000563419, ENST00000564040, ENST00000565535, ENST00000566336, ENST00000566663, ENST00000567521, ENST00000567743, ENST00000568672, ENST00000569348, ENST00000569388, ENST00000569963 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
Cda01h11
Human Assembly Chr Position (strand) Source JBrowse GRCh37 16 66,836,838 - 66,836,941 UniSTS GRCh37 Build 36 16 65,394,339 - 65,394,442 RGD NCBI36 Celera 16 51,345,148 - 51,345,251 RGD Cytogenetic Map 16 q22.1 UniSTS Cytogenetic Map 16 q22 UniSTS HuRef 16 52,710,987 - 52,711,090 UniSTS GeneMap99-GB4 RH Map 16 406.77 UniSTS NCBI RH Map 16 508.6 UniSTS
RH65010
Human Assembly Chr Position (strand) Source JBrowse GRCh37 16 66,849,133 - 66,849,268 UniSTS GRCh37 Build 36 16 65,406,634 - 65,406,769 RGD NCBI36 Celera 16 51,357,443 - 51,357,578 RGD Cytogenetic Map 16 q22 UniSTS HuRef 16 52,723,290 - 52,723,425 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4974
1726
2351
6
624
1951
465
2270
7306
6472
53
3734
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000290810 ⟹ ENSP00000290810
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,802,878 - 66,830,976 (-) Ensembl
Ensembl Acc Id:
ENST00000359087 ⟹ ENSP00000351990
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,802,875 - 66,830,976 (-) Ensembl
Ensembl Acc Id:
ENST00000379463 ⟹ ENSP00000368776
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,802,880 - 66,830,976 (-) Ensembl
Ensembl Acc Id:
ENST00000394074 ⟹ ENSP00000377637
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,802,912 - 66,830,955 (-) Ensembl
Ensembl Acc Id:
ENST00000561579 ⟹ ENSP00000464119
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,817,470 - 66,873,256 (-) Ensembl
Ensembl Acc Id:
ENST00000562074
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,805,630 - 66,808,694 (-) Ensembl
Ensembl Acc Id:
ENST00000562428 ⟹ ENSP00000463546
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,802,875 - 66,808,548 (-) Ensembl
Ensembl Acc Id:
ENST00000562757
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,823,342 - 66,830,976 (-) Ensembl
Ensembl Acc Id:
ENST00000563185 ⟹ ENSP00000454506
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,817,434 - 66,830,973 (-) Ensembl
Ensembl Acc Id:
ENST00000563221
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,802,880 - 66,806,069 (-) Ensembl
Ensembl Acc Id:
ENST00000563253 ⟹ ENSP00000454471
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,816,647 - 66,830,959 (-) Ensembl
Ensembl Acc Id:
ENST00000563419
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,824,516 - 66,830,960 (-) Ensembl
Ensembl Acc Id:
ENST00000564040
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,818,633 - 66,830,963 (-) Ensembl
Ensembl Acc Id:
ENST00000565535 ⟹ ENSP00000455967
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,823,230 - 66,830,976 (-) Ensembl
Ensembl Acc Id:
ENST00000566336 ⟹ ENSP00000462040
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,821,456 - 66,830,917 (-) Ensembl
Ensembl Acc Id:
ENST00000566663 ⟹ ENSP00000462937
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,802,878 - 66,810,413 (-) Ensembl
Ensembl Acc Id:
ENST00000567521
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,813,129 - 66,816,716 (-) Ensembl
Ensembl Acc Id:
ENST00000567743 ⟹ ENSP00000455562
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,816,614 - 66,830,968 (-) Ensembl
Ensembl Acc Id:
ENST00000568672
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,802,880 - 66,806,145 (-) Ensembl
Ensembl Acc Id:
ENST00000569348 ⟹ ENSP00000456564
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,823,281 - 66,830,976 (-) Ensembl
Ensembl Acc Id:
ENST00000569388 ⟹ ENSP00000456847
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,821,446 - 66,830,977 (-) Ensembl
Ensembl Acc Id:
ENST00000569963
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 66,826,099 - 66,830,976 (-) Ensembl
RefSeq Acc Id:
NM_001018159 ⟹ NP_001018169
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 16 66,802,878 - 66,830,976 (-) NCBI GRCh37 16 66,836,781 - 66,864,880 (-) NCBI Build 36 16 65,394,282 - 65,422,380 (-) NCBI Archive HuRef 16 52,710,930 - 52,739,089 (-) ENTREZGENE CHM1_1 16 68,243,864 - 68,271,962 (-) NCBI T2T-CHM13v2.0 16 72,597,172 - 72,625,270 (-) NCBI
Sequence:
AGTGCGCCTGCGCGCTTGTGGAGCTGGTGGCGGCGCTCCGCAGGGGCTCGGCTGTTTTCCGCGCGGCAGGCGCGGCCATGGCGCAGCTGGGAAAGCTGCTCAAGGAGCAGAAGTACGACCGGCAGCTG
hide sequence
RefSeq Acc Id:
NM_001018160 ⟹ NP_001018170
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 16 66,802,878 - 66,830,976 (-) NCBI GRCh37 16 66,836,781 - 66,864,880 (-) NCBI Build 36 16 65,394,282 - 65,422,380 (-) NCBI Archive HuRef 16 52,710,930 - 52,739,089 (-) ENTREZGENE CHM1_1 16 68,243,864 - 68,271,962 (-) NCBI T2T-CHM13v2.0 16 72,597,172 - 72,625,270 (-) NCBI
Sequence:
AGTGCGCCTGCGCGCTTGTGGAGCTGGTGGCGGCGCTCCGCAGGGGCTCGGCTGTTTTCCGCGCGGCAGGCGCGGCCATGGCGCAGCTGGGAAAGCTGCTCAAGGAGCAGAAGTACGACCGGCAGCTG
hide sequence
RefSeq Acc Id:
NM_001286500 ⟹ NP_001273429
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 16 66,802,878 - 66,830,976 (-) NCBI HuRef 16 52,710,930 - 52,739,089 (-) NCBI CHM1_1 16 68,243,864 - 68,271,962 (-) NCBI T2T-CHM13v2.0 16 72,597,172 - 72,625,270 (-) NCBI
Sequence:
AGTGCGCCTGCGCGCTTGTGGAGCTGGTGGCGGCGCTCCGCAGGGGCTCGGCTGTTTTCCGCGC
hide sequence
RefSeq Acc Id:
NM_003905 ⟹ NP_003896
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 16 66,802,878 - 66,830,976 (-) NCBI GRCh37 16 66,836,781 - 66,864,880 (-) NCBI Build 36 16 65,394,282 - 65,422,380 (-) NCBI Archive HuRef 16 52,710,930 - 52,739,089 (-) ENTREZGENE CHM1_1 16 68,243,864 - 68,271,962 (-) NCBI T2T-CHM13v2.0 16 72,597,172 - 72,625,270 (-) NCBI
Sequence:
AGTGCGCCTGCGCGCTTGTGGAGCTGGTGGCGGCGCTCCGCAGGGGCTCGGCTGTTTTCCGCGCGGCAGGCGCGGCCATGGCGCAGCTGGGAAAGCTGCTCAAGGAGCAGAAGTACGACCGGCAGCTG
hide sequence
RefSeq Acc Id:
XM_047434835 ⟹ XP_047290791
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 16 66,802,878 - 66,830,976 (-) NCBI
RefSeq Acc Id:
XM_054314261 ⟹ XP_054170236
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 16 72,597,172 - 72,625,270 (-) NCBI
RefSeq Acc Id:
NP_001018170 ⟸ NM_001018160
- Peptide Label:
isoform c
- UniProtKB:
Q13564 (UniProtKB/Swiss-Prot)
- Sequence:
MEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVI
hide sequence
RefSeq Acc Id:
NP_003896 ⟸ NM_003905
- Peptide Label:
isoform a
- UniProtKB:
B2R700 (UniProtKB/Swiss-Prot), A8MU28 (UniProtKB/Swiss-Prot), A6NFN4 (UniProtKB/Swiss-Prot), A6NCK0 (UniProtKB/Swiss-Prot), B3KUP9 (UniProtKB/Swiss-Prot), Q13564 (UniProtKB/Swiss-Prot)
- Sequence:
MAQLGKLLKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQ
hide sequence
RefSeq Acc Id:
NP_001018169 ⟸ NM_001018159
- Peptide Label:
isoform b
- UniProtKB:
Q13564 (UniProtKB/Swiss-Prot)
- Sequence:
MDAQQTKTNEARLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPES
hide sequence
RefSeq Acc Id:
NP_001273429 ⟸ NM_001286500
- Peptide Label:
isoform d
- UniProtKB:
Q13564 (UniProtKB/Swiss-Prot)
- Sequence:
MAQLGKLLKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGNVGIGSFTIID
hide sequence
Ensembl Acc Id:
ENSP00000351990 ⟸ ENST00000359087
Ensembl Acc Id:
ENSP00000368776 ⟸ ENST00000379463
Ensembl Acc Id:
ENSP00000464119 ⟸ ENST00000561579
Ensembl Acc Id:
ENSP00000463546 ⟸ ENST00000562428
Ensembl Acc Id:
ENSP00000454506 ⟸ ENST00000563185
Ensembl Acc Id:
ENSP00000454471 ⟸ ENST00000563253
Ensembl Acc Id:
ENSP00000455967 ⟸ ENST00000565535
Ensembl Acc Id:
ENSP00000377637 ⟸ ENST00000394074
Ensembl Acc Id:
ENSP00000462937 ⟸ ENST00000566663
Ensembl Acc Id:
ENSP00000462040 ⟸ ENST00000566336
Ensembl Acc Id:
ENSP00000455562 ⟸ ENST00000567743
Ensembl Acc Id:
ENSP00000290810 ⟸ ENST00000290810
Ensembl Acc Id:
ENSP00000456847 ⟸ ENST00000569388
Ensembl Acc Id:
ENSP00000456564 ⟸ ENST00000569348
RefSeq Acc Id:
XP_047290791 ⟸ XM_047434835
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_054170236 ⟸ XM_054314261
- Peptide Label:
isoform X1
RGD ID: 6792964 Promoter ID: HG_KWN:23989 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: ENST00000359087, NM_001018159, NM_001018160, OTTHUMT00000268832, UC010CDW.1 Position: Human Assembly Chr Position (strand) Source Build 36 16 65,422,094 - 65,422,594 (-) MPROMDB
RGD ID: 6853178 Promoter ID: EP74410 Type: initiation region Name: HS_APPBP1 Description: Amyloid beta precursor protein binding protein 1, 59kDa. SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Mammalian gene collection (MGC) full-length cDNA cloning Position: Human Assembly Chr Position (strand) Source Build 36 16 65,422,380 - 65,422,440 EPD
RGD ID: 7232445 Promoter ID: EPDNEW_H21968 Type: initiation region Name: NAE1_1 Description: NEDD8 activating enzyme E1 subunit 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 16 66,830,959 - 66,831,019 EPDNEW
