Symbol:
Artn
Name:
artemin
RGD ID:
733582
MGI Page
MGI
Description:
Enables signaling receptor binding activity. Involved in Peyer's patch morphogenesis and lymphocyte migration into lymphoid organs. Acts upstream of or within axon guidance; induction of positive chemotaxis; and peripheral nervous system development. Located in extracellular space. Is expressed in several structures, including central nervous system; cervical ganglion; oviduct; retina; and small intestine. Orthologous to human ARTN (artemin).
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
neub; neublastin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ARTN (artemin) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Artn (artemin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Artn (artemin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ARTN (artemin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ARTN (artemin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Artn (artemin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ARTN (artemin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ARTN (artemin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Artn (artemin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Artn (artemin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ARTN (artemin)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 117,783,105 - 117,787,993 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 117,783,359 - 117,786,960 (-) Ensembl GRCm39 Ensembl GRCm38 4 117,925,908 - 117,930,795 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 117,926,162 - 117,929,763 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 117,598,767 - 117,602,368 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 117,424,094 - 117,427,695 (-) NCBI MGSCv36 mm8 Celera 4 116,641,832 - 116,645,434 (-) NCBI Celera Cytogenetic Map 4 D1 NCBI cM Map 4 53.83 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Artn Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of ARTN mRNA CTD PMID:28960355 Artn Mouse 17beta-estradiol multiple interactions ISO ARTN (Homo sapiens) 6480464 [Estradiol co-treated with EGF protein] results in increased expression of ARTN mRNA more ... CTD PMID:20305694 and PMID:24758408 Artn Mouse 17beta-estradiol increases expression ISO ARTN (Homo sapiens) 6480464 Estradiol results in increased expression of ARTN mRNA and Estradiol results in increased expression of ARTN protein CTD PMID:20305694 and PMID:31614463 Artn Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ARTN mRNA CTD PMID:19933214 Artn Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Artn (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ARTN mRNA CTD PMID:32109520 and PMID:33387578 Artn Mouse 3,3',4,4',5-pentachlorobiphenyl increases expression ISO Artn (Rattus norvegicus) 6480464 3 more ... CTD PMID:32119087 Artn Mouse 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ARTN mRNA CTD PMID:20188158 Artn Mouse 4,4'-sulfonyldiphenol increases methylation EXP 6480464 bisphenol S results in increased methylation of ARTN exon CTD PMID:33297965 Artn Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of ARTN gene CTD PMID:31683443 Artn Mouse 6-propyl-2-thiouracil decreases expression ISO Artn (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of ARTN mRNA CTD PMID:24780913 Artn Mouse 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:27869817 Artn Mouse 7,12-dimethyltetraphene multiple interactions EXP 6480464 AHR mRNA promotes the reaction [9 more ... CTD PMID:27869817 Artn Mouse acrylamide increases expression ISO Artn (Rattus norvegicus) 6480464 Acrylamide results in increased expression of ARTN mRNA CTD PMID:28959563 Artn Mouse ammonium chloride affects expression ISO Artn (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of ARTN mRNA CTD PMID:16483693 Artn Mouse arsane affects expression ISO ARTN (Homo sapiens) 6480464 Arsenic affects the expression of ARTN protein CTD PMID:24675094 Artn Mouse arsenic atom affects expression ISO ARTN (Homo sapiens) 6480464 Arsenic affects the expression of ARTN protein CTD PMID:24675094 Artn Mouse benzo[a]pyrene multiple interactions EXP 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of ARTN mRNA] CTD PMID:22228805 Artn Mouse benzo[a]pyrene decreases methylation ISO ARTN (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of ARTN 3' UTR and Benzo(a)pyrene results in decreased methylation of ARTN exon CTD PMID:27901495 Artn Mouse benzo[a]pyrene affects methylation ISO ARTN (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ARTN 5' UTR and Benzo(a)pyrene affects the methylation of ARTN promoter CTD PMID:27901495 Artn Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of ARTN mRNA CTD PMID:22228805 Artn Mouse Benzo[ghi]perylene increases expression EXP 6480464 1 and 12-benzoperylene results in increased expression of ARTN mRNA CTD PMID:26377693 Artn Mouse bisphenol A increases expression ISO Artn (Rattus norvegicus) 6480464 bisphenol A results in increased expression of ARTN mRNA CTD PMID:25181051 Artn Mouse bisphenol A decreases expression ISO Artn (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of ARTN mRNA and bisphenol A results in decreased expression of SIGLEC12 mRNA CTD PMID:25181051 more ... Artn Mouse butan-1-ol multiple interactions ISO ARTN (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of ARTN mRNA CTD PMID:29432896 Artn Mouse camptothecin decreases response to substance ISO ARTN (Homo sapiens) 6480464 ARTN mRNA results in decreased susceptibility to Camptothecin CTD PMID:25269479 Artn Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Artn Mouse carmustine decreases expression ISO ARTN (Homo sapiens) 6480464 Carmustine results in decreased expression of ARTN mRNA CTD PMID:15980968 Artn Mouse CGP 52608 multiple interactions ISO ARTN (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ARTN gene] CTD PMID:28238834 Artn Mouse cisplatin decreases expression ISO ARTN (Homo sapiens) 6480464 Cisplatin results in decreased expression of ARTN mRNA CTD PMID:27392435 Artn Mouse cisplatin multiple interactions ISO ARTN (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of ARTN mRNA CTD PMID:27392435 Artn Mouse dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of ARTN mRNA CTD PMID:22733784 Artn Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of ARTN mRNA CTD PMID:30529165 Artn Mouse enniatin increases expression ISO ARTN (Homo sapiens) 6480464 enniatins results in increased expression of ARTN mRNA CTD PMID:36016515 Artn Mouse ethanol multiple interactions ISO ARTN (Homo sapiens) 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of ARTN mRNA CTD PMID:29432896 Artn Mouse fulvestrant multiple interactions ISO ARTN (Homo sapiens) 6480464 ARTN protein inhibits the reaction [fulvestrant inhibits the reaction [Estradiol results in increased expression of BCL2 protein]] more ... CTD PMID:20305694 Artn Mouse fulvestrant decreases response to substance ISO ARTN (Homo sapiens) 6480464 ARTN protein results in decreased susceptibility to fulvestrant CTD PMID:20305694 Artn Mouse gentamycin increases expression ISO Artn (Rattus norvegicus) 6480464 Gentamicins results in increased expression of ARTN mRNA CTD PMID:33387578 Artn Mouse isotretinoin multiple interactions ISO ARTN (Homo sapiens) 6480464 [vorinostat co-treated with Isotretinoin] results in increased expression of ARTN mRNA CTD PMID:18769122 Artn Mouse lead(0) decreases expression ISO ARTN (Homo sapiens) 6480464 Lead results in decreased expression of ARTN mRNA CTD PMID:19921347 Artn Mouse mono(2-ethylhexyl) phthalate increases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of ARTN mRNA CTD PMID:22401849 Artn Mouse paracetamol decreases expression ISO Artn (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of ARTN mRNA CTD PMID:33387578 Artn Mouse paraquat increases expression ISO Artn (Rattus norvegicus) 6480464 Paraquat results in increased expression of ARTN mRNA CTD PMID:32680482 Artn Mouse resveratrol multiple interactions ISO ARTN (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of ARTN mRNA CTD PMID:23557933 Artn Mouse silicon dioxide decreases expression ISO ARTN (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of ARTN mRNA CTD PMID:25351596 Artn Mouse tamoxifen multiple interactions ISO ARTN (Homo sapiens) 6480464 ARTN protein inhibits the reaction [Tamoxifen inhibits the reaction [Estradiol results in increased expression of BCL2 protein]] more ... CTD PMID:20305694 and PMID:24758408 Artn Mouse tamoxifen decreases response to substance ISO ARTN (Homo sapiens) 6480464 ARTN protein results in decreased susceptibility to Tamoxifen CTD PMID:20305694 Artn Mouse temozolomide decreases expression ISO ARTN (Homo sapiens) 6480464 Temozolomide results in decreased expression of ARTN mRNA CTD PMID:31758290 Artn Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of ARTN gene and titanium dioxide results in decreased methylation of ARTN promoter CTD PMID:35295148 Artn Mouse trichloroethene increases expression ISO Artn (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of ARTN mRNA CTD PMID:33387578 Artn Mouse triclosan decreases expression ISO ARTN (Homo sapiens) 6480464 Triclosan results in decreased expression of ARTN mRNA CTD PMID:30510588 Artn Mouse valproic acid increases expression ISO Artn (Rattus norvegicus) 6480464 Valproic Acid results in increased expression of ARTN mRNA CTD PMID:35594946 Artn Mouse vorinostat multiple interactions ISO ARTN (Homo sapiens) 6480464 [vorinostat co-treated with Isotretinoin] results in increased expression of ARTN mRNA CTD PMID:18769122
1,2-dichloroethane (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (EXP) 6-propyl-2-thiouracil (ISO) 7,12-dimethyltetraphene (EXP) acrylamide (ISO) ammonium chloride (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (EXP,ISO) Benzo[ghi]perylene (EXP) bisphenol A (ISO) butan-1-ol (ISO) camptothecin (ISO) carbon nanotube (EXP) carmustine (ISO) CGP 52608 (ISO) cisplatin (ISO) dexamethasone (EXP) dioxygen (EXP) enniatin (ISO) ethanol (ISO) fulvestrant (ISO) gentamycin (ISO) isotretinoin (ISO) lead(0) (ISO) mono(2-ethylhexyl) phthalate (EXP) paracetamol (ISO) paraquat (ISO) resveratrol (ISO) silicon dioxide (ISO) tamoxifen (ISO) temozolomide (ISO) titanium dioxide (EXP) trichloroethene (ISO) triclosan (ISO) valproic acid (ISO) vorinostat (ISO)
1.
Nerve growth factor and artemin are paracrine mediators of pancreatic neuropathy in pancreatic adenocarcinoma.
Ceyhan GO, etal., Ann Surg. 2010 May;251(5):923-31.
2.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
3.
BDNF mRNA expression is significantly upregulated in vestibular schwannomas and correlates with proliferative activity.
Kramer F, etal., J Neurooncol. 2010 May;98(1):31-9. doi: 10.1007/s11060-009-0063-6. Epub 2009 Nov 25.
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
MGD IEA
MGD IEA
6.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
7.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Acetyl-l-carnitine increases artemin level and prevents neurotrophic factor alterations during neuropathy.
Vivoli E, etal., Neuroscience. 2010 Jun 2;167(4):1168-74. Epub 2010 Mar 16.
10.
Persistent restoration of sensory function by immediate or delayed systemic artemin after dorsal root injury.
Wang R, etal., Nat Neurosci. 2008 Apr;11(4):488-96. Epub 2008 Mar 23.
11.
Nan fang yi ke da xue xue bao = Journal of Southern Medical University
Zhu DL, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2009 Mar;29(3):428-32.
Artn Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 117,783,105 - 117,787,993 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 117,783,359 - 117,786,960 (-) Ensembl GRCm39 Ensembl GRCm38 4 117,925,908 - 117,930,795 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 117,926,162 - 117,929,763 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 117,598,767 - 117,602,368 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 117,424,094 - 117,427,695 (-) NCBI MGSCv36 mm8 Celera 4 116,641,832 - 116,645,434 (-) NCBI Celera Cytogenetic Map 4 D1 NCBI cM Map 4 53.83 NCBI
ARTN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 43,933,801 - 43,937,240 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 43,933,320 - 43,937,240 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 44,399,473 - 44,402,912 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 44,171,579 - 44,175,471 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 44,070,746 - 44,071,977 NCBI Celera 1 42,682,525 - 42,686,445 (+) NCBI Celera Cytogenetic Map 1 p34.1 NCBI HuRef 1 42,517,866 - 42,521,786 (+) NCBI HuRef CHM1_1 1 44,515,224 - 44,519,144 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 43,802,329 - 43,808,317 (+) NCBI T2T-CHM13v2.0
Artn Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 136,750,188 - 136,755,645 (-) NCBI GRCr8 mRatBN7.2 5 131,458,596 - 131,470,193 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 131,464,756 - 131,468,025 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 134,169,882 - 134,173,127 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 135,924,501 - 135,927,746 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 135,946,923 - 135,950,168 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 136,759,717 - 136,765,036 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 136,759,717 - 136,762,986 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 140,548,766 - 140,554,035 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 138,390,981 - 138,394,250 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 138,396,703 - 138,397,079 (-) NCBI Celera 5 130,012,959 - 130,016,228 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
Artn Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955537 3,460,176 - 3,464,335 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955537 3,460,176 - 3,464,335 (+) NCBI ChiLan1.0 ChiLan1.0
ARTN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 182,872,431 - 182,878,378 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 182,013,760 - 182,019,707 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 43,233,097 - 43,239,044 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 44,604,514 - 44,610,643 (+) NCBI panpan1.1 PanPan1.1 panPan2
ARTN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Dog10K_Boxer_Tasha 15 16,435,953 - 16,442,427 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 16,469,613 - 16,476,086 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 15 16,268,455 - 16,274,928 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 16,340,604 - 16,343,946 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 16,410,202 - 16,416,677 (-) NCBI UU_Cfam_GSD_1.0
Artn Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 59,423,684 - 59,434,755 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 25,252,684 - 25,253,810 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 25,252,510 - 25,254,221 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ARTN Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 167,357,662 - 167,361,221 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 167,356,363 - 167,361,370 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 154,725,018 - 154,726,492 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ARTN Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 88,869,463 - 88,874,036 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 88,869,941 - 88,871,049 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 28,051,970 - 28,057,269 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Artn
.
Predicted Target Of
Count of predictions: 526 Count of miRNA genes: 293 Interacting mature miRNAs: 317 Transcripts: ENSMUST00000070816, ENSMUST00000097913, ENSMUST00000133703, ENSMUST00000150612 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
12904006 Cfq1_m conditioned fear QTL 1 (mouse) 4 117177646 120107755 Mouse 13824982 Svwq1_m seminal vesicle weight QTL 1 (mouse) 4 89888237 118857197 Mouse 11532714 Sluc43_m susceptibility to lung cancer 43 (mouse) 4 46642108 123127211 Mouse 10047132 Albq19_m albuminuria QTL 19 (mouse) Not determined 4 112824389 146824389 Mouse 12904002 Opfaq9_m open field activity QTL 9 (mouse) 4 92975790 126975790 Mouse 4141623 W6q13_m weight 6 weeks QTL 13 (mouse) Not determined 88982069 140468203 Mouse 12910797 Pwgrq4_m pre-weaning growth rate QTL 4 (mouse) 4 105835310 141433838 Mouse 25314312 Syncl2_m synaptonemal complex length 2 (mouse) 4 65718237 146584457 Mouse 1357726 Lnopy1_m lens opacity 1 (mouse) Not determined 4 85428838 119429037 Mouse 12910794 Pwbwq8_m post-weaning body weight QTL 8 (mouse) 4 105835310 141433838 Mouse 14696689 Gdq2_m grooming duration QTL 2, females (mouse) 4 100857197 124893793 Mouse 1300743 Skull6_m skull morphology 6 (mouse) Not determined 4 111009051 145009280 Mouse 1301382 Arvm2_m autoimmune renal vasculitis 2 (mouse) Not determined 4 107791564 141791756 Mouse 12910813 Pwbwq4_m pre-weaning body weight QTL 4 (mouse) 4 105835310 141433838 Mouse 4141093 W3q17_m weight 3 weeks QTL 17 (mouse) Not determined 88982069 140468203 Mouse 12910808 Pwbwq9_m post-weaning body weight QTL 9 (mouse) 4 105835310 141433838 Mouse 27095939 Ulnl9_m ulna length 9, 16 week (mouse) 4 65318237 118857197 Mouse 11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 4142493 Femwf13_m femur work to failure 13 (mouse) Not determined 116154678 150154782 Mouse 1301815 Sles2_m systemic lupus erythmatosus suppressor 2 (mouse) Not determined 4 94957579 150676858 Mouse 1300663 Start2_m startle response 2 (mouse) Not determined 4 107264957 141265153 Mouse 1300918 Stheal4_m soft tissue heal 4 (mouse) Not determined 4 89969627 123969747 Mouse 1301556 Cd4vts1_m CD4 virgin T cell subset 1 (mouse) Not determined 4 85428838 119429037 Mouse 1301823 Bmd7_m bone mineral density 7 (mouse) Not determined 4 88982069 151654550 Mouse 4141330 Iva1_m isovaleric acid smelling 1 (mouse) Not determined 117071971 120723203 Mouse 1302078 Sluc21_m susceptibility to lung cancer 21 (mouse) Not determined 4 117401141 151401275 Mouse 10412072 Ssen1_m suseptibility to Sendai virus 1 (mouse) Not determined 4 109658132 133154782 Mouse 1301930 Papg1_m pulmonary adenoma progression 1 (mouse) Not determined 4 85781167 119781279 Mouse 13208562 Wght7_m weight 7 (mouse) 4 90888237 148084457 Mouse 13208565 Bmiq6_m body mass index QTL 6 (mouse) 4 110857197 125893793 Mouse 1300655 Nidds_m non-insulin-dependent diabetes mellitus in SJL (mouse) Not determined 4 115030777 129465915 Mouse 1300781 Lith8_m lithogenic gene 8 (mouse) Not determined 4 107264957 141265153 Mouse 39128212 Lwq21_m liver weight QTL 21 (mouse) 4 88982069 140468203 Mouse 1300689 Dob1_m Dietary obesity 1 (mouse) Body weight 4 101574601 123127211 Mouse 27226716 Metcl2_m metatarsal-calcaneal length 2, 5 week (mouse) 4 88118237 118557197 Mouse 1301847 Fecq2_m fecundity QTL 2 (mouse) Not determined 4 100071971 134072206 Mouse 26884445 Sklq7_m skull length QTL 7, 10 week (mouse) 4 68018237 150884457 Mouse 1301597 Anxty_m anxiety (mouse) Not determined 4 74137574 128009280 Mouse 26884437 Sklq13_m skull length QTL 13, 16 week (mouse) 4 57700000 155684457 Mouse 4141549 W10q10_m weight 10 weeks QTL 10 (mouse) Not determined 88982069 140468203 Mouse 1357895 Ctrcts_m cataract severity (mouse) Not determined 4 45709925 138342753 Mouse 1300809 Ccrs2_m corpus callosum hemisphere surface size 2 (mouse) Not determined 4 107264957 141265153 Mouse 1301106 Skts7_m skin tumor susceptibility 7 (mouse) Not determined 4 100071971 134072206 Mouse 1301233 Sbw2_m splenomegaly-NZB x NZW 2 (mouse) Not determined 4 94957579 128009280 Mouse 10755520 Rbc1_m red blood cell count 1 (mouse) 4 108477692 142477692 Mouse 10755521 Hct1_m hematocrit 1 (mouse) 4 108477692 142477692 Mouse 10755522 Hgb1_m hemoglobin 1 (mouse) 4 108477692 142477692 Mouse 27095924 Pglq2_m pelvic girdle length QTL 2, 5 week (mouse) 4 69118237 130727311 Mouse 1301118 Bbaa23_m B.burgdorferi-associated arthritis 23 (mouse) Not determined 4 85781167 119781279 Mouse 15039368 Nmrs19_m NAFLD-associated magnetic resonance shift 19 (mouse) 4 90882780 124882780 Mouse 27095917 Scvln14_m sacral vertebrae length 2, 16 week (mouse) 4 68018237 130277062 Mouse 1301731 Cafq2_m caffeine metabolism QTL 2 (mouse) Not determined 4 94732255 128732454 Mouse 4141900 Skts-fp1_m skin tumor susceptibility in FVB and PWK 1 (mouse) Not determined 4 53550839 124055180 Mouse 15039382 Ltgq7_m liver triglyceride QTL 7 (mouse) 4 105705794 139705794 Mouse 15039377 Bw45_m body weight QTL 45 (mouse) 4 105705794 139705794 Mouse 1300839 Dyscalc2_m dystrophic cardiac calcinosis 2 (mouse) Not determined 4 111009051 145009280 Mouse 12880433 Fgf23lq1_m FGF23 serum level QTL 1 (mouse) 4 101157197 135157197 Mouse 4141001 Tgq17_m triglyceride QTL 17 (mouse) Not determined 112523489 146523489 Mouse 1300580 Lbw2_m lupus NZB x NZW 2 (mouse) Not determined 4 98545539 128009280 Mouse 15039378 Adip30_m adiposity 30 (mouse) 4 105705794 139705794 Mouse 26884449 Sklq2_m skull length QTL 2, 5 week (mouse) 4 36700000 128993793 Mouse 27095905 Scvln3_m sacral vertebrae length 2, 5 week (mouse) 4 55600000 128993793 Mouse 1357800 Tgq3_m triglyceride QTL 3 (mouse) Not determined 4 107055093 141055180 Mouse 15039385 Mvlq3_m macrovesicular liver lesion QTL 3 (mouse) 4 112182386 146182386 Mouse 11553870 Cmmm_m carcinoma modifier of MSM (mouse) 4 90590668 124590781 Mouse 1301996 Mmtg2_m modifier of mammary tumor growth 2 (mouse) Not determined 4 116270979 124055180 Mouse
Artn
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 117,926,336 - 117,926,438 UniSTS GRCm38 MGSCv37 4 117,598,941 - 117,599,043 UniSTS GRCm37 Celera 4 116,642,007 - 116,642,109 UniSTS Cytogenetic Map 4 D1 UniSTS cM Map 4 UniSTS
UniSTS:484828
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 117,926,293 - 117,927,884 UniSTS GRCm38 MGSCv37 4 117,598,898 - 117,600,489 UniSTS GRCm37 Celera 4 116,641,963 - 116,643,555 UniSTS Cytogenetic Map 4 D1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000070816 ⟹ ENSMUSP00000064521
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 117,783,359 - 117,786,960 (-) Ensembl GRCm38.p6 Ensembl 4 117,926,162 - 117,929,763 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000097913 ⟹ ENSMUSP00000095526
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 117,783,360 - 117,786,694 (-) Ensembl GRCm38.p6 Ensembl 4 117,926,163 - 117,929,497 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000133703
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 117,785,239 - 117,786,674 (-) Ensembl GRCm38.p6 Ensembl 4 117,928,042 - 117,929,477 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000150612
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 117,785,341 - 117,786,610 (-) Ensembl GRCm38.p6 Ensembl 4 117,928,144 - 117,929,413 (-) Ensembl
RefSeq Acc Id:
NM_001284191 ⟹ NP_001271120
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 117,783,357 - 117,786,960 (-) NCBI GRCm38 4 117,926,160 - 117,929,763 (-) NCBI Celera 4 116,641,830 - 116,645,434 (-) NCBI
Sequence:
CTTTGCTTGACTACCAACTTCGAATTCCCAGTTTCAGCGTCTCGCTGCAGCCCGCGATCTCTACTCTGCCTCCTGGGGTCTTCTCCAAATGTCTAGCCCCCACCTAGAGGGACCTAGCCTAGCCAGCG
hide sequence
RefSeq Acc Id:
NM_001284192 ⟹ NP_001271121
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 117,783,357 - 117,786,960 (-) NCBI GRCm38 4 117,926,160 - 117,929,763 (-) NCBI Celera 4 116,641,830 - 116,645,434 (-) NCBI
Sequence:
CTTTGCTTGACTACCAACTTCGAATTCCCAGTTTCAGCGTCTCGCTGCAGCCCGCGATCTCTAC
hide sequence
RefSeq Acc Id:
NM_001284193 ⟹ NP_001271122
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 117,783,357 - 117,786,960 (-) NCBI GRCm38 4 117,926,160 - 117,929,763 (-) NCBI Celera 4 116,641,830 - 116,645,434 (-) NCBI
Sequence:
CTTTGCTTGACTACCAACTTCGAATTCCCAGTTTCAGCGTCTCGCTGCAGCCCGCGATCTCTACTCTGCCTCCTGGGGTCTTCTCCAAATGTCTAGCCCCCACCTAGAGGGACCTAGCCTAGCCAGCG
hide sequence
RefSeq Acc Id:
NM_009711 ⟹ NP_033841
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 117,783,357 - 117,786,960 (-) NCBI GRCm38 4 117,926,160 - 117,929,763 (-) NCBI MGSCv37 4 117,598,767 - 117,602,368 (-) RGD Celera 4 116,641,830 - 116,645,434 (-) NCBI cM Map 4 ENTREZGENE
Sequence:
CTTTGCTTGACTACCAACTTCGAATTCCCAGTTTCAGCGTCTCGCTGCAGCCCGCGATCTCTAC
hide sequence
RefSeq Acc Id:
XM_006502690 ⟹ XP_006502753
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 117,783,105 - 117,787,988 (-) NCBI GRCm38 4 117,925,908 - 117,930,791 (-) NCBI
Sequence:
GCAGTTCAGTGCTCTTACCCACTGAGCTGTCTCTCCAGCCCCATGGGTAGTTCTTCAAGGTCCACAGAGGTGCTGGTACATGATCAGGGCACATCGGGTCCATGCACTGGGTACCCTTCCCCACTCTC
hide sequence
RefSeq Acc Id:
XM_006502691 ⟹ XP_006502754
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 117,783,105 - 117,787,988 (-) NCBI GRCm38 4 117,925,908 - 117,930,791 (-) NCBI
Sequence:
GCAGTTCAGTGCTCTTACCCACTGAGCTGTCTCTCCAGCCCCATGGGTAGTTCTTCAAGGTCCACAGAGGTGCTGGTACATGATCAGGGCACATCGGGTCCATGCACTGGGTACCCTTCCCCACTCTC
hide sequence
RefSeq Acc Id:
XM_006502692 ⟹ XP_006502755
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 117,783,105 - 117,787,988 (-) NCBI GRCm38 4 117,925,908 - 117,930,791 (-) NCBI
Sequence:
GCAGTTCAGTGCTCTTACCCACTGAGCTGTCTCTCCAGCCCCATGGGTAGTTCTTCAAGGTCCA
hide sequence
RefSeq Acc Id:
XM_006502693 ⟹ XP_006502756
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 117,783,105 - 117,787,988 (-) NCBI GRCm38 4 117,925,908 - 117,930,791 (-) NCBI
Sequence:
GCAGTTCAGTGCTCTTACCCACTGAGCTGTCTCTCCAGCCCCATGGGTAGTTCTTCAAGGTCCA
hide sequence
RefSeq Acc Id:
XM_006502694 ⟹ XP_006502757
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 117,783,105 - 117,787,993 (-) NCBI GRCm38 4 117,925,908 - 117,930,795 (-) NCBI
Sequence:
GGAGAGCAGTTCAGTGCTCTTACCCACTGAGCTGTCTCTCCAGCCCCATGGGTAGTTCTTCAAGGTCCACAGAGGTGCTGGTACATGATCAGGGCACATCGGGTCCATGCACTGGGTACCCTTCCCCA
hide sequence
RefSeq Acc Id:
XM_011240419 ⟹ XP_011238721
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 117,783,105 - 117,787,988 (-) NCBI GRCm38 4 117,925,908 - 117,930,791 (-) NCBI
Sequence:
GCAGTTCAGTGCTCTTACCCACTGAGCTGTCTCTCCAGCCCCATGGGTAGTTCTTCAAGGTCCACAGAGGTGCTGGTACATGATCAGGGCACATCGGGTCCATGCACTGGGTACCCTTCCCCACTCTC
hide sequence
RefSeq Acc Id:
XM_030253105 ⟹ XP_030108965
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 117,783,105 - 117,787,988 (-) NCBI GRCm38 4 117,925,908 - 117,930,791 (-) NCBI
Sequence:
GCAGTTCAGTGCTCTTACCCACTGAGCTGTCTCTCCAGCCCCATGGGTAGTTCTTCAAGGTCCACAGAGGTGCTGGTACATGATCAGGGCACATCGGGTCCATGCACTGGGTACCCTTCCCCACTCTC
hide sequence
RefSeq Acc Id:
NP_033841 ⟸ NM_009711
- Peptide Label:
isoform 1 preproprotein
- UniProtKB:
Q3SXF4 (UniProtKB/Swiss-Prot), Q3SXF5 (UniProtKB/Swiss-Prot), Q9Z0L2 (UniProtKB/Swiss-Prot)
- Sequence:
MELGLAEPTALSHCLRPRWQSAWWPTLAVLALLSCVTEASLDPMSRSPAARDGPSPVLAPPTDHLPGGHTAHLCSERTLRPPPQSPQPAPPPPGPALQSPPAALRGARAARAGTRSSRARTTDARGCR
hide sequence
RefSeq Acc Id:
NP_001271120 ⟸ NM_001284191
- Peptide Label:
isoform 1 preproprotein
- UniProtKB:
Q3SXF4 (UniProtKB/Swiss-Prot), Q3SXF5 (UniProtKB/Swiss-Prot), Q9Z0L2 (UniProtKB/Swiss-Prot)
- Sequence:
MELGLAEPTALSHCLRPRWQSAWWPTLAVLALLSCVTEASLDPMSRSPAARDGPSPVLAPPTDHLPGGHTAHLCSERTLRPPPQSPQPAPPPPGPALQSPPAALRGARAARAGTRSSRARTTDARGCR
hide sequence
RefSeq Acc Id:
NP_001271122 ⟸ NM_001284193
- Peptide Label:
isoform 1 preproprotein
- UniProtKB:
Q3SXF4 (UniProtKB/Swiss-Prot), Q3SXF5 (UniProtKB/Swiss-Prot), Q9Z0L2 (UniProtKB/Swiss-Prot)
- Sequence:
MELGLAEPTALSHCLRPRWQSAWWPTLAVLALLSCVTEASLDPMSRSPAARDGPSPVLAPPTDHLPGGHTAHLCSERTLRPPPQSPQPAPPPPGPALQSPPAALRGARAARAGTRSSRARTTDARGCR
hide sequence
RefSeq Acc Id:
NP_001271121 ⟸ NM_001284192
- Peptide Label:
isoform 2 precursor
- UniProtKB:
Q9Z0L2 (UniProtKB/Swiss-Prot)
- Sequence:
MELGLAEPTALSHCLRPRWQSAWWPTLAVLALLSCVTEASLDPMSRSPAARDGPSPVLAPPTDHLPGRGTHCAFVQRKNPATPASVSSARTPAAWSRAPVSSRCAPRGTRGACRNPEQPRTDHRCARL
hide sequence
RefSeq Acc Id:
XP_006502757 ⟸ XM_006502694
- Peptide Label:
isoform X2
- Sequence:
MELGLAEPTALSHCLRPRWQSAWWPTLAVLALLSCVTEASLDPMSRSPAARDGPSPVLAPPTDHLPGRGTHCAFVQRKNPATPASVSSARTPAAWSRAPVSSRCAPRGTRGACRNPEQPRTDHRCARL
hide sequence
RefSeq Acc Id:
XP_006502756 ⟸ XM_006502693
- Peptide Label:
isoform X1
- UniProtKB:
Q3SXF4 (UniProtKB/Swiss-Prot), Q3SXF5 (UniProtKB/Swiss-Prot), Q9Z0L2 (UniProtKB/Swiss-Prot)
- Sequence:
MELGLAEPTALSHCLRPRWQSAWWPTLAVLALLSCVTEASLDPMSRSPAARDGPSPVLAPPTDHLPGGHTAHLCSERTLRPPPQSPQPAPPPPGPALQSPPAALRGARAARAGTRSSRARTTDARGCR
hide sequence
RefSeq Acc Id:
XP_006502754 ⟸ XM_006502691
- Peptide Label:
isoform X1
- UniProtKB:
Q3SXF4 (UniProtKB/Swiss-Prot), Q3SXF5 (UniProtKB/Swiss-Prot), Q9Z0L2 (UniProtKB/Swiss-Prot)
- Sequence:
MELGLAEPTALSHCLRPRWQSAWWPTLAVLALLSCVTEASLDPMSRSPAARDGPSPVLAPPTDHLPGGHTAHLCSERTLRPPPQSPQPAPPPPGPALQSPPAALRGARAARAGTRSSRARTTDARGCR
hide sequence
RefSeq Acc Id:
XP_006502755 ⟸ XM_006502692
- Peptide Label:
isoform X1
- UniProtKB:
Q3SXF4 (UniProtKB/Swiss-Prot), Q3SXF5 (UniProtKB/Swiss-Prot), Q9Z0L2 (UniProtKB/Swiss-Prot)
- Sequence:
MELGLAEPTALSHCLRPRWQSAWWPTLAVLALLSCVTEASLDPMSRSPAARDGPSPVLAPPTDHLPGGHTAHLCSERTLRPPPQSPQPAPPPPGPALQSPPAALRGARAARAGTRSSRARTTDARGCR
hide sequence
RefSeq Acc Id:
XP_006502753 ⟸ XM_006502690
- Peptide Label:
isoform X1
- UniProtKB:
Q3SXF4 (UniProtKB/Swiss-Prot), Q3SXF5 (UniProtKB/Swiss-Prot), Q9Z0L2 (UniProtKB/Swiss-Prot)
- Sequence:
MELGLAEPTALSHCLRPRWQSAWWPTLAVLALLSCVTEASLDPMSRSPAARDGPSPVLAPPTDHLPGGHTAHLCSERTLRPPPQSPQPAPPPPGPALQSPPAALRGARAARAGTRSSRARTTDARGCR
hide sequence
RefSeq Acc Id:
XP_011238721 ⟸ XM_011240419
- Peptide Label:
isoform X1
- UniProtKB:
Q3SXF4 (UniProtKB/Swiss-Prot), Q3SXF5 (UniProtKB/Swiss-Prot), Q9Z0L2 (UniProtKB/Swiss-Prot)
- Sequence:
MELGLAEPTALSHCLRPRWQSAWWPTLAVLALLSCVTEASLDPMSRSPAARDGPSPVLAPPTDHLPGGHTAHLCSERTLRPPPQSPQPAPPPPGPALQSPPAALRGARAARAGTRSSRARTTDARGCR
hide sequence
RefSeq Acc Id:
XP_030108965 ⟸ XM_030253105
- Peptide Label:
isoform X1
- UniProtKB:
Q9Z0L2 (UniProtKB/Swiss-Prot), Q3SXF4 (UniProtKB/Swiss-Prot), Q3SXF5 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSMUSP00000064521 ⟸ ENSMUST00000070816
Ensembl Acc Id:
ENSMUSP00000095526 ⟸ ENSMUST00000097913
RGD ID: 6834909 Promoter ID: MM_KWN:39274 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_4Hour, Brain, MEF_B4 Transcripts: NM_009711, OTTMUST00000019625, OTTMUST00000019626, UC008UJI.1, UC008UJJ.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 117,602,016 - 117,602,702 (-) MPROMDB
RGD ID: 6884392 Promoter ID: EPDNEW_M5647 Type: multiple initiation site Name: Artn_2 Description: Mus musculus artemin , transcript variant 4, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5648 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 117,929,470 - 117,929,530 EPDNEW
RGD ID: 6884394 Promoter ID: EPDNEW_M5648 Type: initiation region Name: Artn_1 Description: Mus musculus artemin , transcript variant 4, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5647 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 117,929,734 - 117,929,794 EPDNEW
