Advanced Search (OLGA)

Gene: RGS14 (regulator of G protein signaling 14) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

RGS14

Name:

regulator of G protein signaling 14

RGD ID:

733515

HGNC Page

HGNC:9996

Description:

Enables GDP-dissociation inhibitor activity; GTPase activator activity; and microtubule binding activity. Involved in cell division and spindle organization. Located in spindle. Implicated in nephrolithiasis.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

regulator of G-protein signaling 14; regulator of G-protein signalling 14

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	177,357,924 - 177,372,596 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	177,357,924 - 177,372,596 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	176,784,925 - 176,799,597 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	176,717,450 - 176,732,205 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	176,717,449 - 176,732,204	NCBI
Celera	5	171,701,669 - 171,716,413 (-)	NCBI		Celera
Cytogenetic Map	5	q35.3	NCBI
HuRef	5	171,705,499 - 171,720,237 (+)	NCBI		HuRef
CHM1_1	5	176,217,893 - 176,232,649 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	177,901,146 - 177,915,812 (+)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RGS14	Human	nephrolithiasis		IAGP		7242927	DNA:SNP: :rs11746443 (human)	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RGS14	Human	Chromosome 5, Trisomy 5q		IAGP	RGD:155268941	8554872	ClinVar Annotator: match by term: 5q35 microduplication syndrome	ClinVar	PMID:31690835
RGS14	Human	Ehlers-Danlos syndrome dermatosparaxis type		IAGP	RGD:156439716	8554872	ClinVar Annotator: match by term: Ehlers-Danlos syndrome, dermatosparaxis type	ClinVar	PMID:16770806\|PMID:17090394\|PMID:21567906\|PMID:23599694\|PMID:23913520\|PMID:24819041\|PMID:28128410\|PMID:28492532\|PMID:33389145
RGS14	Human	Ehlers-Danlos syndrome spondylodysplastic type 2		IAGP	RGD:151795153	8554872	ClinVar Annotator: match by term: Ehlers-Danlos syndrome progeroid type	ClinVar	PMID:28492532
RGS14	Human	Marfanoid Mental Retardation Syndrome, Autosomal		IAGP	RGD:14977181	8554872	ClinVar Annotator: match by term: Marfanoid habitus and intellectual disability	ClinVar	PMID:25741868
RGS14	Human	Silver-Russell syndrome		IAGP	RGD:407572889	8554872	ClinVar Annotator: match by term: Russell-Silver syndrome	ClinVar	PMID:27172843
RGS14	Human	Sotos syndrome		IAGP	RGD:156438171	8554872	ClinVar Annotator: match by term: Sotos syndrome	ClinVar	PMID:12464997\|PMID:14571271\|PMID:15942875\|PMID:16247291\|PMID:18505455\|PMID:21597970\|PMID:25608832\|PMID:26047794\|PMID:28492532
RGS14	Human	Sotos syndrome		IAGP	RGD:156439716	8554872	ClinVar Annotator: match by term: Sotos syndrome	ClinVar	PMID:16770806\|PMID:17090394\|PMID:21567906\|PMID:23599694\|PMID:23913520\|PMID:24819041\|PMID:28128410\|PMID:28492532\|PMID:33389145
RGS14	Human	Sotos syndrome		IAGP	RGD:156441441	8554872	ClinVar Annotator: match by term: Sotos syndrome	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RGS14	Human	1,2-dimethylhydrazine	increases expression	ISO	RGD:733516	6480464	1,2-Dimethylhydrazine results in increased expression of RGS14 mRNA	CTD	PMID:22206623
RGS14	Human	17beta-estradiol	multiple interactions	ISO	RGD:620003	6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of RGS14 mRNA	CTD	PMID:32741896
RGS14	Human	17beta-estradiol 3-benzoate	multiple interactions	ISO	RGD:620003	6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of RGS14 mRNA	CTD	PMID:32741896
RGS14	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:620003	6480464	Tetrachlorodibenzodioxin results in increased expression of RGS14 mRNA	CTD	PMID:33387578
RGS14	Human	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	RGD:733516	6480464	tetrabromobisphenol A results in decreased expression of RGS14 mRNA	CTD	PMID:25172293
RGS14	Human	4,4'-diaminodiphenylmethane	decreases expression	ISO	RGD:733516	6480464	4,4'-diaminodiphenylmethane results in decreased expression of RGS14 mRNA	CTD	PMID:18648102
RGS14	Human	4,4'-sulfonyldiphenol	decreases methylation	ISO	RGD:733516	6480464	bisphenol S results in decreased methylation of RGS14 exon	CTD	PMID:33297965
RGS14	Human	4,4'-sulfonyldiphenol	multiple interactions	ISO	RGD:620003	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
RGS14	Human	6-propyl-2-thiouracil	increases expression	ISO	RGD:620003	6480464	Propylthiouracil results in increased expression of RGS14 mRNA	CTD	PMID:24780913
RGS14	Human	acetamide	increases expression	ISO	RGD:620003	6480464	acetamide results in increased expression of RGS14 mRNA	CTD	PMID:31881176
RGS14	Human	alpha-Zearalanol	increases expression	ISO	RGD:620003	6480464	Zeranol results in increased expression of RGS14 mRNA	CTD	PMID:35163327
RGS14	Human	amitrole	decreases expression	ISO	RGD:620003	6480464	Amitrole results in decreased expression of RGS14 mRNA	CTD	PMID:38685447
RGS14	Human	ammonium chloride	affects expression	ISO	RGD:620003	6480464	Ammonium Chloride affects the expression of RGS14 mRNA	CTD	PMID:16483693
RGS14	Human	arsenite(3-)	increases expression	ISO	RGD:733516	6480464	arsenite results in increased expression of RGS14 mRNA	CTD	PMID:33053406
RGS14	Human	atrazine	increases expression	EXP		6480464	Atrazine results in increased expression of RGS14 mRNA	CTD	PMID:22378314
RGS14	Human	benzo[a]pyrene	affects methylation	EXP		6480464	Benzo(a)pyrene affects the methylation of RGS14 5' UTR; Benzo(a)pyrene affects the methylation of RGS14 promoter	CTD	PMID:27901495
RGS14	Human	benzo[a]pyrene	decreases expression	EXP		6480464	Benzo(a)pyrene results in decreased expression of RGS14 mRNA	CTD	PMID:32234424
RGS14	Human	bisphenol A	decreases expression	ISO	RGD:620003	6480464	bisphenol A results in decreased expression of RGS14 mRNA	CTD	PMID:25181051\|PMID:30816183\|PMID:32528016\|PMID:34947998
RGS14	Human	bisphenol A	multiple interactions	ISO	RGD:620003	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
RGS14	Human	bisphenol A	increases expression	ISO	RGD:733516	6480464	bisphenol A results in increased expression of RGS14 mRNA	CTD	PMID:38701888
RGS14	Human	bisphenol F	multiple interactions	ISO	RGD:620003	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
RGS14	Human	buta-1,3-diene	decreases expression	ISO	RGD:733516	6480464	1,3-butadiene results in decreased expression of RGS14 mRNA	CTD	PMID:29038090
RGS14	Human	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of RGS14 mRNA	CTD	PMID:38382870
RGS14	Human	caffeine	decreases phosphorylation	EXP		6480464	Caffeine results in decreased phosphorylation of RGS14 protein	CTD	PMID:35688186
RGS14	Human	choline	multiple interactions	ISO	RGD:733516	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
RGS14	Human	chromium(6+)	affects expression	ISO	RGD:733516	6480464	chromium hexavalent ion affects the expression of RGS14 mRNA	CTD	PMID:28472532
RGS14	Human	cisplatin	multiple interactions	EXP		6480464	[Cisplatin co-treated with jinfukang] results in increased expression of RGS14 mRNA	CTD	PMID:27392435
RGS14	Human	dioxygen	multiple interactions	ISO	RGD:620003	6480464	[Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression more ...	CTD	PMID:33729688
RGS14	Human	ethanol	affects splicing	ISO	RGD:733516	6480464	Ethanol affects the splicing of RGS14 mRNA	CTD	PMID:30319688
RGS14	Human	folic acid	multiple interactions	ISO	RGD:733516	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
RGS14	Human	FR900359	decreases phosphorylation	EXP		6480464	FR900359 results in decreased phosphorylation of RGS14 protein	CTD	PMID:37730182
RGS14	Human	L-methionine	multiple interactions	ISO	RGD:733516	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
RGS14	Human	lipopolysaccharide	multiple interactions	EXP		6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of RGS14 mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
RGS14	Human	lipopolysaccharide	decreases expression	EXP		6480464	Lipopolysaccharides results in decreased expression of RGS14 mRNA	CTD	PMID:35811015
RGS14	Human	methyl methanesulfonate	decreases expression	EXP		6480464	Methyl Methanesulfonate results in decreased expression of RGS14 mRNA	CTD	PMID:23649840
RGS14	Human	niclosamide	increases expression	EXP		6480464	Niclosamide results in increased expression of RGS14 mRNA	CTD	PMID:36318118
RGS14	Human	ozone	multiple interactions	ISO	RGD:733516	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ...	CTD	PMID:34911549
RGS14	Human	ozone	multiple interactions	EXP		6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of RGS14 mRNA	CTD	PMID:35430440
RGS14	Human	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of RGS14 mRNA	CTD	PMID:21420995\|PMID:22230336\|PMID:29067470
RGS14	Human	paracetamol	decreases expression	ISO	RGD:620003	6480464	Acetaminophen results in decreased expression of RGS14 mRNA	CTD	PMID:33387578
RGS14	Human	pirinixic acid	multiple interactions	EXP		6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ...	CTD	PMID:19710929
RGS14	Human	pirinixic acid	decreases expression	ISO	RGD:733516	6480464	pirinixic acid results in decreased expression of RGS14 mRNA	CTD	PMID:17426115
RGS14	Human	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	EXP		6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of RGS14 mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
RGS14	Human	testosterone	multiple interactions	ISO	RGD:620003	6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of RGS14 mRNA	CTD	PMID:32741896
RGS14	Human	thioacetamide	increases expression	ISO	RGD:620003	6480464	Thioacetamide results in increased expression of RGS14 mRNA	CTD	PMID:34492290
RGS14	Human	titanium dioxide	increases expression	ISO	RGD:733516	6480464	titanium dioxide results in increased expression of RGS14 mRNA	CTD	PMID:23557971
RGS14	Human	Tributyltin oxide	decreases expression	ISO	RGD:733516	6480464	bis(tri-n-butyltin)oxide results in decreased expression of RGS14 mRNA	CTD	PMID:18958704
RGS14	Human	trichloroethene	increases expression	ISO	RGD:620003	6480464	Trichloroethylene results in increased expression of RGS14 mRNA	CTD	PMID:33387578
RGS14	Human	triphenyl phosphate	affects expression	EXP		6480464	triphenyl phosphate affects the expression of RGS14 mRNA	CTD	PMID:37042841
RGS14	Human	urethane	decreases expression	EXP		6480464	Urethane results in decreased expression of RGS14 mRNA	CTD	PMID:28818685
RGS14	Human	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of RGS14 mRNA	CTD	PMID:25979313
RGS14	Human	zoledronic acid	increases expression	EXP		6480464	zoledronic acid results in increased expression of RGS14 mRNA	CTD	PMID:20977926

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RGS14	Human	cell division	involved_in	IMP		150520179	PMID:17635935	UniProt	PMID:17635935
RGS14	Human	cell division	involved_in	IEA	UniProtKB-KW:KW-0132	150520179		UniProt	GO_REF:0000043
RGS14	Human	cell division	involved_in	IBA	MGI:1859709\|PANTHER:PTN002914935\|UniProtKB:O43566	150520179		GO_Central	GO_REF:0000033
RGS14	Human	chromosome segregation	involved_in	IEA	UniProtKB:P97492\|ensembl:ENSMUSP00000068731	150520179		Ensembl	GO_REF:0000107
RGS14	Human	chromosome segregation	involved_in	ISS	UniProtKB:P97492	150520179		UniProt	GO_REF:0000024
RGS14	Human	G protein-coupled receptor signaling pathway	involved_in	TAS		150520179		Reactome	Reactome:R-HSA-388396
RGS14	Human	learning	involved_in	ISS	UniProtKB:P97492	150520179		UniProt	GO_REF:0000024
RGS14	Human	learning	involved_in	IEA	UniProtKB:P97492\|ensembl:ENSMUSP00000068731	150520179		Ensembl	GO_REF:0000107
RGS14	Human	long-term memory	involved_in	ISS	UniProtKB:P97492	150520179		UniProt	GO_REF:0000024
RGS14	Human	long-term memory	involved_in	IEA	UniProtKB:P97492\|ensembl:ENSMUSP00000068731	150520179		Ensembl	GO_REF:0000107
RGS14	Human	long-term synaptic potentiation	involved_in	ISS	UniProtKB:P97492	150520179		UniProt	GO_REF:0000024
RGS14	Human	long-term synaptic potentiation	involved_in	IEA	UniProtKB:P97492\|ensembl:ENSMUSP00000068731	150520179		Ensembl	GO_REF:0000107
RGS14	Human	mitotic cell cycle	acts_upstream_of_or_within	IEA	UniProtKB:P97492\|ensembl:ENSMUSP00000068731	150520179		Ensembl	GO_REF:0000107
RGS14	Human	modulation of chemical synaptic transmission	involved_in	IEA	UniProtKB:P97492\|ensembl:ENSMUSP00000068731	150520179		Ensembl	GO_REF:0000107
RGS14	Human	negative regulation of ERK1 and ERK2 cascade	involved_in	IEA	UniProtKB:O08773\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	negative regulation of ERK1 and ERK2 cascade	involved_in	ISS	UniProtKB:O08773	150520179		UniProt	GO_REF:0000024
RGS14	Human	negative regulation of G protein-coupled receptor signaling pathway	involved_in	ISS	UniProtKB:P97492	150520179		UniProt	GO_REF:0000024
RGS14	Human	negative regulation of G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB:P97492\|ensembl:ENSMUSP00000068731	150520179		Ensembl	GO_REF:0000107
RGS14	Human	negative regulation of MAP kinase activity	involved_in	ISS	UniProtKB:P97492	150520179		UniProt	GO_REF:0000024
RGS14	Human	negative regulation of signal transduction	involved_in	IEA	UniProtKB-KW:KW-0734	150520179		UniProt	GO_REF:0000043
RGS14	Human	negative regulation of synaptic plasticity	involved_in	IEA	UniProtKB:P97492\|ensembl:ENSMUSP00000068731	150520179		Ensembl	GO_REF:0000107
RGS14	Human	negative regulation of synaptic plasticity	involved_in	ISS	UniProtKB:P97492	150520179		UniProt	GO_REF:0000024
RGS14	Human	nucleocytoplasmic transport	involved_in	ISS	UniProtKB:O08773\|UniProtKB:P97492	150520179		UniProt	GO_REF:0000024
RGS14	Human	nucleocytoplasmic transport	involved_in	IEA	UniProtKB:O08773\|UniProtKB:P97492\|ensembl:ENSMUSP00000068731\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	platelet-derived growth factor receptor signaling pathway	involved_in	ISS	UniProtKB:O08773	150520179		UniProt	GO_REF:0000024
RGS14	Human	platelet-derived growth factor receptor signaling pathway	involved_in	IEA	UniProtKB:O08773\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	positive regulation of GTPase activity	involved_in	ISO	RGD:733516	9068941	PMID:10926822	UniProt	PMID:10926822
RGS14	Human	positive regulation of neurogenesis	involved_in	IEA	UniProtKB:O08773\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	positive regulation of neurogenesis	involved_in	ISS	UniProtKB:O08773	150520179		UniProt	GO_REF:0000024
RGS14	Human	regulation of G protein-coupled receptor signaling pathway		ISO	RGD:620003	9068941		RGD	PMID:11976690\|REF_RGD_ID:729762
RGS14	Human	regulation of G protein-coupled receptor signaling pathway	involved_in	IBA	FB:FBgn0020278\|MGI:1859709\|PANTHER:PTN000851567\|RGD:3564\|RGD:620003	150520179		GO_Central	GO_REF:0000033
RGS14	Human	regulation of G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR037881	150520179		InterPro	GO_REF:0000002
RGS14	Human	regulation of G protein-coupled receptor signaling pathway	involved_in	TAS		150520179	PMID:9168931	PINC	PMID:9168931
RGS14	Human	regulation of G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB:O08773\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	response to oxidative stress	involved_in	IEA	UniProtKB:O08773\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	response to oxidative stress	involved_in	ISS	UniProtKB:O08773	150520179		UniProt	GO_REF:0000024
RGS14	Human	signal transduction	involved_in	IEA	InterPro:IPR003116	150520179		InterPro	GO_REF:0000002
RGS14	Human	spindle organization	involved_in	IMP		150520179	PMID:15917656	UniProt	PMID:15917656
RGS14	Human	spindle organization	involved_in	IEA	UniProtKB:P97492\|ensembl:ENSMUSP00000068731	150520179		Ensembl	GO_REF:0000107
RGS14	Human	spindle organization	involved_in	IBA	MGI:1859709\|PANTHER:PTN002914935\|UniProtKB:O43566	150520179		GO_Central	GO_REF:0000033
RGS14	Human	visual learning	involved_in	IEA	UniProtKB:O08773\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	visual learning	involved_in	ISS	UniProtKB:O08773	150520179		UniProt	GO_REF:0000024
RGS14	Human	zygote asymmetric cell division	involved_in	IEA	UniProtKB:P97492\|ensembl:ENSMUSP00000068731	150520179		Ensembl	GO_REF:0000107
RGS14	Human	zygote asymmetric cell division	involved_in	ISS	UniProtKB:P97492	150520179		UniProt	GO_REF:0000024

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RGS14	Human	cell projection	located_in	IEA	UniProtKB-KW:KW-0966	150520179		UniProt	GO_REF:0000043
RGS14	Human	centrosome	located_in	IEA	UniProtKB-SubCell:SL-0048	150520179		UniProt	GO_REF:0000044
RGS14	Human	centrosome	located_in	IEA	UniProtKB:O08773\|UniProtKB:P97492\|ensembl:ENSMUSP00000068731\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	centrosome	located_in	ISS	UniProtKB:O08773\|UniProtKB:P97492	150520179		UniProt	GO_REF:0000024
RGS14	Human	cytoplasm	located_in	ISS	UniProtKB:O08773\|UniProtKB:P97492	150520179		UniProt	GO_REF:0000024
RGS14	Human	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	150520179		UniProt	GO_REF:0000044
RGS14	Human	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	150520179		UniProt	GO_REF:0000043
RGS14	Human	cytoplasm	located_in	IEA	UniProtKB:O08773\|UniProtKB:P97492\|ensembl:ENSMUSP00000068731\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	cytoplasm	is_active_in	IBA	FB:FBgn0020278\|MGI:1859709\|PANTHER:PTN000851567\|RGD:3564\|RGD:620003\|UniProtKB:O14924	150520179		GO_Central	GO_REF:0000033
RGS14	Human	cytoskeleton	located_in	IEA	UniProtKB-KW:KW-0206	150520179		UniProt	GO_REF:0000043
RGS14	Human	dendrite		ISO	RGD:620003	9068941		RGD	PMID:16819986\|REF_RGD_ID:7207381
RGS14	Human	dendrite	located_in	ISS	UniProtKB:P97492	150520179		UniProt	GO_REF:0000024
RGS14	Human	dendrite	located_in	IEA	UniProtKB-SubCell:SL-0283	150520179		UniProt	GO_REF:0000044
RGS14	Human	dendrite	located_in	IEA	UniProtKB:O08773\|UniProtKB:P97492\|ensembl:ENSMUSP00000068731\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	dendritic spine	located_in	IEA	UniProtKB:P97492\|ensembl:ENSMUSP00000068731	150520179		Ensembl	GO_REF:0000107
RGS14	Human	dendritic spine	located_in	ISS	UniProtKB:P97492	150520179		UniProt	GO_REF:0000024
RGS14	Human	dendritic spine	located_in	IEA	UniProtKB-SubCell:SL-0284	150520179		UniProt	GO_REF:0000044
RGS14	Human	glutamatergic synapse	is_active_in	IEA	UniProtKB:P97492\|ensembl:ENSMUSP00000068731	150520179		Ensembl	GO_REF:0000107
RGS14	Human	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	150520179		UniProt	GO_REF:0000044
RGS14	Human	membrane	located_in	IEA	UniProtKB-KW:KW-0472	150520179		UniProt	GO_REF:0000043
RGS14	Human	microtubule	located_in	IEA	UniProtKB-KW:KW-0493	150520179		UniProt	GO_REF:0000043
RGS14	Human	nuclear body	located_in	ISS	UniProtKB:P97492	150520179		UniProt	GO_REF:0000024
RGS14	Human	nuclear body	located_in	IEA	UniProtKB:P97492\|ensembl:ENSMUSP00000068731	150520179		Ensembl	GO_REF:0000107
RGS14	Human	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	150520179		UniProt	GO_REF:0000043
RGS14	Human	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	150520179		UniProt	GO_REF:0000044
RGS14	Human	nucleus	located_in	ISS	UniProtKB:O08773\|UniProtKB:P97492	150520179		UniProt	GO_REF:0000024
RGS14	Human	nucleus	located_in	IEA	UniProtKB:O08773\|UniProtKB:P97492\|ensembl:ENSMUSP00000068731\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	nucleus	is_active_in	IBA	MGI:1859709\|PANTHER:PTN000851567\|RGD:3564\|RGD:620003\|UniProtKB:O14924	150520179		GO_Central	GO_REF:0000033
RGS14	Human	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	150520179		UniProt	GO_REF:0000043
RGS14	Human	plasma membrane	is_active_in	IBA	FB:FBgn0020278\|MGI:1859709\|PANTHER:PTN000851567\|RGD:620003	150520179		GO_Central	GO_REF:0000033
RGS14	Human	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	150520179		UniProt	GO_REF:0000044
RGS14	Human	plasma membrane	located_in	IEA	UniProtKB:O08773\|UniProtKB:P97492\|ensembl:ENSMUSP00000068731\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	plasma membrane	located_in	TAS		150520179		Reactome	Reactome:R-HSA-8982012\|Reactome:R-HSA-8982019\|Reactome:R-HSA-8982020
RGS14	Human	plasma membrane	located_in	ISS	UniProtKB:O08773\|UniProtKB:P97492	150520179		UniProt	GO_REF:0000024
RGS14	Human	PML body	located_in	IEA	UniProtKB-SubCell:SL-0465	150520179		UniProt	GO_REF:0000044
RGS14	Human	postsynaptic density	located_in	ISS	UniProtKB:P97492	150520179		UniProt	GO_REF:0000024
RGS14	Human	postsynaptic density	located_in	IEA	UniProtKB:P97492\|ensembl:ENSMUSP00000068731	150520179		Ensembl	GO_REF:0000107
RGS14	Human	postsynaptic density	located_in	IEA	UniProtKB-SubCell:SL-0297	150520179		UniProt	GO_REF:0000044
RGS14	Human	postsynaptic density	is_active_in	ISO	RGD:733516	9068941	PMID:20837545	SynGO	PMID:20837545
RGS14	Human	spindle	located_in	IEA	UniProtKB:P97492\|ensembl:ENSMUSP00000068731	150520179		Ensembl	GO_REF:0000107
RGS14	Human	spindle	located_in	IDA		150520179	PMID:15917656	UniProt	PMID:15917656
RGS14	Human	spindle	located_in	IEA	UniProtKB-SubCell:SL-0251	150520179		UniProt	GO_REF:0000044
RGS14	Human	spindle pole	located_in	IEA	UniProtKB-SubCell:SL-0448	150520179		UniProt	GO_REF:0000044
RGS14	Human	spindle pole	located_in	IEA	UniProtKB:O08773\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	spindle pole	located_in	ISS	UniProtKB:O08773	150520179		UniProt	GO_REF:0000024
RGS14	Human	synapse	located_in	IEA	UniProtKB-KW:KW-0770	150520179		UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RGS14	Human	G-protein alpha-subunit binding		ISO	RGD:2714	9068941		RGD	PMID:11387333\|REF_RGD_ID:7207387
RGS14	Human	G-protein alpha-subunit binding	enables	IEA	InterPro:IPR037881	150520179		InterPro	GO_REF:0000002
RGS14	Human	G-protein alpha-subunit binding	enables	IEA	UniProtKB:O08773\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	GDP-dissociation inhibitor activity	enables	IDA		150520179	PMID:15917656	UniProt	PMID:15917656
RGS14	Human	GDP-dissociation inhibitor activity	enables	IEA	UniProtKB:O08773\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	GTPase activating protein binding	enables	IEA	UniProtKB:P97492\|ensembl:ENSMUSP00000068731	150520179		Ensembl	GO_REF:0000107
RGS14	Human	GTPase activator activity	enables	IDA		150520179	PMID:15917656	UniProt	PMID:15917656
RGS14	Human	GTPase activator activity	enables	IBA	FB:FBgn0020278\|MGI:1859709\|PANTHER:PTN000851567\|RGD:3564\|RGD:620003\|UniProtKB:O43566	150520179		GO_Central	GO_REF:0000033
RGS14	Human	GTPase activator activity	enables	IEA	InterPro:IPR046995	150520179		InterPro	GO_REF:0000002
RGS14	Human	GTPase activator activity	enables	TAS		150520179	PMID:9168931	PINC	PMID:9168931
RGS14	Human	GTPase activator activity	enables	IEA	UniProtKB:O08773\|UniProtKB:P97492\|ensembl:ENSMUSP00000068731\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	GTPase activator activity	enables	IEA	UniProtKB-KW:KW-0343	150520179		UniProt	GO_REF:0000043
RGS14	Human	GTPase activity	enables	TAS		150520179		Reactome	Reactome:R-HSA-8982020
RGS14	Human	GTPase regulator activity	enables	IEA	ARBA:ARBA00026642	150520179		UniProt	GO_REF:0000117
RGS14	Human	GTPase regulator activity	enables	IEA	InterPro:IPR003109	150520179		InterPro	GO_REF:0000002
RGS14	Human	microtubule binding	enables	IDA		150520179	PMID:15917656	UniProt	PMID:15917656
RGS14	Human	microtubule binding	enables	IEA	InterPro:IPR037881	150520179		InterPro	GO_REF:0000002
RGS14	Human	protein binding	enables	IPI	UniProtKB:P08754	150520179	PMID:32296183	IntAct	PMID:32296183
RGS14	Human	protein binding	enables	IPI	UniProtKB:Q9BSI4	150520179	PMID:21044950	IntAct	PMID:21044950
RGS14	Human	protein binding	enables	IPI	UniProtKB:P08754\|UniProtKB:P63096	150520179	PMID:21988832, PMID:33961781	IntAct	PMID:21988832\|PMID:33961781
RGS14	Human	protein kinase binding	enables	IEA	UniProtKB:O08773\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107
RGS14	Human	signaling receptor complex adaptor activity	enables	ISS	UniProtKB:O08773	150520179		UniProt	GO_REF:0000024
RGS14	Human	signaling receptor complex adaptor activity	enables	IEA	UniProtKB:O08773\|ensembl:ENSRNOP00000021596	150520179		Ensembl	GO_REF:0000107

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RGS14	Human	Decreased glomerular filtration rate		IAGP		7242927	DNA:SNP: :rs11746443	RGD

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	A genome-wide association study of nephrolithiasis in the Japanese population identifies novel susceptible Loci at 5q35.3, 7p14.3, and 13q14.1.	Urabe Y, etal., PLoS Genet. 2012;8(3):e1002541. doi: 10.1371/journal.pgen.1002541. Epub 2012 Mar 1.

PMID:9168931	PMID:10926822	PMID:10953050	PMID:11387333	PMID:11829488	PMID:11976690	PMID:12477932	PMID:12534294	PMID:14702039	PMID:15489334	PMID:15525537	PMID:15917656
PMID:16189514	PMID:17603074	PMID:17635935	PMID:18029348	PMID:19636837	PMID:19878719	PMID:19899154	PMID:20383146	PMID:20627871	PMID:20842066	PMID:21044950	PMID:21832049
PMID:21833088	PMID:21873635	PMID:21880739	PMID:21988832	PMID:22379092	PMID:22703881	PMID:22797727	PMID:22807448	PMID:23128233	PMID:23255434	PMID:24068962	PMID:26186194
PMID:26987813	PMID:28298427	PMID:28514442	PMID:28776200	PMID:30217807	PMID:30945288	PMID:31754202	PMID:32296183	PMID:32665550	PMID:33309307	PMID:33410399	PMID:33961781
PMID:35013429	PMID:35307350	PMID:35575683	PMID:36541898	PMID:37071682	PMID:38237897	PMID:39293332

RGS14
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	177,357,924 - 177,372,596 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	177,357,924 - 177,372,596 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	176,784,925 - 176,799,597 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	176,717,450 - 176,732,205 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	176,717,449 - 176,732,204	NCBI
Celera	5	171,701,669 - 171,716,413 (-)	NCBI		Celera
Cytogenetic Map	5	q35.3	NCBI
HuRef	5	171,705,499 - 171,720,237 (+)	NCBI		HuRef
CHM1_1	5	176,217,893 - 176,232,649 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	177,901,146 - 177,915,812 (+)	NCBI		T2T-CHM13v2.0

Rgs14
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	55,517,269 - 55,532,504 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	55,517,545 - 55,532,500 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	55,369,732 - 55,384,687 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	55,369,732 - 55,384,687 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	55,471,093 - 55,486,048 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	54,849,935 - 54,864,851 (+)	NCBI		MGSCv36	mm8
MGSCv36	13	55,379,393 - 55,394,309 (+)	NCBI		MGSCv36	mm8
Cytogenetic Map	13	B1	NCBI
cM Map	13	29.8	NCBI

Rgs14
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	9,254,112 - 9,268,233 (-)	NCBI		GRCr8
mRatBN7.2	17	9,248,982 - 9,263,104 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	9,249,019 - 9,263,104 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	9,265,278 - 9,279,405 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	10,795,224 - 10,809,305 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	9,261,669 - 9,275,796 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	9,777,925 - 9,792,007 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	9,777,842 - 9,792,007 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	11,887,270 - 11,901,352 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	15,293,100 - 15,307,162 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	15,293,099 - 15,307,162 (-)	NCBI
Celera	17	9,327,534 - 9,341,623 (-)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

Rgs14
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	29,602,820 - 29,616,210 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	29,602,654 - 29,616,793 (+)	NCBI	ChiLan1.0	ChiLan1.0

RGS14
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	172,441,892 - 172,456,648 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	170,581,431 - 170,596,187 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	172,659,323 - 172,674,084 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	179,721,876 - 179,736,608 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	179,721,876 - 179,739,453 (+)	Ensembl	panpan1.1		panPan2

RGS14
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	35,984,970 - 35,999,386 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	35,985,132 - 35,999,294 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	35,952,393 - 35,966,792 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	36,351,200 - 36,365,605 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	36,310,038 - 36,365,601 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	36,176,431 - 36,190,828 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	36,362,626 - 36,377,029 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	36,871,876 - 36,886,282 (-)	NCBI		UU_Cfam_GSD_1.0

Rgs14
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	122,617,771 - 122,633,949 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936597	1,643,616 - 1,658,638 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936597	1,650,480 - 1,658,823 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RGS14
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	80,574,415 - 80,590,003 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	80,574,411 - 80,589,998 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	82,278,839 - 82,294,432 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RGS14
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	79,370,320 - 79,385,355 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	79,370,087 - 79,387,192 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666075	10,559,155 - 10,573,950 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rgs14
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	12,707,825 - 12,723,279 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	12,705,392 - 12,722,919 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in RGS14
57 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 5q35.2-35.3(chr5:176132340-177586960)x1	copy number loss	See cases [RCV000050645]	Chr5:176132340..177586960 [GRCh38] Chr5:175559343..177013961 [GRCh37] Chr5:175491949..176946567 [NCBI36] Chr5:5q35.2-35.3	pathogenic
GRCh38/hg38 5q32-35.3(chr5:149714592-181272151)x3	copy number gain	See cases [RCV000051863]	Chr5:149714592..181272151 [GRCh38] Chr5:149094155..180699152 [GRCh37] Chr5:149074348..180631758 [NCBI36] Chr5:5q32-35.3	pathogenic
GRCh38/hg38 5q33.3-35.3(chr5:160029980-181269805)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051865]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051865]\|See cases [RCV000051865]	Chr5:160029980..181269805 [GRCh38] Chr5:159456987..180696806 [GRCh37] Chr5:159389565..180629412 [NCBI36] Chr5:5q33.3-35.3	pathogenic
GRCh38/hg38 5q34-35.3(chr5:168689326-181269946)x3	copy number gain	See cases [RCV000051866]	Chr5:168689326..181269946 [GRCh38] Chr5:168116331..180696947 [GRCh37] Chr5:168048909..180629553 [NCBI36] Chr5:5q34-35.3	pathogenic
GRCh38/hg38 5q35.2-35.3(chr5:175851047-178365049)x3	copy number gain	See cases [RCV000051867]	Chr5:175851047..178365049 [GRCh38] Chr5:175278050..177792050 [GRCh37] Chr5:175210656..177724656 [NCBI36] Chr5:5q35.2-35.3	pathogenic
GRCh38/hg38 5q35.2-35.3(chr5:175889986-180793986)x3	copy number gain	See cases [RCV000051868]	Chr5:175889986..180793986 [GRCh38] Chr5:175316989..180220986 [GRCh37] Chr5:175249595..180153592 [NCBI36] Chr5:5q35.2-35.3	pathogenic
GRCh38/hg38 5q35.2-35.3(chr5:175007241-179089812)x1	copy number loss	See cases [RCV000052151]	Chr5:175007241..179089812 [GRCh38] Chr5:174434244..178516813 [GRCh37] Chr5:174366850..178449419 [NCBI36] Chr5:5q35.2-35.3	pathogenic
GRCh38/hg38 5q35.2-35.3(chr5:176043476-177995759)x1	copy number loss	See cases [RCV000053127]	Chr5:176043476..177995759 [GRCh38] Chr5:175470479..177422760 [GRCh37] Chr5:175403085..177355366 [NCBI36] Chr5:5q35.2-35.3	pathogenic
GRCh38/hg38 5q35.2-35.3(chr5:176115257-177646633)x1	copy number loss	See cases [RCV000053128]	Chr5:176115257..177646633 [GRCh38] Chr5:175542260..177073634 [GRCh37] Chr5:175474866..177006240 [NCBI36] Chr5:5q35.2-35.3	pathogenic
GRCh38/hg38 5q35.2-35.3(chr5:176152073-177986213)x1	copy number loss	See cases [RCV000053129]	Chr5:176152073..177986213 [GRCh38] Chr5:175579076..177413214 [GRCh37] Chr5:175511682..177345820 [NCBI36] Chr5:5q35.2-35.3	pathogenic
GRCh38/hg38 5q35.2-35.3(chr5:176152073-177646633)x1	copy number loss	See cases [RCV000053131]	Chr5:176152073..177646633 [GRCh38] Chr5:175579076..177073634 [GRCh37] Chr5:175511682..177006240 [NCBI36] Chr5:5q35.2-35.3	pathogenic
GRCh38/hg38 5q35.2-35.3(chr5:176149599-177716401)x3	copy number gain	See cases [RCV000053481]	Chr5:176149599..177716401 [GRCh38] Chr5:175576602..177143402 [GRCh37] Chr5:175509208..177076008 [NCBI36] Chr5:5q35.2-35.3	pathogenic\|uncertain significance
GRCh38/hg38 5q35.2-35.3(chr5:176043476-177452489)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053860]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053860]\|See cases [RCV000053860]	Chr5:176043476..177452489 [GRCh38] Chr5:175470479..176879490 [GRCh37] Chr5:175403085..176812096 [NCBI36] Chr5:5q35.2-35.3	pathogenic\|uncertain significance
GRCh38/hg38 5q33.3-35.3(chr5:156825512-181269805)x3	copy number gain	See cases [RCV000133847]	Chr5:156825512..181269805 [GRCh38] Chr5:156252523..180696806 [GRCh37] Chr5:156185101..180629412 [NCBI36] Chr5:5q33.3-35.3	pathogenic
GRCh38/hg38 5q34-35.3(chr5:164386701-181269805)x3	copy number gain	See cases [RCV000135546]	Chr5:164386701..181269805 [GRCh38] Chr5:163813707..180696806 [GRCh37] Chr5:163746285..180629412 [NCBI36] Chr5:5q34-35.3	pathogenic
GRCh38/hg38 5q35.3(chr5:177261458-177651722)x3	copy number gain	See cases [RCV000138817]	Chr5:177261458..177651722 [GRCh38] Chr5:176688459..177078723 [GRCh37] Chr5:176621065..177011329 [NCBI36] Chr5:5q35.3	likely benign\|uncertain significance
GRCh38/hg38 5q35.3(chr5:177118445-177374609)x3	copy number gain	See cases [RCV000141324]	Chr5:177118445..177374609 [GRCh38] Chr5:176545446..176801610 [GRCh37] Chr5:176478052..176734216 [NCBI36] Chr5:5q35.3	likely pathogenic
GRCh38/hg38 5q35.1-35.3(chr5:169334755-181285301)x3	copy number gain	See cases [RCV000141249]	Chr5:169334755..181285301 [GRCh38] Chr5:168761759..180712302 [GRCh37] Chr5:168694337..180644908 [NCBI36] Chr5:5q35.1-35.3	pathogenic
GRCh38/hg38 5q35.2-35.3(chr5:175536771-181292788)x1	copy number loss	See cases [RCV000141987]	Chr5:175536771..181292788 [GRCh38] Chr5:174963774..180719789 [GRCh37] Chr5:174896380..180652395 [NCBI36] Chr5:5q35.2-35.3	pathogenic
GRCh38/hg38 5q35.2-35.3(chr5:175989092-178009412)x1	copy number loss	See cases [RCV000142365]	Chr5:175989092..178009412 [GRCh38] Chr5:175416095..177436413 [GRCh37] Chr5:175348701..177369019 [NCBI36] Chr5:5q35.2-35.3	pathogenic
GRCh38/hg38 5q35.2-35.3(chr5:176132340-177995759)x1	copy number loss	See cases [RCV000142510]	Chr5:176132340..177995759 [GRCh38] Chr5:175559343..177422760 [GRCh37] Chr5:175491949..177355366 [NCBI36] Chr5:5q35.2-35.3	pathogenic
GRCh38/hg38 5q35.2-35.3(chr5:176291838-178662699)x1	copy number loss	See cases [RCV000142047]	Chr5:176291838..178662699 [GRCh38] Chr5:175718841..178089700 [GRCh37] Chr5:175651447..178022306 [NCBI36] Chr5:5q35.2-35.3	pathogenic
GRCh38/hg38 5q35.2-35.3(chr5:176700128-181269805)x1	copy number loss	See cases [RCV000142648]	Chr5:176700128..181269805 [GRCh38] Chr5:176127129..180696806 [GRCh37] Chr5:176059735..180629412 [NCBI36] Chr5:5q35.2-35.3	pathogenic
GRCh38/hg38 5q35.2-35.3(chr5:176517339-177709289)x1	copy number loss	See cases [RCV000142538]	Chr5:176517339..177709289 [GRCh38] Chr5:175944340..177136290 [GRCh37] Chr5:175876946..177068896 [NCBI36] Chr5:5q35.2-35.3	pathogenic
GRCh38/hg38 5q35.2-35.3(chr5:176143674-178009412)x1	copy number loss	See cases [RCV000143463]	Chr5:176143674..178009412 [GRCh38] Chr5:175570677..177436413 [GRCh37] Chr5:175503283..177369019 [NCBI36] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:174397487-180686444)x1	copy number loss	See cases [RCV000167565]	Chr5:174397487..180686444 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q15-35.3(chr5:94844077-178830410)x3	copy number gain	not provided [RCV000487658]	Chr5:94844077..178830410 [GRCh37] Chr5:5q15-35.3	likely benign
Single allele	duplication	not provided [RCV000768450]	Chr5:175843728..180703728 [GRCh37] Chr5:5q35.2-35.3	likely pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:176274007-180719789)x1	copy number loss	See cases [RCV000447018]	Chr5:176274007..180719789 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:175722788-177423091)x3	copy number gain	See cases [RCV000445774]	Chr5:175722788..177423091 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:176505173-178230923)x1	copy number loss	See cases [RCV000445817]	Chr5:176505173..178230923 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:174427052-180719789)x1	copy number loss	See cases [RCV000448611]	Chr5:174427052..180719789 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:175601473-180100378)x1	copy number loss	See cases [RCV000448793]	Chr5:175601473..180100378 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q21.3-35.3(chr5:106716357-180687338)x3	copy number gain	See cases [RCV000448245]	Chr5:106716357..180687338 [GRCh37] Chr5:5q21.3-35.3	pathogenic
GRCh37/hg19 5q35.1-35.3(chr5:171396359-180719789)x3	copy number gain	See cases [RCV000448458]	Chr5:171396359..180719789 [GRCh37] Chr5:5q35.1-35.3	pathogenic
GRCh37/hg19 5q35.1-35.3(chr5:172031248-180719789)x3	copy number gain	See cases [RCV000512068]	Chr5:172031248..180719789 [GRCh37] Chr5:5q35.1-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:175438045-177392885)x1	copy number loss	See cases [RCV000511974]	Chr5:175438045..177392885 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5p15.33-q35.3(chr5:113577-180719789)x3	copy number gain	See cases [RCV000512039]	Chr5:113577..180719789 [GRCh37] Chr5:5p15.33-q35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:175570677-177439550)x3	copy number gain	See cases [RCV000511393]	Chr5:175570677..177439550 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5p15.33-q35.3(chr5:113577-180719789)	copy number gain	See cases [RCV000510723]	Chr5:113577..180719789 [GRCh37] Chr5:5p15.33-q35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:175570677-180719789)x1	copy number loss	See cases [RCV000510785]	Chr5:175570677..180719789 [GRCh37] Chr5:5q35.2-35.3	pathogenic
NM_006480.5(RGS14):c.1175C>G (p.Pro392Arg)	single nucleotide variant	not specified [RCV004286269]	Chr5:177370952 [GRCh38] Chr5:176797953 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.41G>A (p.Arg14His)	single nucleotide variant	not specified [RCV004282308]	Chr5:177358065 [GRCh38] Chr5:176785066 [GRCh37] Chr5:5q35.3	uncertain significance
GRCh37/hg19 5q35.2-35.3(chr5:175570678-177437340)x1	copy number loss	See cases [RCV000512405]	Chr5:175570678..177437340 [GRCh37] Chr5:5q35.2-35.3	pathogenic
Single allele	duplication	not provided [RCV000677989]	Chr5:176798338..177423150 [GRCh37] Chr5:5q35.3	uncertain significance
GRCh37/hg19 5q35.2-35.3(chr5:175570677-177436413)x1	copy number loss	not provided [RCV000682615]	Chr5:175570677..177436413 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:175438045-177481250)x1	copy number loss	not provided [RCV000682614]	Chr5:175438045..177481250 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:176044976-177023859)x1	copy number loss	not provided [RCV000682618]	Chr5:176044976..177023859 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5p15.33-q35.3(chr5:25328-180693344)x3	copy number gain	not provided [RCV000744323]	Chr5:25328..180693344 [GRCh37] Chr5:5p15.33-q35.3	pathogenic
GRCh37/hg19 5p15.33-q35.3(chr5:13648-180905029)x3	copy number gain	not provided [RCV000744317]	Chr5:13648..180905029 [GRCh37] Chr5:5p15.33-q35.3	pathogenic
GRCh37/hg19 5q33.2-35.3(chr5:155344802-180693344)x3	copy number gain	not provided [RCV000745284]	Chr5:155344802..180693344 [GRCh37] Chr5:5q33.2-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:174832617-180693344)x3	copy number gain	not provided [RCV000745336]	Chr5:174832617..180693344 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:175346223-177423236)x1	copy number loss	not provided [RCV000745338]	Chr5:175346223..177423236 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:175433876-177441189)x1	copy number loss	not provided [RCV000745339]	Chr5:175433876..177441189 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:174990352-180690937)	copy number gain	not provided [RCV000767711]	Chr5:174990352..180690937 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:176305543-177422876)	copy number gain	not provided [RCV000767712]	Chr5:176305543..177422876 [GRCh37] Chr5:5q35.2-35.3	pathogenic
NM_006480.5(RGS14):c.1685C>T (p.Thr562Ile)	single nucleotide variant	not specified [RCV004331973]	Chr5:177372059 [GRCh38] Chr5:176799060 [GRCh37] Chr5:5q35.3	uncertain significance
GRCh37/hg19 5q35.3(chr5:176774402-177064884)x4	copy number gain	not provided [RCV000848335]	Chr5:176774402..177064884 [GRCh37] Chr5:5q35.3	uncertain significance
GRCh37/hg19 5q35.2-35.3(chr5:175570677-177439550)x3	copy number gain	not provided [RCV000846148]	Chr5:175570677..177439550 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.3(chr5:176643613-179085551)x3	copy number gain	not provided [RCV000846590]	Chr5:176643613..179085551 [GRCh37] Chr5:5q35.3	uncertain significance
Single allele	deletion	Marfanoid habitus and intellectual disability [RCV000851176]	Chr5:175875407..177036017 [GRCh37] Chr5:5q35.2-35.3	likely pathogenic
GRCh37/hg19 5q35.3(chr5:176732536-177260046)x1	copy number loss	not provided [RCV000845642]	Chr5:176732536..177260046 [GRCh37] Chr5:5q35.3	uncertain significance
NC_000005.9:g.(?_176289625)_(177151363_?)del	deletion	Sotos syndrome [RCV003232856]\|not provided [RCV003113198]	Chr5:176289625..177151363 [GRCh37] Chr5:5q35.2-35.3	pathogenic\|no classifications from unflagged records
NM_006480.5(RGS14):c.1621G>A (p.Glu541Lys)	single nucleotide variant	not provided [RCV000948724]	Chr5:177371995 [GRCh38] Chr5:176798996 [GRCh37] Chr5:5q35.3	benign
GRCh37/hg19 5q35.3(chr5:176718361-176957659)x3	copy number gain	not provided [RCV002472682]	Chr5:176718361..176957659 [GRCh37] Chr5:5q35.3	uncertain significance
GRCh37/hg19 5q35.3(chr5:176616151-177107778)x3	copy number gain	not provided [RCV002472763]	Chr5:176616151..177107778 [GRCh37] Chr5:5q35.3	uncertain significance
NC_000005.10:g.177357511G>A	single nucleotide variant	not provided [RCV001621874]	Chr5:177357511 [GRCh38] Chr5:177357511..177357512 [GRCh38] Chr5:176784512 [GRCh37] Chr5:176784512..176784513 [GRCh37] Chr5:5q35.3	benign
GRCh37/hg19 5q35.2-35.3(chr5:175346695-177469711)x1	copy number loss	Sotos syndrome [RCV003232270]	Chr5:175346695..177469711 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.1-35.3(chr5:170805664-180719789)x3	copy number gain	5q35 microduplication syndrome [RCV001263227]	Chr5:170805664..180719789 [GRCh37] Chr5:5q35.1-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:175394616-177436413)x3	copy number gain	not provided [RCV001258713]	Chr5:175394616..177436413 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:175570677-177114151)x3	copy number gain	not provided [RCV001258712]	Chr5:175570677..177114151 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q32-35.3(chr5:149010383-180719789)	copy number gain	Hunter-McAlpine craniosynostosis [RCV002280612]	Chr5:149010383..180719789 [GRCh37] Chr5:5q32-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:176497464-177776599)x3	copy number gain	not provided [RCV001832980]	Chr5:176497464..177776599 [GRCh37] Chr5:5q35.2-35.3	pathogenic\|likely pathogenic
NC_000005.9:g.(?_176047812)_(177422934_?)del	deletion	Ehlers-Danlos syndrome progeroid type [RCV001931790]	Chr5:176047812..177422934 [GRCh37] Chr5:5q35.2-35.3	uncertain significance
NC_000005.9:g.(?_176047812)_(177422934_?)dup	duplication	Ehlers-Danlos syndrome progeroid type [RCV001883344]\|not provided [RCV001879660]	Chr5:176047812..177422934 [GRCh37] Chr5:5q35.2-35.3	uncertain significance
NC_000005.9:g.(?_175158654)_(179263593_?)dup	duplication	Ehlers-Danlos syndrome, dermatosparaxis type [RCV003116717]\|Sotos syndrome [RCV003232857]\|not provided [RCV003154288]	Chr5:175158654..179263593 [GRCh37] Chr5:5q35.2-35.3	uncertain significance\|no classifications from unflagged records
NC_000005.9:g.(?_176618865)_(177036696_?)dup	duplication	Sotos syndrome [RCV003232859]	Chr5:176618865..177036696 [GRCh37] Chr5:5q35.3	uncertain significance
Single allele	duplication	5q35 microduplication syndrome [RCV002286375]	Chr5:176449583..177376826 [GRCh38] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.1-35.3(chr5:170350336-180719789)x3	copy number gain	See cases [RCV002292398]	Chr5:170350336..180719789 [GRCh37] Chr5:5q35.1-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:176516440-177773252)x3	copy number gain	not provided [RCV002474595]	Chr5:176516440..177773252 [GRCh37] Chr5:5q35.2-35.3	likely pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:176547912-177126647)x3	copy number gain	not provided [RCV002472528]	Chr5:176547912..177126647 [GRCh37] Chr5:5q35.2-35.3	likely pathogenic
NM_006480.5(RGS14):c.1642A>G (p.Lys548Glu)	single nucleotide variant	not specified [RCV004240483]	Chr5:177372016 [GRCh38] Chr5:176799017 [GRCh37] Chr5:5q35.3	likely benign
NM_006480.5(RGS14):c.1621G>C (p.Glu541Gln)	single nucleotide variant	not specified [RCV004233915]	Chr5:177371995 [GRCh38] Chr5:176798996 [GRCh37] Chr5:5q35.3	likely benign
NM_006480.5(RGS14):c.1604C>T (p.Ala535Val)	single nucleotide variant	not specified [RCV004228673]	Chr5:177371978 [GRCh38] Chr5:176798979 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.1069C>G (p.Gln357Glu)	single nucleotide variant	not specified [RCV004234192]	Chr5:177370606 [GRCh38] Chr5:176797607 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.1282G>A (p.Gly428Arg)	single nucleotide variant	not specified [RCV004085163]	Chr5:177371192 [GRCh38] Chr5:176798193 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.1178C>G (p.Thr393Ser)	single nucleotide variant	not specified [RCV004245421]	Chr5:177370955 [GRCh38] Chr5:176797956 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.103G>A (p.Glu35Lys)	single nucleotide variant	not specified [RCV004128385]	Chr5:177366212 [GRCh38] Chr5:176793213 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.1430C>T (p.Ala477Val)	single nucleotide variant	not specified [RCV004221426]	Chr5:177371521 [GRCh38] Chr5:176798522 [GRCh37] Chr5:5q35.3	likely benign
NM_006480.5(RGS14):c.1438A>G (p.Ser480Gly)	single nucleotide variant	not specified [RCV004081958]	Chr5:177371529 [GRCh38] Chr5:176798530 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.1081G>A (p.Val361Met)	single nucleotide variant	not specified [RCV004089807]	Chr5:177370618 [GRCh38] Chr5:176797619 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.707G>A (p.Gly236Glu)	single nucleotide variant	not specified [RCV004273787]	Chr5:177367793 [GRCh38] Chr5:176794794 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.658C>T (p.Pro220Ser)	single nucleotide variant	not specified [RCV004263863]	Chr5:177367744 [GRCh38] Chr5:176794745 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.880G>T (p.Gly294Cys)	single nucleotide variant	not specified [RCV004279458]	Chr5:177368747 [GRCh38] Chr5:176795748 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.659C>T (p.Pro220Leu)	single nucleotide variant	not specified [RCV004255238]	Chr5:177367745 [GRCh38] Chr5:176794746 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.742C>G (p.Leu248Val)	single nucleotide variant	not specified [RCV004266982]	Chr5:177368159 [GRCh38] Chr5:176795160 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.743T>G (p.Leu248Arg)	single nucleotide variant	not specified [RCV004266983]	Chr5:177368160 [GRCh38] Chr5:176795161 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.1417C>T (p.His473Tyr)	single nucleotide variant	not specified [RCV004279576]	Chr5:177371508 [GRCh38] Chr5:176798509 [GRCh37] Chr5:5q35.3	uncertain significance
GRCh37/hg19 5q35.2-35.3(chr5:175332333-177469711)x1	copy number loss	not provided [RCV003485494]	Chr5:175332333..177469711 [GRCh37] Chr5:5q35.2-35.3	pathogenic
Single allele	deletion	not provided [RCV003448669]	Chr5:175559209..177430432 [GRCh37] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.3(chr5:176744569-177107777)x3	copy number gain	not specified [RCV003986576]	Chr5:176744569..177107777 [GRCh37] Chr5:5q35.3	uncertain significance
GRCh37/hg19 5q35.2-35.3(chr5:176385815-178410738)x1	copy number loss	not specified [RCV003986570]	Chr5:176385815..178410738 [GRCh37] Chr5:5q35.2-35.3	pathogenic
NM_006480.5(RGS14):c.172G>A (p.Glu58Lys)	single nucleotide variant	not specified [RCV004449133]	Chr5:177366281 [GRCh38] Chr5:176793282 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.418G>A (p.Ala140Thr)	single nucleotide variant	not specified [RCV004449135]	Chr5:177366969 [GRCh38] Chr5:176793970 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.779C>T (p.Ser260Phe)	single nucleotide variant	not specified [RCV004449137]	Chr5:177368196 [GRCh38] Chr5:176795197 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.1013C>G (p.Ser338Cys)	single nucleotide variant	not specified [RCV004449126]	Chr5:177368880 [GRCh38] Chr5:176795881 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.94G>T (p.Gly32Cys)	single nucleotide variant	not specified [RCV004449138]	Chr5:177366203 [GRCh38] Chr5:176793204 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.1117A>G (p.Ile373Val)	single nucleotide variant	not specified [RCV004449128]	Chr5:177370654 [GRCh38] Chr5:176797655 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.1156G>A (p.Val386Ile)	single nucleotide variant	not specified [RCV004449129]	Chr5:177370933 [GRCh38] Chr5:176797934 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.1213G>A (p.Glu405Lys)	single nucleotide variant	not specified [RCV004449130]	Chr5:177370990 [GRCh38] Chr5:176797991 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.1283G>A (p.Gly428Glu)	single nucleotide variant	not specified [RCV004449131]	Chr5:177371193 [GRCh38] Chr5:176798194 [GRCh37] Chr5:5q35.3	likely benign
NM_006480.5(RGS14):c.1364A>G (p.Lys455Arg)	single nucleotide variant	not specified [RCV004449132]	Chr5:177371377 [GRCh38] Chr5:176798378 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.173A>G (p.Glu58Gly)	single nucleotide variant	not specified [RCV004449134]	Chr5:177366282 [GRCh38] Chr5:176793283 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.41G>T (p.Arg14Leu)	single nucleotide variant	not specified [RCV004449136]	Chr5:177358065 [GRCh38] Chr5:176785066 [GRCh37] Chr5:5q35.3	uncertain significance
GRCh37/hg19 5q35.2-35.3(chr5:175470000-177450000)x1	copy number loss	not provided [RCV004577486]	Chr5:175470000..177450000 [GRCh37] Chr5:5q35.2-35.3	pathogenic
NM_006480.5(RGS14):c.546G>C (p.Glu182Asp)	single nucleotide variant	not specified [RCV004662950]	Chr5:177367476 [GRCh38] Chr5:176794477 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.1172A>G (p.Lys391Arg)	single nucleotide variant	not specified [RCV004671934]	Chr5:177370949 [GRCh38] Chr5:176797950 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.380C>G (p.Ser127Cys)	single nucleotide variant	not specified [RCV004671936]	Chr5:177366931 [GRCh38] Chr5:176793932 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.1004G>A (p.Arg335Gln)	single nucleotide variant	not specified [RCV004662951]	Chr5:177368871 [GRCh38] Chr5:176795872 [GRCh37] Chr5:5q35.3	uncertain significance
Single allele	duplication	Russell-Silver syndrome [RCV004698950]	Chr5:177041167..177411815 [GRCh38] Chr5:5q35.2-35.3	pathogenic
GRCh37/hg19 5q35.2-35.3(chr5:175570678-177414568)x3	copy number gain	not provided [RCV004819302]	Chr5:175570678..177414568 [GRCh37] Chr5:5q35.2-35.3	pathogenic
NM_006480.5(RGS14):c.928G>C (p.Asp310His)	single nucleotide variant	not specified [RCV004855395]	Chr5:177368795 [GRCh38] Chr5:176795796 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.1394C>T (p.Pro465Leu)	single nucleotide variant	not specified [RCV004852329]	Chr5:177371485 [GRCh38] Chr5:176798486 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.1151G>T (p.Arg384Leu)	single nucleotide variant	not specified [RCV004852326]	Chr5:177370928 [GRCh38] Chr5:176797929 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.665G>A (p.Gly222Asp)	single nucleotide variant	not specified [RCV004852327]	Chr5:177367751 [GRCh38] Chr5:176794752 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.1468A>T (p.Thr490Ser)	single nucleotide variant	not specified [RCV004852328]	Chr5:177371559 [GRCh38] Chr5:176798560 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.320C>G (p.Pro107Arg)	single nucleotide variant	not specified [RCV004852330]	Chr5:177366781 [GRCh38] Chr5:176793782 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.448C>T (p.Pro150Ser)	single nucleotide variant	not specified [RCV004852331]	Chr5:177366999 [GRCh38] Chr5:176794000 [GRCh37] Chr5:5q35.3	uncertain significance
NM_006480.5(RGS14):c.62A>G (p.Asp21Gly)	single nucleotide variant	not specified [RCV004852332]	Chr5:177365979 [GRCh38] Chr5:176792980 [GRCh37] Chr5:5q35.3	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	4156
Count of miRNA genes:	952
Interacting mature miRNAs:	1207
Transcripts:	ENST00000408923, ENST00000425155, ENST00000502731, ENST00000503044, ENST00000503110, ENST00000504631, ENST00000506944, ENST00000509289, ENST00000511890, ENST00000512000, ENST00000512490, ENST00000514102, ENST00000514713
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
596978197	GWAS1097716_H	glomerular filtration rate QTL GWAS1097716 (human)		6e-17	glomerular filtration rate		5	177370342	177370343	Human
596976276	GWAS1095795_H	blood urea nitrogen measurement QTL GWAS1095795 (human)		0.000008	blood urea nitrogen measurement		5	177367190	177367191	Human
596978196	GWAS1097715_H	glomerular filtration rate QTL GWAS1097715 (human)		4e-12	glomerular filtration rate		5	177367190	177367191	Human
596978199	GWAS1097718_H	glomerular filtration rate QTL GWAS1097718 (human)		8e-17	glomerular filtration rate		5	177371305	177371306	Human
596978198	GWAS1097717_H	glomerular filtration rate QTL GWAS1097717 (human)		1e-14	glomerular filtration rate		5	177371069	177371071	Human
597601181	GWAS1658041_H	blood urea nitrogen measurement QTL GWAS1658041 (human)		1e-20	blood urea nitrogen measurement	blood urea nitrogen level (CMO:0000049)	5	177371305	177371306	Human
597028243	GWAS1124317_H	blood urea nitrogen measurement QTL GWAS1124317 (human)		1e-19	blood urea nitrogen measurement	blood urea nitrogen level (CMO:0000049)	5	177361569	177361570	Human
596978195	GWAS1097714_H	glomerular filtration rate QTL GWAS1097714 (human)		6e-17	glomerular filtration rate		5	177365742	177365743	Human
597224735	GWAS1320809_H	cystatin C measurement QTL GWAS1320809 (human)		7e-72	cystatin C measurement	blood cystatin C level (CMO:0002777)	5	177367190	177367191	Human
597257246	GWAS1353320_H	urate measurement QTL GWAS1353320 (human)		2e-11	urate measurement	blood uric acid level (CMO:0000501)	5	177367190	177367191	Human
597601422	GWAS1658282_H	blood urea nitrogen measurement QTL GWAS1658282 (human)		2e-19	blood urea nitrogen measurement	blood urea nitrogen level (CMO:0000049)	5	177371039	177371040	Human
406944339	GWAS593315_H	eosinophil percentage of leukocytes QTL GWAS593315 (human)		1e-11	eosinophil quantity (VT:0002602)	blood eosinophil count to total leukocyte count ratio (CMO:0000369)	5	177365490	177365491	Human
597591821	GWAS1648681_H	bladder calculus QTL GWAS1648681 (human)		2e-80	bladder calculus		5	177371039	177371040	Human
597591944	GWAS1648804_H	ureterolithiasis QTL GWAS1648804 (human)		1e-25	ureterolithiasis		5	177371039	177371040	Human
597201280	GWAS1297354_H	nephrolithiasis QTL GWAS1297354 (human)		1e-15	nephrolithiasis		5	177371039	177371040	Human
597614854	GWAS1671714_H	ureterolithiasis QTL GWAS1671714 (human)		5e-21	ureterolithiasis		5	177371039	177371040	Human
407060442	GWAS709418_H	inflammatory bowel disease QTL GWAS709418 (human)		2e-08	inflammatory bowel disease		5	177367190	177367191	Human
597595653	GWAS1652513_H	blood urea nitrogen measurement QTL GWAS1652513 (human)		2e-38	blood urea nitrogen measurement	blood urea nitrogen level (CMO:0000049)	5	177371039	177371040	Human
597041673	GWAS1137747_H	nephrolithiasis QTL GWAS1137747 (human)		3e-21	nephrolithiasis		5	177371039	177371040	Human
2289409	BW320_H	Body weight QTL 320 (human)	3.5	0.0002	Body weight	lean mass	5	160925164	181538259	Human
597601339	GWAS1658199_H	blood urea nitrogen measurement QTL GWAS1658199 (human)		1e-13	blood urea nitrogen measurement	blood urea nitrogen level (CMO:0000049)	5	177371305	177371306	Human
597255231	GWAS1351305_H	calcium measurement QTL GWAS1351305 (human)		5e-13	calcium measurement	blood calcium level (CMO:0000502)	5	177367190	177367191	Human
597021501	GWAS1117575_H	ulcerative colitis QTL GWAS1117575 (human)		4e-08	ulcerative colitis		5	177361569	177361570	Human
597057854	GWAS1153928_H	eosinophil count QTL GWAS1153928 (human)		1e-16	eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	5	177365490	177365491	Human
407048043	GWAS697019_H	nephrolithiasis QTL GWAS697019 (human)		9e-12	nephrolithiasis		5	177371305	177371306	Human
597321398	GWAS1417472_H	metabolite measurement QTL GWAS1417472 (human)		8e-12	metabolite measurement		5	177371305	177371306	Human
597349303	GWAS1445377_H	lichen planus QTL GWAS1445377 (human)		0.0000002	lichen planus		5	177363161	177363162	Human
406977004	GWAS625980_H	hemoglobin measurement QTL GWAS625980 (human)		1e-09	hemoglobin measurement	hemoglobin measurement (CMO:0000508)	5	177371039	177371040	Human
597025594	GWAS1121668_H	chronic kidney disease QTL GWAS1121668 (human)		2e-10	chronic kidney disease		5	177361569	177361570	Human
597053222	GWAS1149296_H	eosinophil count QTL GWAS1149296 (human)		4e-21	eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	5	177365556	177365557	Human
596966181	GWAS1085700_H	lichen planus QTL GWAS1085700 (human)		0.0000002	lichen planus		5	177363161	177363162	Human
597291048	GWAS1387122_H	phosphate measurement QTL GWAS1387122 (human)		7e-11	blood phosphate amount (VT:0001565)		5	177365490	177365491	Human
597092772	GWAS1188846_H	ulcerative colitis QTL GWAS1188846 (human)		3e-09	ulcerative colitis		5	177361569	177361570	Human
406954228	GWAS603204_H	hematocrit QTL GWAS603204 (human)		9e-11	hematocrit	hematocrit (CMO:0000037)	5	177371039	177371040	Human
597238575	GWAS1334649_H	calcium measurement QTL GWAS1334649 (human)		1e-12	calcium measurement	blood calcium level (CMO:0000502)	5	177365490	177365491	Human
597591774	GWAS1648634_H	nephrolithiasis QTL GWAS1648634 (human)		8e-73	nephrolithiasis		5	177371039	177371040	Human
597093205	GWAS1189279_H	Crohn's disease QTL GWAS1189279 (human)		3e-08	intestine integrity trait (VT:0010554)		5	177361569	177361570	Human
597072594	GWAS1168668_H	multiple sclerosis QTL GWAS1168668 (human)		4e-18	multiple sclerosis		5	177361569	177361570	Human
597094737	GWAS1190811_H	nephrolithiasis QTL GWAS1190811 (human)		6e-11	nephrolithiasis		5	177367190	177367191	Human
597054298	GWAS1150372_H	multiple sclerosis QTL GWAS1150372 (human)		3e-21	multiple sclerosis		5	177363161	177363162	Human
597431378	GWAS1527452_H	testosterone measurement QTL GWAS1527452 (human)		4e-09	testosterone measurement	serum testosterone level (CMO:0000568)	5	177371059	177371060	Human
597020997	GWAS1117071_H	inflammatory bowel disease QTL GWAS1117071 (human)		4e-09	inflammatory bowel disease		5	177361569	177361570	Human
597427017	GWAS1523091_H	gout QTL GWAS1523091 (human)		7e-14	gout		5	177363806	177363807	Human
597098703	GWAS1194777_H	urolithiasis QTL GWAS1194777 (human)		6e-14	urolithiasis		5	177365742	177365743	Human
407101208	GWAS750184_H	eosinophil count QTL GWAS750184 (human)		1e-21	eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	5	177365490	177365491	Human
597057101	GWAS1153175_H	eosinophil count QTL GWAS1153175 (human)		2e-20	eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	5	177365490	177365491	Human
596988278	GWAS1107797_H	phosphate measurement QTL GWAS1107797 (human)		7e-11	phosphate measurement		5	177365490	177365491	Human
597286269	GWAS1382343_H	calcium measurement QTL GWAS1382343 (human)		7e-18	calcium measurement	blood calcium level (CMO:0000502)	5	177361621	177361622	Human
597044850	GWAS1140924_H	hemoglobin measurement QTL GWAS1140924 (human)		7e-16	hemoglobin measurement	hemoglobin measurement (CMO:0000508)	5	177371039	177371040	Human
597611771	GWAS1668631_H	erythrocyte count QTL GWAS1668631 (human)		5e-13	erythrocyte count	red blood cell count (CMO:0000025)	5	177371039	177371040	Human
597092336	GWAS1188410_H	inflammatory bowel disease QTL GWAS1188410 (human)		3e-12	inflammatory bowel disease		5	177361569	177361570	Human
597426298	GWAS1522372_H	urate measurement QTL GWAS1522372 (human)		4e-20	urate measurement	blood uric acid level (CMO:0000501)	5	177363806	177363807	Human
597246206	GWAS1342280_H	blood phosphate measurement QTL GWAS1342280 (human)		2e-86	blood phosphate amount (VT:0001565)	blood phosphate level (CMO:0000504)	5	177367190	177367191	Human
407024427	GWAS673403_H	calcium measurement QTL GWAS673403 (human)		0.000005	calcium measurement	blood calcium level (CMO:0000502)	5	177370342	177370343	Human
597347571	GWAS1443645_H	nephrolithiasis QTL GWAS1443645 (human)		5e-20	nephrolithiasis		5	177371039	177371040	Human
597346032	GWAS1442106_H	urate measurement QTL GWAS1442106 (human)		1e-13	urate measurement	blood uric acid level (CMO:0000501)	5	177363806	177363807	Human
597282547	GWAS1378621_H	blood urea nitrogen measurement QTL GWAS1378621 (human)		0.000008	blood urea nitrogen measurement	blood urea nitrogen level (CMO:0000049)	5	177367190	177367191	Human
597594734	GWAS1651594_H	hematocrit QTL GWAS1651594 (human)		4e-19	hematocrit	hemoglobin measurement (CMO:0000508)	5	177371039	177371040	Human
597604074	GWAS1660934_H	triglyceride measurement QTL GWAS1660934 (human)		1e-15	triglyceride measurement	blood triglyceride level (CMO:0000118)	5	177371305	177371306	Human
597227488	GWAS1323562_H	urolithiasis QTL GWAS1323562 (human)		2e-19	urolithiasis		5	177371305	177371306	Human
597612901	GWAS1669761_H	erythrocyte count QTL GWAS1669761 (human)		2e-12	erythrocyte count	red blood cell count (CMO:0000025)	5	177371039	177371040	Human
597594595	GWAS1651455_H	hematocrit QTL GWAS1651455 (human)		3e-26	hematocrit	hematocrit (CMO:0000037)	5	177371039	177371040	Human
597428578	GWAS1524652_H	gout QTL GWAS1524652 (human)		2e-14	gout		5	177363806	177363807	Human
597615200	GWAS1672060_H	nephrolithiasis QTL GWAS1672060 (human)		2e-57	nephrolithiasis		5	177370342	177370343	Human

D5S1624E

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	5	176,799,485 - 176,799,564	UniSTS	GRCh37
Build 36	5	176,732,091 - 176,732,170	RGD	NCBI36
Celera	5	171,701,704 - 171,701,783	RGD
Cytogenetic Map	5	q35.3	UniSTS
HuRef	5	171,720,123 - 171,720,202	UniSTS
GeneMap99-GB4 RH Map	5	636.91	UniSTS
NCBI RH Map	5	973.0	UniSTS

RGS14_3061

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	5	176,798,945 - 176,799,570	UniSTS	GRCh37
Build 36	5	176,731,551 - 176,732,176	RGD	NCBI36
Celera	5	171,701,698 - 171,702,323	RGD
HuRef	5	171,719,583 - 171,720,208	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2432	2788	2245	4953	1723	2348	4	623	1949	465	2269	7288	6459	53	3717	850	1739	1613	174	1


RefSeq Transcripts	NM_001366617	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001366618	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_006480	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_024454328	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_047416638	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_047416639	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054351449	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054351450	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC146507	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF037194	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF037195	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF493936	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI623584	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK098150	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK123382	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY987041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC014094	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BI752372	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471195	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068273	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000408923 ⟹ ENSP00000386229

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	5	177,357,924 - 177,372,596 (+)	Ensembl

Ensembl Acc Id:

ENST00000425155

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	5	177,367,314 - 177,372,596 (+)	Ensembl

Ensembl Acc Id:

ENST00000502731

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	5	177,370,553 - 177,371,578 (+)	Ensembl

Ensembl Acc Id:

ENST00000503044

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	5	177,371,107 - 177,372,143 (+)	Ensembl

Ensembl Acc Id:

ENST00000503110

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	5	177,367,217 - 177,368,888 (+)	Ensembl

Ensembl Acc Id:

ENST00000504631

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	5	177,366,428 - 177,367,557 (+)	Ensembl

Ensembl Acc Id:

ENST00000506944

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	5	177,371,113 - 177,372,166 (+)	Ensembl

Ensembl Acc Id:

ENST00000509289

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	5	177,371,066 - 177,371,582 (+)	Ensembl

Ensembl Acc Id:

ENST00000511890 ⟹ ENSP00000422329

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	5	177,366,943 - 177,372,298 (+)	Ensembl

Ensembl Acc Id:

ENST00000512000

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	5	177,367,302 - 177,368,016 (+)	Ensembl

Ensembl Acc Id:

ENST00000512490

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	5	177,367,303 - 177,368,804 (+)	Ensembl

Ensembl Acc Id:

ENST00000514102

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	5	177,370,821 - 177,372,292 (+)	Ensembl

Ensembl Acc Id:

ENST00000514713

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	5	177,366,943 - 177,369,075 (+)	Ensembl

RefSeq Acc Id:

NM_001366617 ⟹ NP_001353546

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	5	177,357,924 - 177,372,596 (+)	NCBI
T2T-CHM13v2.0	5	177,901,146 - 177,915,812 (+)	NCBI

Sequence:

show sequence

CTCTCCACTGCCTGCCCGCCACCGTGCAAGCTCTGGCCGGCGCTGCCCACAGTCCCCATGGTGGGCAGCCCCCGCGGCGGGGACCCCTGATCGGCAGCGGCATGCCAGGGAAGCCCAAGCACCTGGGC
GTCCCCAACGGGCGCATGGTTCTGGCTGTGTCAGATGGAGAGCTGAGCAGCACGACGGGGCCCCAGGGCCAGGGCGAGGGCCGCGGCAGCTCTCTCAGCATCCACAGCCTCCCCAGTGGTCCCAGCAG
CCCCTTCCCAACCGAGGAGCAGCCTGTGGCCAGCTGGGCCCTGTCCTTCGAGCGGCTGTTGCAGGACCCGCTGGGCCTGGCTTACTTCACTGAGTTCCTGAAGAAGGAGTTCAGCGCGGAAAACGTGA
CTTTCTGGAAGGCCTGCGAGCGCTTCCAGCAGATCCCGGCCAGCGATACCCAGCAGCTAGCTCAGGAGGCCCGCAACATCTACCAGGAGTTCCTGTCCAGCCAGGCGCTGAGCCCAGTGAACATCGAC
CGTCAGGCCTGGCTTGGCGAGGAGGTGCTGGCCGAGCCCCGGCCGGACATGTTTCGGGCACAGCAGCTTCAGATCTTCAACTTGATGAAGTTCGACAGCTATGCGCGCTTCGTCAAGTCCCCGCTGTA
CCGCGAGTGCCTGCTAGCCGAAGCCGAGGGACGCCCTCTGCGGGAACCTGGCTCCTCGCGCCTCGGCAGCCCTGACGCCACGAGGAAGAAGCCGAAGCTGAAGCCCGGGAAGTCGCTGCCGCTGGGTG
TGGAGGAGTTGGGGCAGCTGCCACCCGTTGAGGGTCCTGGGGGCCGCCCTCTCCGCAAGTCCTTCCGCCGGGAGCTGGGCGGGACTGCAAACGCCGCCTTGCGCCGAGAGTCTCAGGGCTCCCTCAAC
TCCTCCGCCAGCCTGGACCTTGGCTTCCTAGCCTTCGTCAGCAGCAAATCTGAGAGCCACCGGAAGAGCCTTGGGAGCACGGAGGGTGAAAGTGAAAGCCGGCCAGGGAAGTACTGCTGTGTGTACCT
GCCCGATGGCACAGCCTCCTTGGCCCTGGCCAGACCTGGCCTCACCATCCGAGACATGCTGGCAGGGATCTGTGAGAAACGAGGCCTCTCTCTACCTGACATCAAGGTCTACCTGGTGGGCAATGAAC
AGAAGGCCCTGGTCCTGGATCAGGACTGCACCGTGCTGGCGGATCAGGAAGTGCGGCTGGAAAACAGGATCACCTTCGAGCTGGAGCTGACGGCGCTGGAGCGCGTGGTACGAATCTCAGCCAAGCCC
ACCAAGCGGCTGCAGGAGGCGCTGCAGCCCATTCTGGAGAAGCACGGCTTGAGCCCGCTAGAGGTGGTGCTGCACCGGCCAGGCGAGAAACAGCCTCTGGATCTGGGGAAGCTAGTGAGCTCGGTGGC
GGCCCAGAGACTGGTTTTGGACACTCTTCCAGGTGTGAAGATCTCCAAAGCCCGTGACAAATCTCCCTGCCGCAGCCAGGGCTGCCCACCTAGAACTCAGGATAAGGCCACCCATCCCCCTCCAGCGT
CCCCCAGTTCTCTGGTGAAGGTGCCCAGTAGTGCCACTGGAAAGCGGCAGACCTGTGACATCGAAGGCCTGGTGGAGCTGCTGAACCGGGTGCAGAGCAGCGGGGCCCACGACCAGAGGGGCCTTCTG
AGGAAAGAGGACCTGGTACTTCCAGAATTTCTGCAGCTGCCCGCCCAAGGGCCCAGCTCCGAGGAGACCCCACCACAGACCAAATCAGCAGCCCAGCCCATCGGGGGATCCTTGAACTCCACCACCGA
CTCAGCCCTCTGACAGCTACCCAACAGTCCAGGACAGCTGCATGGCACCCGGCGGGCCGAGCATGCCATGGGTCCGCTCTGCATGCCCTGTCTGTGCCATGAGTGTCCCTGGCCCCTTCCTGCCATGG
GCAGGCCCGCAGGAAGAGCCGGTAGGGGTGGAAAGGGGACTCAGATGAGACACACCCCACAGCTGCCACCGCCTTGTCCCTCAACAAGCTCACCCCCAATCCCTTGCAGCCAGGCCACAATGGGGGAG
GTGAGTCCAGCCCCTTGGAACAGGCTTGCCCAACATGGAGGGATGGCGTTGGCAGTGCCAGCCTCCCCAGCCTGTGCCAAGCTTCAACAGGGGCAAGAGGAGGGGCCGGCCCCTCCTCAGGAAGCTGG
TATGAGTAAGGCCTTGAGGGTGCAGGCAGGCAGCCCTGTACCCCACCCACATAGACTATACTGTACATACAGATTTTGCAGTAGGCTTGGGGCAGCTGGGTTTGTCCTTGATGTATGATACTGTTATT
ATAATAATTATTATTATTCTGC

hide sequence

RefSeq Acc Id:

NM_001366618 ⟹ NP_001353547

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	5	177,357,924 - 177,372,596 (+)	NCBI
T2T-CHM13v2.0	5	177,901,146 - 177,915,812 (+)	NCBI

Sequence:

show sequence

CTCTCCACTGCCTGCCCGCCACCGTGCAAGCTCTGGCCGGCGCTGCCCACAGTCCCCATGGTGG
GCAGCCCCCGCGGCGGGGACCCCTGATCGGCAGCGGCATGCCAGGGAAGCCCAAGCACCTGGGCGTCCCCAACGGGCGCATGGTTCTGGCTGTGTCAGATGGAGAGCTGAGCAGCACGACGGGGCCCC
AGGGCCAGGGCGAGGGCCGCGGCAGCTCTCTCAGCATCCACAGCCTCCCCAGTGGTCCCAGCAGCCCCTTCCCAACCGAGGAGCAGCCTGTGGCCAGCTGGGCCCTGTCCTTCGAGCGGCTGTTGCAG
GACCCGCTGGGCCTGGCTTACTTCACTGAGTTCCTGAAGAAGGAGTTCAGCGCGGAAAACGTGACTTTCTGGAAGGCCTGCGAGCGCTTCCAGCAGATCCCGGCCAGCGATACCCAGCAGCTAGCTCA
GGAGGCCCGCAACATCTACCAGGAGTTCCTGTCCAGCCAGGCGCTGAGCCCAGTGAACATCGACCGTCAGGCCTGGCTTGGCGAGGAGGTGCTGGCCGAGCCCCGGCCGGACATGTTTCGGGCACAGC
AGCTTCAGATCTTCAACTTGATGAAGTTCGACAGCTATGCGCGCTTCGTCAAGTCCCCGCTGTACCGCGAGTGCCTGCTAGCCGAAGCCGAGGGACGCCCTCTGCGGGAACCTGGCTCCTCGCGCCTC
GGCAGCCCTGACGCCACGAGGAAGAAGCCGAAGCTGAAGCCCGGGAAGTCGCTGCCGCTGGGTGTGGAGGAGTTGGGGCAGCTGCCACCCGTTGAGGGTCCTGGGGGCCGCCCTCTCCGCAAGTCCTT
CCGCCGGGAGCTGGGCGGGACTGCAAACGCCGCCTTGCGCCGAGAGTCTCAGGGCTCCCTCAACTCCTCCGCCAGCCTGGACCTTGGCTTCCTAGCCTTCGTCAGCAGCAAATCTGAGAGCCACCGGA
AGAGCCTTGGGAGCACGGAGGGTGAAAGTGAAAGCCGGCCAGGGAAGTACTGCTGTGTGTACCTGCCCGATGGCACAGCCTCCTTGGCCCTGGCCAGACCTGGCCTCACCATCCGAGACATGCTGGCA
GGGATCTGTGAGAAACGAGGCCTCTCTCTACCTGACATCAAGGTCTACCTGGTGGGCAATGAACAGAAGGCCCTGGTCCTGGATCAGGACTGCACCGTGCTGGCGGATCAGGAAGTGCGGCTGGAAAA
CAGGATCACCTTCGAGCTGGAGCTGACGGCGCTGGAGCGCGTGGTACGAATCTCAGCCAAGCCCACCAAGCGGCTGCAGGAGGCGCTGCAGCCCATTCTGGAGAAGCACGGCTTGAGCCCGCTAGAGG
TGGTGCTGCACCGGCCAGGCGAGAAACAGCCTCTGGATCTGGGGAAGCTAGTGAGCTCGGTGGCGGCCCAGAGACTGGTTTTGGACACTCTTCCAGGTGTGAAGATCTCCAAAGCCCGTGACAAATCT
CCCTGCCGCAGCCAGGCCTGGTGGAGCTGCTGAACCGGGTGCAGAGCAGCGGGGCCCACGACCAGAGGGGCCTTCTGAGGAAAGAGGACCTGGTACTTCCAGAATTTCTGCAGCTGCCCGCCCAAGGG
CCCAGCTCCGAGGAGACCCCACCACAGACCAAATCAGCAGCCCAGCCCATCGGGGGATCCTTGAACTCCACCACCGACTCAGCCCTCTGACAGCTACCCAACAGTCCAGGACAGCTGCATGGCACCCG
GCGGGCCGAGCATGCCATGGGTCCGCTCTGCATGCCCTGTCTGTGCCATGAGTGTCCCTGGCCCCTTCCTGCCATGGGCAGGCCCGCAGGAAGAGCCGGTAGGGGTGGAAAGGGGACTCAGATGAGAC
ACACCCCACAGCTGCCACCGCCTTGTCCCTCAACAAGCTCACCCCCAATCCCTTGCAGCCAGGCCACAATGGGGGAGGTGAGTCCAGCCCCTTGGAACAGGCTTGCCCAACATGGAGGGATGGCGTTG
GCAGTGCCAGCCTCCCCAGCCTGTGCCAAGCTTCAACAGGGGCAAGAGGAGGGGCCGGCCCCTCCTCAGGAAGCTGGTATGAGTAAGGCCTTGAGGGTGCAGGCAGGCAGCCCTGTACCCCACCCACA
TAGACTATACTGTACATACAGATTTTGCAGTAGGCTTGGGGCAGCTGGGTTTGTCCTTGATGTATGATACTGTTATTATAATAATTATTATTATTCTGC

hide sequence

RefSeq Acc Id:

NM_006480 ⟹ NP_006471

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	5	177,357,924 - 177,372,596 (+)	NCBI
GRCh37	5	176,784,704 - 176,799,599 (+)	NCBI
Build 36	5	176,717,450 - 176,732,205 (+)	NCBI Archive
HuRef	5	171,705,499 - 171,720,237 (+)	ENTREZGENE
CHM1_1	5	176,217,893 - 176,232,649 (+)	NCBI
T2T-CHM13v2.0	5	177,901,146 - 177,915,812 (+)	NCBI

Sequence:

show sequence

CTCTCCACTGCCTGCCCGCCACCGTGCAAGCTCTGGCCGGCGCTGCCCACAGTCCCCATGGTGGGCAGCCCCCGCGGCGGGGACCCCTGATCGGCAGCGGCATGCCAGGGAAGCCCAAGCACCTGGGC
GTCCCCAACGGGCGCATGGTTCTGGCTGTGTCAGATGGAGAGCTGAGCAGCACGACGGGGCCCCAGGGCCAGGGCGAGGGCCGCGGCAGCTCTCTCAGCATCCACAGCCTCCCCAGTGGTCCCAGCAG
CCCCTTCCCAACCGAGGAGCAGCCTGTGGCCAGCTGGGCCCTGTCCTTCGAGCGGCTGTTGCAGGACCCGCTGGGCCTGGCTTACTTCACTGAGTTCCTGAAGAAGGAGTTCAGCGCGGAAAACGTGA
CTTTCTGGAAGGCCTGCGAGCGCTTCCAGCAGATCCCGGCCAGCGATACCCAGCAGCTAGCTCAGGAGGCCCGCAACATCTACCAGGAGTTCCTGTCCAGCCAGGCGCTGAGCCCAGTGAACATCGAC
CGTCAGGCCTGGCTTGGCGAGGAGGTGCTGGCCGAGCCCCGGCCGGACATGTTTCGGGCACAGCAGCTTCAGATCTTCAACTTGATGAAGTTCGACAGCTATGCGCGCTTCGTCAAGTCCCCGCTGTA
CCGCGAGTGCCTGCTAGCCGAAGCCGAGGGACGCCCTCTGCGGGAACCTGGCTCCTCGCGCCTCGGCAGCCCTGACGCCACGAGGAAGAAGCCGAAGCTGAAGCCCGGGAAGTCGCTGCCGCTGGGTG
TGGAGGAGTTGGGGCAGCTGCCACCCGTTGAGGGTCCTGGGGGCCGCCCTCTCCGCAAGTCCTTCCGCCGGGAGCTGGGCGGGACTGCAAACGCCGCCTTGCGCCGAGAGTCTCAGGGCTCCCTCAAC
TCCTCCGCCAGCCTGGACCTTGGCTTCCTAGCCTTCGTCAGCAGCAAATCTGAGAGCCACCGGAAGAGCCTTGGGAGCACGGAGGGTGAAAGTGAAAGCCGGCCAGGGAAGTACTGCTGTGTGTACCT
GCCCGATGGCACAGCCTCCTTGGCCCTGGCCAGACCTGGCCTCACCATCCGAGACATGCTGGCAGGGATCTGTGAGAAACGAGGCCTCTCTCTACCTGACATCAAGGTCTACCTGGTGGGCAATGAAC
AGGCCCTGGTCCTGGATCAGGACTGCACCGTGCTGGCGGATCAGGAAGTGCGGCTGGAAAACAGGATCACCTTCGAGCTGGAGCTGACGGCGCTGGAGCGCGTGGTACGAATCTCAGCCAAGCCCACC
AAGCGGCTGCAGGAGGCGCTGCAGCCCATTCTGGAGAAGCACGGCTTGAGCCCGCTAGAGGTGGTGCTGCACCGGCCAGGCGAGAAACAGCCTCTGGATCTGGGGAAGCTAGTGAGCTCGGTGGCGGC
CCAGAGACTGGTTTTGGACACTCTTCCAGGTGTGAAGATCTCCAAAGCCCGTGACAAATCTCCCTGCCGCAGCCAGGGCTGCCCACCTAGAACTCAGGATAAGGCCACCCATCCCCCTCCAGCGTCCC
CCAGTTCTCTGGTGAAGGTGCCCAGTAGTGCCACTGGAAAGCGGCAGACCTGTGACATCGAAGGCCTGGTGGAGCTGCTGAACCGGGTGCAGAGCAGCGGGGCCCACGACCAGAGGGGCCTTCTGAGG
AAAGAGGACCTGGTACTTCCAGAATTTCTGCAGCTGCCCGCCCAAGGGCCCAGCTCCGAGGAGACCCCACCACAGACCAAATCAGCAGCCCAGCCCATCGGGGGATCCTTGAACTCCACCACCGACTC
AGCCCTCTGACAGCTACCCAACAGTCCAGGACAGCTGCATGGCACCCGGCGGGCCGAGCATGCCATGGGTCCGCTCTGCATGCCCTGTCTGTGCCATGAGTGTCCCTGGCCCCTTCCTGCCATGGGCA
GGCCCGCAGGAAGAGCCGGTAGGGGTGGAAAGGGGACTCAGATGAGACACACCCCACAGCTGCCACCGCCTTGTCCCTCAACAAGCTCACCCCCAATCCCTTGCAGCCAGGCCACAATGGGGGAGGTG
AGTCCAGCCCCTTGGAACAGGCTTGCCCAACATGGAGGGATGGCGTTGGCAGTGCCAGCCTCCCCAGCCTGTGCCAAGCTTCAACAGGGGCAAGAGGAGGGGCCGGCCCCTCCTCAGGAAGCTGGTAT
GAGTAAGGCCTTGAGGGTGCAGGCAGGCAGCCCTGTACCCCACCCACATAGACTATACTGTACATACAGATTTTGCAGTAGGCTTGGGGCAGCTGGGTTTGTCCTTGATGTATGATACTGTTATTATA
ATAATTATTATTATTCTGC

hide sequence

RefSeq Acc Id:

XM_047416638 ⟹ XP_047272594

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	5	177,357,924 - 177,372,596 (+)	NCBI

RefSeq Acc Id:

XM_047416639 ⟹ XP_047272595

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	5	177,363,053 - 177,372,596 (+)	NCBI

RefSeq Acc Id:

XM_054351449 ⟹ XP_054207424

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
T2T-CHM13v2.0	5	177,901,146 - 177,915,812 (+)	NCBI

RefSeq Acc Id:

XM_054351450 ⟹ XP_054207425

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
T2T-CHM13v2.0	5	177,906,275 - 177,915,812 (+)	NCBI


Protein RefSeqs	NP_001353546	(Get FASTA)	NCBI Sequence Viewer
	NP_001353547	(Get FASTA)	NCBI Sequence Viewer
	NP_006471	(Get FASTA)	NCBI Sequence Viewer
	XP_047272594	(Get FASTA)	NCBI Sequence Viewer
	XP_047272595	(Get FASTA)	NCBI Sequence Viewer
	XP_054207424	(Get FASTA)	NCBI Sequence Viewer
	XP_054207425	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB92613	(Get FASTA)	NCBI Sequence Viewer
	AAB92614	(Get FASTA)	NCBI Sequence Viewer
	AAH14094	(Get FASTA)	NCBI Sequence Viewer
	AAM12650	(Get FASTA)	NCBI Sequence Viewer
	AAY26402	(Get FASTA)	NCBI Sequence Viewer
	BAC85600	(Get FASTA)	NCBI Sequence Viewer
	BAG53582	(Get FASTA)	NCBI Sequence Viewer
	EAW85011	(Get FASTA)	NCBI Sequence Viewer
	EAW85012	(Get FASTA)	NCBI Sequence Viewer
	EAW85013	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000386229
	ENSP00000386229.3
	ENSP00000422329
GenBank Protein	O43566	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_006471 ⟸ NM_006480
- Peptide Label:	isoform 1
- UniProtKB:	Q6ZWA4 (UniProtKB/Swiss-Prot), Q506M1 (UniProtKB/Swiss-Prot), O43565 (UniProtKB/Swiss-Prot), Q8TD62 (UniProtKB/Swiss-Prot), O43566 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MPGKPKHLGVPNGRMVLAVSDGELSSTTGPQGQGEGRGSSLSIHSLPSGPSSPFPTEEQPVASWALSFERLLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARNIYQEFLSS QALSPVNIDRQAWLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLYRECLLAEAEGRPLREPGSSRLGSPDATRKKPKLKPGKSLPLGVEELGQLPPVEGPGGRPLRKSFRRELGGTANAAL RRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQDCTVLADQEVRLENRITFELELTALER VVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPGEKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPSSLVKVPSSATGKRQTCDIEGLVELLNRVQSSG AHDQRGLLRKEDLVLPEFLQLPAQGPSSEETPPQTKSAAQPIGGSLNSTTDSAL hide sequence

RefSeq Acc Id:	NP_001353546 ⟸ NM_001366617
- Peptide Label:	isoform 2

RefSeq Acc Id:	NP_001353547 ⟸ NM_001366618
- Peptide Label:	isoform 3

Ensembl Acc Id:

ENSP00000422329 ⟸ ENST00000511890

Ensembl Acc Id:

ENSP00000386229 ⟸ ENST00000408923

Protein Domains

GoLoco RBD RGS

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O43566-F1-model_v2	AlphaFold	O43566	1-566	view protein structure

RGD ID:

6803504

Promoter ID:

HG_KWN:51901

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, K562, Lymphoblastoid, NB4

Transcripts:

ENST00000336477, ENST00000398128, NM_006480

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	5	176,717,139 - 176,717,639 (+)	MPROMDB

RGD ID:

6803505

Promoter ID:

HG_KWN:51902

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

K562

Transcripts:

UC003MGG.1, UC003MGH.1, UC003MGI.1

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	5	176,727,571 - 176,728,071 (+)	MPROMDB

RGD ID:

6803506

Promoter ID:

HG_KWN:51903

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, HeLa_S3, K562, Lymphoblastoid

Transcripts:

UC003MGJ.1

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	5	176,730,341 - 176,731,087 (+)	MPROMDB

RGD ID:

6871696

Promoter ID:

EPDNEW_H9013

Type:

multiple initiation site

Name:

RGS14_3

Description:

regulator of G protein signaling 14

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H9014 EPDNEW_H9015

Experiment Methods:

Single-end sequencing.; Paired-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	5	177,357,658 - 177,357,718	EPDNEW

RGD ID:

6871698

Promoter ID:

EPDNEW_H9014

Type:

initiation region

Name:

RGS14_1

Description:

regulator of G protein signaling 14

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H9013 EPDNEW_H9015

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	5	177,357,924 - 177,357,984	EPDNEW

RGD ID:

6871700

Promoter ID:

EPDNEW_H9015

Type:

initiation region

Name:

RGS14_2

Description:

regulator of G protein signaling 14

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H9013 EPDNEW_H9014

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	5	177,366,866 - 177,366,926	EPDNEW

Database	Acc Id	Source(s)
COSMIC	RGS14	COSMIC
Ensembl Genes	ENSG00000169220	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000408923	ENTREZGENE
	ENST00000408923.8	UniProtKB/Swiss-Prot
	ENST00000511890	ENTREZGENE
Gene3D-CATH	1.10.167.10	UniProtKB/Swiss-Prot
	1.10.196.10	UniProtKB/Swiss-Prot
	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/Swiss-Prot
GTEx	ENSG00000169220	GTEx
HGNC ID	HGNC:9996	ENTREZGENE
Human Proteome Map	RGS14	Human Proteome Map
InterPro	GoLoco_motif	UniProtKB/Swiss-Prot
	RBD1_RGS14	UniProtKB/Swiss-Prot
	RBD2_RGS14	UniProtKB/Swiss-Prot
	RBD_dom	UniProtKB/Swiss-Prot
	RGS	UniProtKB/Swiss-Prot
	RGS10/12/14-like	UniProtKB/Swiss-Prot
	RGS14_RGS	UniProtKB/Swiss-Prot
	RGS_sf	UniProtKB/Swiss-Prot
	RGS_subdom1/3	UniProtKB/Swiss-Prot
	RGS_subdomain_2	UniProtKB/Swiss-Prot
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot
KEGG Report	hsa:10636	UniProtKB/Swiss-Prot
NCBI Gene	10636	ENTREZGENE
OMIM	602513	OMIM
PANTHER	PTHR45945:SF2	UniProtKB/Swiss-Prot
	REGULATOR OF G-PROTEIN SIGNALING LOCO	UniProtKB/Swiss-Prot
Pfam	GoLoco	UniProtKB/Swiss-Prot
	RBD	UniProtKB/Swiss-Prot
	RGS	UniProtKB/Swiss-Prot
PharmGKB	PA34366	PharmGKB
PRINTS	RGSPROTEIN	UniProtKB/Swiss-Prot
PROSITE	GOLOCO	UniProtKB/Swiss-Prot
	RBD	UniProtKB/Swiss-Prot
	RGS	UniProtKB/Swiss-Prot
SMART	GoLoco	UniProtKB/Swiss-Prot
	RBD	UniProtKB/Swiss-Prot
	RGS	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48097	UniProtKB/Swiss-Prot
	SSF54236	UniProtKB/Swiss-Prot
UniProt	H0Y8W3	ENTREZGENE, UniProtKB/TrEMBL
	O43565	ENTREZGENE
	O43566	ENTREZGENE
	Q506M1	ENTREZGENE
	Q6ZWA4	ENTREZGENE
	Q8TD62	ENTREZGENE
	RGS14_HUMAN	UniProtKB/Swiss-Prot
UniProt Secondary	O43565	UniProtKB/Swiss-Prot
	Q506M1	UniProtKB/Swiss-Prot
	Q6ZWA4	UniProtKB/Swiss-Prot
	Q8TD62	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-04-18	RGS14	regulator of G protein signaling 14	RGS14	regulator of G-protein signaling 14	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Manual Human Phenotype Annotations - RGD

Send us a Message

Imported Disease Annotations - ClinVar

Manual Human Phenotype Annotations - RGD