Symbol:
PRSS8
Name:
serine protease 8
RGD ID:
730925
HGNC Page
HGNC:9491
Description:
Predicted to enable sodium channel regulator activity. Predicted to be involved in positive regulation of sodium ion transport and transepithelial transport. Predicted to act upstream of or within hair follicle development. Located in plasma membrane. Biomarker of breast carcinoma; ovarian cancer; and prostate carcinoma in situ.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
CAP1; channel-activating protease 1; channel-activating serine protease 1; prostasin; protease, serine 8; protease, serine, 8 (prostasin)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Prss8 (serine protease 8 (prostasin)) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Rattus norvegicus (Norway rat):
Prss8 (serine protease 8) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Prss8 (serine protease 8) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
PRSS8 (serine protease 8) NCBI
Ortholog
Canis lupus familiaris (dog):
PRSS8 (serine protease 8) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prss8 (serine protease 8) NCBI
Ortholog
Sus scrofa (pig):
PRSS8 (serine protease 8) HGNC
Ensembl, NCBI, OrthoDB
Chlorocebus sabaeus (green monkey):
PRSS8 (serine protease 8) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Prss8 (serine protease 8) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Prss30 (protease, serine, 30) HGNC
Treefam
Mus musculus (house mouse):
Prss30 (serine protease 30) HGNC
Treefam
Sus scrofa (pig):
HPN (hepsin) HGNC
Treefam
Rattus norvegicus (Norway rat):
Dpf3 (double PHD fingers 3) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Prss8 (serine protease 8)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Prss8 (serine protease 8 (prostasin))
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:dkey-16l2.17
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|PhylomeDB)
Danio rerio (zebrafish):
zgc:92313
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
prss8
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus laevis (African clawed frog):
prss8.S
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 31,131,433 - 31,135,727 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 31,131,433 - 31,135,727 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 31,142,754 - 31,147,048 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 31,050,255 - 31,054,652 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 31,050,256 - 31,054,652 NCBI Celera 16 29,150,870 - 29,155,267 (+) NCBI Celera Cytogenetic Map 16 p11.2 NCBI HuRef 16 28,703,907 - 28,708,304 (-) NCBI HuRef CHM1_1 16 32,460,477 - 32,464,874 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 31,518,914 - 31,523,208 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
PRSS8 Human (1->4)-beta-D-glucan multiple interactions ISO RGD:730926 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRSS8 mRNA CTD PMID:36331819 PRSS8 Human 1,1-dichloroethene decreases expression ISO RGD:730926 6480464 vinylidene chloride results in decreased expression of PRSS8 mRNA CTD PMID:26682919 PRSS8 Human 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:730926 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 PRSS8 Human 1,2-dichloroethane decreases expression ISO RGD:730926 6480464 ethylene dichloride results in decreased expression of PRSS8 mRNA CTD PMID:28960355 PRSS8 Human 1-naphthyl isothiocyanate increases expression ISO RGD:619973 6480464 1-Naphthylisothiocyanate results in increased expression of PRSS8 mRNA CTD PMID:30723492 PRSS8 Human 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PRSS8 mRNA CTD PMID:23019147|PMID:31614463 PRSS8 Human 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of PRSS8 mRNA CTD PMID:30165855 PRSS8 Human 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO RGD:619973 6480464 2,4,5,2',4',5'-hexachlorobiphenyl results in increased expression of PRSS8 mRNA CTD PMID:20959002 PRSS8 Human 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:730926 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 PRSS8 Human 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:619973 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of PRSS8 mRNA CTD PMID:31826744 PRSS8 Human 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:730926 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 PRSS8 Human 2,3,4,7,8-Pentachlorodibenzofuran decreases expression ISO RGD:619973 6480464 2,3,4,7,8-pentachlorodibenzofuran results in decreased expression of PRSS8 mRNA CTD PMID:21724226 PRSS8 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:619973 6480464 Tetrachlorodibenzodioxin affects the expression of PRSS8 mRNA CTD PMID:22298810 PRSS8 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PRSS8 mRNA CTD PMID:23152189 PRSS8 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:619973 6480464 Tetrachlorodibenzodioxin results in increased expression of PRSS8 mRNA CTD PMID:20959002 PRSS8 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:619973 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRSS8 mRNA CTD PMID:21724226|PMID:32109520 PRSS8 Human 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO RGD:619973 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of PRSS8 mRNA CTD PMID:21724226 PRSS8 Human 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:730926 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 PRSS8 Human 2,4-dinitrotoluene affects expression ISO RGD:619973 6480464 2,4-dinitrotoluene affects the expression of PRSS8 mRNA CTD PMID:21346803 PRSS8 Human 3,3',5,5'-tetrabromobisphenol A increases expression ISO RGD:619973 6480464 tetrabromobisphenol A results in increased expression of PRSS8 mRNA CTD PMID:27914987 PRSS8 Human 4,4'-sulfonyldiphenol increases expression ISO RGD:730926 6480464 bisphenol S results in increased expression of PRSS8 mRNA CTD PMID:30951980 PRSS8 Human 4,4'-sulfonyldiphenol affects methylation ISO RGD:730926 6480464 bisphenol S affects the methylation of PRSS8 gene CTD PMID:31683443 PRSS8 Human 4-hydroxyphenyl retinamide increases expression ISO RGD:730926 6480464 Fenretinide results in increased expression of PRSS8 mRNA CTD PMID:28973697 PRSS8 Human acetamide increases expression ISO RGD:619973 6480464 acetamide results in increased expression of PRSS8 mRNA CTD PMID:31881176 PRSS8 Human acrylamide decreases expression ISO RGD:619973 6480464 Acrylamide results in decreased expression of PRSS8 mRNA CTD PMID:28959563 PRSS8 Human afimoxifene multiple interactions EXP 6480464 afimoxifene inhibits the reaction [Estrogens results in decreased expression of PRSS8 mRNA] CTD PMID:21233418 PRSS8 Human aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of PRSS8 mRNA CTD PMID:27153756 PRSS8 Human aflatoxin B1 increases expression ISO RGD:619973 6480464 Aflatoxin B1 results in increased expression of PRSS8 mRNA CTD PMID:25378103 PRSS8 Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of PRSS8 mRNA CTD PMID:21934132 PRSS8 Human alpha-hexachlorocyclohexane increases expression ISO RGD:619973 6480464 alpha-hexachlorocyclohexane results in increased expression of PRSS8 mRNA CTD PMID:17785943 PRSS8 Human ammonium chloride affects expression ISO RGD:619973 6480464 Ammonium Chloride affects the expression of PRSS8 mRNA CTD PMID:16483693 PRSS8 Human Aroclor 1254 increases expression ISO RGD:730926 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of PRSS8 mRNA CTD PMID:23650126 PRSS8 Human arsane affects methylation EXP 6480464 Arsenic affects the methylation of PRSS8 gene CTD PMID:25304211 PRSS8 Human arsenic atom affects methylation EXP 6480464 Arsenic affects the methylation of PRSS8 gene CTD PMID:25304211 PRSS8 Human benzo[a]pyrene decreases methylation EXP 6480464 Benzo(a)pyrene results in decreased methylation of PRSS8 exon CTD PMID:27901495 PRSS8 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of PRSS8 promoter CTD PMID:27901495 PRSS8 Human benzo[b]fluoranthene increases expression ISO RGD:730926 6480464 benzo(b)fluoranthene results in increased expression of PRSS8 mRNA CTD PMID:26377693 PRSS8 Human beta-naphthoflavone multiple interactions ISO RGD:619973 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of PRSS8 mRNA CTD PMID:18164116 PRSS8 Human bisphenol A affects expression ISO RGD:619973 6480464 bisphenol A affects the expression of PRSS8 mRNA CTD PMID:25181051 PRSS8 Human bisphenol A decreases expression ISO RGD:730926 6480464 bisphenol A results in decreased expression of PRSS8 mRNA CTD PMID:35479511 PRSS8 Human bisphenol A increases expression ISO RGD:730926 6480464 bisphenol A results in increased expression of PRSS8 mRNA CTD PMID:30951980|PMID:32156529|PMID:34585602 PRSS8 Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PRSS8 mRNA CTD PMID:30903817 PRSS8 Human bisphenol F increases expression ISO RGD:730926 6480464 bisphenol F results in increased expression of PRSS8 mRNA CTD PMID:30951980 PRSS8 Human bisphenol F decreases expression ISO RGD:730926 6480464 bisphenol F results in decreased expression of PRSS8 mRNA CTD PMID:38685157 PRSS8 Human cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of PRSS8 mRNA CTD PMID:24376830 PRSS8 Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of PRSS8 mRNA CTD PMID:38568856 PRSS8 Human carbon nanotube decreases expression ISO RGD:730926 6480464 Nanotubes, Carbon analog results in decreased expression of PRSS8 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681|PMID:25620056 PRSS8 Human choline multiple interactions ISO RGD:730926 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B more ... CTD PMID:20938992|PMID:33549593 PRSS8 Human copper atom multiple interactions EXP 6480464 [Disulfiram binds to Copper] which results in decreased expression of PRSS8 mRNA CTD PMID:24690739 PRSS8 Human copper(0) multiple interactions EXP 6480464 [Disulfiram binds to Copper] which results in decreased expression of PRSS8 mRNA CTD PMID:24690739 PRSS8 Human copper(II) chloride decreases expression EXP 6480464 cupric chloride results in decreased expression of PRSS8 mRNA CTD PMID:38568856 PRSS8 Human copper(II) sulfate increases expression EXP 6480464 Copper Sulfate results in increased expression of PRSS8 mRNA CTD PMID:19549813 PRSS8 Human coumestrol multiple interactions EXP 6480464 [Coumestrol co-treated with resveratrol] results in decreased expression of PRSS8 mRNA CTD PMID:19167446 PRSS8 Human coumestrol decreases expression EXP 6480464 Coumestrol results in decreased expression of PRSS8 mRNA CTD PMID:19167446 PRSS8 Human cyanocob(III)alamin multiple interactions ISO RGD:730926 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B more ... CTD PMID:33549593 PRSS8 Human cyclosporin A affects expression EXP 6480464 Cyclosporine affects the expression of PRSS8 mRNA CTD PMID:25562108 PRSS8 Human DDE decreases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of PRSS8 mRNA CTD PMID:38568856 PRSS8 Human decabromodiphenyl ether increases expression ISO RGD:619973 6480464 decabromobiphenyl ether results in increased expression of PRSS8 mRNA CTD PMID:23914054 PRSS8 Human diethyl maleate decreases expression ISO RGD:619973 6480464 diethyl maleate results in decreased expression of PRSS8 mRNA CTD PMID:21161181 PRSS8 Human diethyl phthalate decreases expression ISO RGD:619973 6480464 diethyl phthalate results in decreased expression of PRSS8 mRNA CTD PMID:32341500 PRSS8 Human disulfiram multiple interactions EXP 6480464 [Disulfiram binds to Copper] which results in decreased expression of PRSS8 mRNA CTD PMID:24690739 PRSS8 Human diuron decreases expression ISO RGD:619973 6480464 Diuron results in decreased expression of PRSS8 mRNA CTD PMID:21551480 PRSS8 Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 PRSS8 Human elemental selenium increases expression EXP 6480464 Selenium results in increased expression of PRSS8 mRNA CTD PMID:19244175 PRSS8 Human endosulfan decreases expression ISO RGD:619973 6480464 Endosulfan results in decreased expression of PRSS8 mRNA CTD PMID:29391264 PRSS8 Human entinostat increases expression EXP 6480464 entinostat results in increased expression of PRSS8 mRNA CTD PMID:26272509 PRSS8 Human entinostat multiple interactions EXP 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 PRSS8 Human epoxiconazole decreases expression ISO RGD:730926 6480464 epoxiconazole results in decreased expression of PRSS8 mRNA CTD PMID:35436446 PRSS8 Human ethanol multiple interactions ISO RGD:619973 6480464 [Fish Oils co-treated with Ethanol] results in increased expression of PRSS8 mRNA CTD PMID:17347304 PRSS8 Human flavonoids increases expression ISO RGD:619973 6480464 Flavonoids results in increased expression of PRSS8 mRNA CTD PMID:18035473 PRSS8 Human folic acid multiple interactions ISO RGD:730926 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B more ... CTD PMID:20938992|PMID:33549593 PRSS8 Human folpet decreases expression ISO RGD:730926 6480464 folpet results in decreased expression of PRSS8 mRNA CTD PMID:31558096 PRSS8 Human genistein multiple interactions EXP 6480464 ESR2 promotes the reaction [Genistein results in decreased expression of PRSS8 protein] CTD PMID:20884965 PRSS8 Human genistein decreases expression EXP 6480464 Genistein results in decreased expression of PRSS8 protein CTD PMID:20884965 PRSS8 Human glycine betaine multiple interactions ISO RGD:730926 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B more ... CTD PMID:33549593 PRSS8 Human inulin multiple interactions ISO RGD:730926 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PRSS8 mRNA CTD PMID:36331819 PRSS8 Human isotretinoin decreases expression EXP 6480464 Isotretinoin results in decreased expression of PRSS8 mRNA CTD PMID:20436886 PRSS8 Human L-methionine multiple interactions ISO RGD:730926 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B more ... CTD PMID:20938992|PMID:33549593 PRSS8 Human lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of PRSS8 mRNA CTD PMID:38568856 PRSS8 Human mercury dibromide increases expression EXP 6480464 mercuric bromide results in increased expression of PRSS8 mRNA CTD PMID:26272509 PRSS8 Human mercury dibromide multiple interactions EXP 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 PRSS8 Human Muraglitazar decreases expression ISO RGD:619973 6480464 muraglitazar results in decreased expression of PRSS8 mRNA CTD PMID:21515302 PRSS8 Human N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PRSS8 mRNA CTD PMID:24810058 PRSS8 Human N-methyl-4-phenylpyridinium decreases expression ISO RGD:619973 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PRSS8 mRNA CTD PMID:28801915 PRSS8 Human N-nitrosodiethylamine multiple interactions ISO RGD:619973 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of PRSS8 mRNA CTD PMID:18164116 PRSS8 Human N-nitrosodiethylamine increases expression ISO RGD:730926 6480464 Diethylnitrosamine results in increased expression of PRSS8 mRNA CTD PMID:24535843 PRSS8 Human nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of PRSS8 mRNA CTD PMID:24768652 PRSS8 Human nickel sulfate increases expression EXP 6480464 nickel sulfate results in increased expression of PRSS8 mRNA CTD PMID:18651567 PRSS8 Human okadaic acid increases expression EXP 6480464 Okadaic Acid results in increased expression of PRSS8 mRNA CTD PMID:38832940 PRSS8 Human panobinostat multiple interactions EXP 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 PRSS8 Human panobinostat increases expression EXP 6480464 panobinostat results in increased expression of PRSS8 mRNA CTD PMID:26272509 PRSS8 Human PCB138 multiple interactions ISO RGD:730926 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 PRSS8 Human perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:730926 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRSS8 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 PRSS8 Human perfluorooctanoic acid decreases expression ISO RGD:619973 6480464 perfluorooctanoic acid results in decreased expression of PRSS8 mRNA CTD PMID:28511854 PRSS8 Human phenobarbital multiple interactions ISO RGD:730926 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B more ... CTD PMID:19482888|PMID:33549593 PRSS8 Human phenobarbital affects expression ISO RGD:730926 6480464 Phenobarbital affects the expression of PRSS8 mRNA CTD PMID:19136022|PMID:23091169 PRSS8 Human phenobarbital increases expression ISO RGD:730926 6480464 Phenobarbital results in increased expression of PRSS8 mRNA CTD PMID:19270015|PMID:19482888|PMID:31836555|PMID:33549593 PRSS8 Human phenylmercury acetate increases expression EXP 6480464 Phenylmercuric Acetate results in increased expression of PRSS8 mRNA CTD PMID:26272509 PRSS8 Human phenylmercury acetate multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 PRSS8 Human pirinixic acid affects expression ISO RGD:730926 6480464 pirinixic acid affects the expression of PRSS8 mRNA CTD PMID:19136022|PMID:23811191 PRSS8 Human propiconazole increases expression ISO RGD:730926 6480464 propiconazole results in increased expression of PRSS8 mRNA CTD PMID:21278054 PRSS8 Human resveratrol multiple interactions EXP 6480464 [Coumestrol co-treated with resveratrol] results in decreased expression of PRSS8 mRNA CTD PMID:19167446 PRSS8 Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 PRSS8 Human selenium atom increases expression EXP 6480464 Selenium results in increased expression of PRSS8 mRNA CTD PMID:19244175 PRSS8 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of PRSS8 mRNA CTD PMID:12634122|PMID:38568856 PRSS8 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of PRSS8 mRNA CTD PMID:38568856 PRSS8 Human sodium dodecyl sulfate increases expression EXP 6480464 Sodium Dodecyl Sulfate results in increased expression of PRSS8 mRNA CTD PMID:31734321 PRSS8 Human sunitinib decreases expression EXP 6480464 Sunitinib results in decreased expression of PRSS8 mRNA CTD PMID:31533062 PRSS8 Human tamoxifen decreases expression ISO RGD:730926 6480464 Tamoxifen results in decreased expression of PRSS8 mRNA CTD PMID:25123088 PRSS8 Human Tesaglitazar decreases expression ISO RGD:619973 6480464 tesaglitazar results in decreased expression of PRSS8 mRNA CTD PMID:21515302 PRSS8 Human tetrachloromethane decreases expression ISO RGD:730926 6480464 Carbon Tetrachloride results in decreased expression of PRSS8 mRNA CTD PMID:31919559 PRSS8 Human thioacetamide increases expression ISO RGD:619973 6480464 Thioacetamide results in increased expression of PRSS8 mRNA CTD PMID:23411599 PRSS8 Human trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of PRSS8 mRNA CTD PMID:24935251|PMID:26272509 PRSS8 Human trichostatin A multiple interactions EXP 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 PRSS8 Human Triptolide decreases expression ISO RGD:730926 6480464 triptolide results in decreased expression of PRSS8 mRNA CTD PMID:32835833 PRSS8 Human triptonide increases expression ISO RGD:730926 6480464 triptonide results in increased expression of PRSS8 mRNA CTD PMID:33045310 PRSS8 Human urethane decreases expression EXP 6480464 Urethane results in decreased expression of PRSS8 mRNA CTD PMID:28818685 PRSS8 Human valproic acid affects expression ISO RGD:730926 6480464 Valproic Acid affects the expression of PRSS8 mRNA CTD PMID:17292431 PRSS8 Human valproic acid multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 PRSS8 Human valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of PRSS8 gene CTD PMID:29154799 PRSS8 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of PRSS8 mRNA CTD PMID:23179753|PMID:24383497|PMID:24935251|PMID:26272509 PRSS8 Human vinclozolin decreases methylation ISO RGD:619973 6480464 vinclozolin results in decreased methylation of PRSS8 gene CTD PMID:31079544 PRSS8 Human zinc atom multiple interactions ISO RGD:730926 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B more ... CTD PMID:33549593 PRSS8 Human zinc(0) multiple interactions ISO RGD:730926 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B more ... CTD PMID:33549593
(1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dichloroethane (ISO) 1-naphthyl isothiocyanate (ISO) 17beta-estradiol (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,4,7,8-Pentachlorodibenzofuran (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4,4'-trichlorobiphenyl (ISO) 2,4-dinitrotoluene (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acetamide (ISO) acrylamide (ISO) afimoxifene (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (EXP) alpha-hexachlorocyclohexane (ISO) ammonium chloride (ISO) Aroclor 1254 (ISO) arsane (EXP) arsenic atom (EXP) benzo[a]pyrene (EXP) benzo[b]fluoranthene (ISO) beta-naphthoflavone (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (EXP) cadmium dichloride (EXP) carbon nanotube (ISO) choline (ISO) copper atom (EXP) copper(0) (EXP) copper(II) chloride (EXP) copper(II) sulfate (EXP) coumestrol (EXP) cyanocob(III)alamin (ISO) cyclosporin A (EXP) DDE (EXP) decabromodiphenyl ether (ISO) diethyl maleate (ISO) diethyl phthalate (ISO) disulfiram (EXP) diuron (ISO) dorsomorphin (EXP) elemental selenium (EXP) endosulfan (ISO) entinostat (EXP) epoxiconazole (ISO) ethanol (ISO) flavonoids (ISO) folic acid (ISO) folpet (ISO) genistein (EXP) glycine betaine (ISO) inulin (ISO) isotretinoin (EXP) L-methionine (ISO) lead diacetate (EXP) mercury dibromide (EXP) Muraglitazar (ISO) N-methyl-4-phenylpyridinium (EXP,ISO) N-nitrosodiethylamine (ISO) nickel atom (EXP) nickel sulfate (EXP) okadaic acid (EXP) panobinostat (EXP) PCB138 (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phenylmercury acetate (EXP) pirinixic acid (ISO) propiconazole (ISO) resveratrol (EXP) SB 431542 (EXP) selenium atom (EXP) sodium arsenite (EXP) sodium dodecyl sulfate (EXP) sunitinib (EXP) tamoxifen (ISO) Tesaglitazar (ISO) tetrachloromethane (ISO) thioacetamide (ISO) trichostatin A (EXP) Triptolide (ISO) triptonide (ISO) urethane (EXP) valproic acid (EXP,ISO) vinclozolin (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Prostasin serine protease inhibits breast cancer invasiveness and is transcriptionally regulated by promoter DNA methylation.
Chen LM and Chai KX, Int J Cancer. 2002 Jan 20;97(3):323-9.
2.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
3.
Blood-borne RT-PCR assay for prostasin- specific transcripts to identify circulating prostate cells in cancer patients.
Laribi A, etal., Eur Urol. 2001 Jan;39(1):65-71.
4.
Prostasin, a potential serum marker for ovarian cancer: identification through microarray technology.
Mok SC, etal., J Natl Cancer Inst. 2001 Oct 3;93(19):1458-64.
5.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
6.
The mouse frizzy (fr) and rat 'hairless' (frCR) mutations are natural variants of protease serine S1 family member 8 (Prss8).
Spacek DV, etal., Exp Dermatol. 2010 Jun;19(6):527-32. doi: 10.1111/j.1600-0625.2009.01054.x. Epub 2010 Feb 25.
7.
Down-regulated expression of prostasin in high-grade or hormone-refractory human prostate cancers.
Takahashi S, etal., Prostate. 2003 Feb 15;54(3):187-93.
PRSS8 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 31,131,433 - 31,135,727 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 31,131,433 - 31,135,727 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 31,142,754 - 31,147,048 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 31,050,255 - 31,054,652 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 31,050,256 - 31,054,652 NCBI Celera 16 29,150,870 - 29,155,267 (+) NCBI Celera Cytogenetic Map 16 p11.2 NCBI HuRef 16 28,703,907 - 28,708,304 (-) NCBI HuRef CHM1_1 16 32,460,477 - 32,464,874 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 31,518,914 - 31,523,208 (-) NCBI T2T-CHM13v2.0
Prss8 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 127,524,889 - 127,529,266 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 127,524,888 - 127,529,276 (-) Ensembl GRCm39 Ensembl GRCm38 7 127,925,717 - 127,930,149 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 127,925,716 - 127,930,104 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 135,069,231 - 135,073,627 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 127,716,865 - 127,721,242 (-) NCBI MGSCv36 mm8 Celera 7 127,760,906 - 127,765,302 (-) NCBI Celera Cytogenetic Map 7 F3 NCBI cM Map 7 69.84 NCBI
Prss8 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 191,966,701 - 191,971,271 (-) NCBI GRCr8 mRatBN7.2 1 182,536,229 - 182,540,745 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 182,536,229 - 182,540,815 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 190,886,770 - 190,891,286 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 198,072,862 - 198,077,378 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 190,743,263 - 190,747,782 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 199,372,519 - 199,377,035 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 199,372,519 - 199,377,035 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 206,395,299 - 206,399,815 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 187,210,556 - 187,215,072 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 187,360,436 - 187,364,953 (-) NCBI Celera 1 180,187,038 - 180,191,554 (-) NCBI Celera Cytogenetic Map 1 q37 NCBI
Prss8 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955493 7,971,609 - 7,976,666 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955493 7,970,929 - 7,976,885 (-) NCBI ChiLan1.0 ChiLan1.0
PRSS8 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 34,337,449 - 34,341,801 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 39,138,848 - 39,143,190 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 23,833,127 - 23,837,466 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 31,500,225 - 31,504,555 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 31,500,225 - 31,504,623 (-) Ensembl panpan1.1 panPan2
PRSS8 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 17,110,251 - 17,114,564 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 17,110,300 - 17,114,816 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 18,685,630 - 18,689,940 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 17,241,173 - 17,245,485 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 17,241,217 - 17,244,733 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 17,041,381 - 17,045,690 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 16,960,412 - 16,964,722 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 17,272,597 - 17,276,908 (+) NCBI UU_Cfam_GSD_1.0
Prss8 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 125,389,779 - 125,393,813 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936501 13,485,310 - 13,491,905 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936501 13,487,863 - 13,491,837 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRSS8 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 17,357,802 - 17,362,220 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 17,357,793 - 17,362,223 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 17,510,112 - 17,514,539 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRSS8 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 27,820,898 - 27,827,873 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 27,817,830 - 27,824,926 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666068 1,641,573 - 1,646,053 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prss8
.
Predicted Target Of
Count of predictions: 1850 Count of miRNA genes: 830 Interacting mature miRNAs: 1013 Transcripts: ENST00000317508, ENST00000564025, ENST00000567531, ENST00000567797, ENST00000567833, ENST00000568261 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
D16S3336
Human Assembly Chr Position (strand) Source JBrowse GRCh37 16 31,142,777 - 31,142,930 UniSTS GRCh37 Build 36 16 31,050,278 - 31,050,431 RGD NCBI36 Celera 16 29,155,091 - 29,155,244 RGD Cytogenetic Map 16 p11.2 UniSTS HuRef 16 28,703,930 - 28,704,083 UniSTS
RH69053
Human Assembly Chr Position (strand) Source JBrowse GRCh37 16 31,143,002 - 31,143,162 UniSTS GRCh37 Build 36 16 31,050,503 - 31,050,663 RGD NCBI36 Celera 16 29,154,859 - 29,155,019 RGD Cytogenetic Map 16 p11.2 UniSTS HuRef 16 28,704,155 - 28,704,315 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1173
2400
2679
2118
4768
1694
2319
6
603
1523
444
2210
6667
5868
41
3565
1
850
1729
1605
174
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000317508 ⟹ ENSP00000319730
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 31,131,433 - 31,135,727 (-) Ensembl
Ensembl Acc Id:
ENST00000564025
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 31,133,200 - 31,135,727 (-) Ensembl
Ensembl Acc Id:
ENST00000567531 ⟹ ENSP00000457673
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 31,132,439 - 31,135,640 (-) Ensembl
Ensembl Acc Id:
ENST00000567797 ⟹ ENSP00000458056
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 31,132,879 - 31,135,727 (-) Ensembl
Ensembl Acc Id:
ENST00000567833
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 31,134,042 - 31,135,703 (-) Ensembl
Ensembl Acc Id:
ENST00000568261 ⟹ ENSP00000457750
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 31,131,894 - 31,135,727 (-) Ensembl
RefSeq Acc Id:
NM_002773 ⟹ NP_002764
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 16 31,131,433 - 31,135,727 (-) NCBI GRCh37 16 31,142,754 - 31,147,151 (-) ENTREZGENE Build 36 16 31,050,255 - 31,054,652 (-) NCBI Archive HuRef 16 28,703,907 - 28,708,304 (-) ENTREZGENE CHM1_1 16 32,460,477 - 32,464,806 (-) NCBI T2T-CHM13v2.0 16 31,518,914 - 31,523,208 (-) NCBI
Sequence:
AGACGGTGCTGGTGACTCGTCCACACTGCTCGCTTCGGATACTCCAGGCGTCTCCCGTTGCGGCCGCTCCCTGCCTTAGAGGCCAGCCTTGGACACTTGCTGCCCCTTTCCAGCCCGGATTCTGGGAT
hide sequence
RefSeq Acc Id:
NP_002764 ⟸ NM_002773
- Peptide Label:
preproprotein
- UniProtKB:
B4DWP2 (UniProtKB/Swiss-Prot), Q9UCA3 (UniProtKB/Swiss-Prot), Q16651 (UniProtKB/Swiss-Prot)
- Sequence:
MAQKGVLGPGQLGAVAILLYLGLLRSGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQ
hide sequence
Ensembl Acc Id:
ENSP00000319730 ⟸ ENST00000317508
Ensembl Acc Id:
ENSP00000458056 ⟸ ENST00000567797
Ensembl Acc Id:
ENSP00000457673 ⟸ ENST00000567531
Ensembl Acc Id:
ENSP00000457750 ⟸ ENST00000568261
RGD ID: 6793395 Promoter ID: HG_KWN:23605 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562 Transcripts: ENST00000317508, NM_002773 Position: Human Assembly Chr Position (strand) Source Build 36 16 31,054,356 - 31,054,856 (-) MPROMDB
RGD ID: 6851816 Promoter ID: EP73713 Type: initiation region Name: HS_PRSS8 Description: Protease, serine, 8 (prostasin). SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: NEDO full length human cDNA sequencing project.; Oligo-capping Position: Human Assembly Chr Position (strand) Source Build 36 16 31,054,549 - 31,054,609 EPD
RGD ID: 7232081 Promoter ID: EPDNEW_H21786 Type: initiation region Name: PRSS8_1 Description: protease, serine 8 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 16 31,135,727 - 31,135,787 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2018-01-23
PRSS8
serine protease 8
PRSS8
protease, serine 8
Symbol and/or name change
5135510 APPROVED
2015-11-24
PRSS8
protease, serine 8
PRSS8
protease, serine, 8
Symbol and/or name change
5135510 APPROVED
