Symbol:
Ddx24
Name:
DEAD-box helicase 24
RGD ID:
727929
Description:
Predicted to enable several functions, including ATP binding activity; RNA binding activity; and RNA helicase activity. Predicted to be active in nucleolus. Orthologous to human DDX24 (DEAD-box helicase 24); PARTICIPATES IN ribosome biogenesis pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
ATP-dependent RNA helicase DDX24; ATP-dependent RNA helicase DDX24-like; DEAD (Asp-Glu-Ala-Asp) box helicase 24; DEAD (Asp-Glu-Ala-Asp) box polypeptide 24; LOC100909476
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DDX24 (DEAD-box helicase 24) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ddx24 (DEAD box helicase 24) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ddx24 (DEAD-box helicase 24) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DDX24 (DEAD-box helicase 24) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DDX24 (DEAD-box helicase 24) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ddx24 (DEAD-box helicase 24) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DDX24 (DEAD-box helicase 24) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DDX24 (DEAD-box helicase 24) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ddx24 (DEAD-box helicase 24) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PRPF19 (pre-mRNA processing factor 19) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
DDX24 (DEAD-box helicase 24)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ddx24 (DEAD box helicase 24)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ddx24 (DEAD (Asp-Glu-Ala-Asp) box helicase 24)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F55F8.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
MAK5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ddx24
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 128,329,554 - 128,346,818 (-) NCBI GRCr8 mRatBN7.2 6 122,564,767 - 122,582,032 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 122,564,767 - 122,581,927 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 122,705,614 - 122,722,897 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 123,000,876 - 123,018,159 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 122,335,418 - 122,352,763 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 127,302,201 - 127,319,382 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 127,302,201 - 127,319,362 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 128,996,616 - 129,001,614 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 136,522,732 - 136,539,906 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 127,699,436 - 127,716,597 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 127,703,182 - 127,720,344 (-) NCBI Celera 6 120,045,460 - 120,062,621 (-) NCBI Celera Cytogenetic Map 6 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ddx24 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of DDX24 mRNA] CTD PMID:31150632 Ddx24 Rat (1->4)-beta-D-glucan multiple interactions ISO Ddx24 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DDX24 mRNA CTD PMID:36331819 Ddx24 Rat 1,2-dimethylhydrazine increases expression ISO Ddx24 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of DDX24 mRNA CTD PMID:22206623 Ddx24 Rat 17alpha-ethynylestradiol increases expression ISO Ddx24 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of DDX24 mRNA CTD PMID:17942748 Ddx24 Rat 17alpha-ethynylestradiol multiple interactions ISO Ddx24 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DDX24 mRNA CTD PMID:17942748 Ddx24 Rat 17beta-estradiol affects expression ISO Ddx24 (Mus musculus) 6480464 Estradiol affects the expression of DDX24 mRNA CTD PMID:15598610 Ddx24 Rat 17beta-estradiol increases expression ISO DDX24 (Homo sapiens) 6480464 Estradiol results in increased expression of DDX24 mRNA CTD PMID:31614463 Ddx24 Rat 17beta-estradiol decreases expression ISO Ddx24 (Mus musculus) 6480464 Estradiol results in decreased expression of DDX24 mRNA CTD PMID:39298647 Ddx24 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ddx24 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DDX24 mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to DDX24 promoter] CTD PMID:17942748 and PMID:19654925 Ddx24 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DDX24 mRNA CTD PMID:33387578 Ddx24 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of DDX24 mRNA CTD PMID:34747641 Ddx24 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO DDX24 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of DDX24 mRNA CTD PMID:22903824 Ddx24 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ddx24 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DDX24 mRNA CTD PMID:21570461 Ddx24 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of DDX24 mRNA CTD PMID:21346803 Ddx24 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of DDX24 mRNA CTD PMID:21346803 Ddx24 Rat 2-methylcholine affects expression ISO DDX24 (Homo sapiens) 6480464 beta-methylcholine affects the expression of DDX24 mRNA CTD PMID:21179406 Ddx24 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Ddx24 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of DDX24 mRNA CTD PMID:26251327 Ddx24 Rat 4,4'-sulfonyldiphenol increases expression ISO Ddx24 (Mus musculus) 6480464 bisphenol S results in increased expression of DDX24 mRNA CTD PMID:39298647 Ddx24 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of DDX24 mRNA CTD PMID:21346803 Ddx24 Rat arachidonic acid decreases expression ISO DDX24 (Homo sapiens) 6480464 Arachidonic Acid results in decreased expression of DDX24 mRNA CTD PMID:16704987 Ddx24 Rat benzo[a]pyrene diol epoxide I decreases expression ISO DDX24 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Ddx24 Rat beta-lapachone increases expression ISO DDX24 (Homo sapiens) 6480464 beta-lapachone results in increased expression of DDX24 mRNA CTD PMID:38218311 Ddx24 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DDX24 mRNA CTD PMID:18180321 Ddx24 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of DDX24 gene CTD PMID:28505145 Ddx24 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DDX24 mRNA CTD PMID:25181051 more ... Ddx24 Rat Bisphenol B increases expression ISO DDX24 (Homo sapiens) 6480464 bisphenol B results in increased expression of DDX24 protein CTD PMID:34186270 Ddx24 Rat bisphenol F increases expression ISO DDX24 (Homo sapiens) 6480464 bisphenol F results in increased expression of DDX24 protein CTD PMID:34186270 Ddx24 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of DDX24 mRNA CTD PMID:19167457 Ddx24 Rat cadmium dichloride decreases expression ISO DDX24 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of DDX24 mRNA CTD PMID:25596134 Ddx24 Rat caffeine decreases phosphorylation ISO DDX24 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of DDX24 protein CTD PMID:35688186 Ddx24 Rat chloroacetaldehyde decreases expression ISO DDX24 (Homo sapiens) 6480464 chloroacetaldehyde results in decreased expression of DDX24 mRNA CTD PMID:25596134 Ddx24 Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of DDX24 mRNA CTD PMID:23125180 Ddx24 Rat cisplatin increases expression ISO DDX24 (Homo sapiens) 6480464 Cisplatin results in increased expression of DDX24 mRNA CTD PMID:25596134 Ddx24 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of DDX24 mRNA CTD PMID:17602206 Ddx24 Rat coumarin affects phosphorylation ISO DDX24 (Homo sapiens) 6480464 coumarin affects the phosphorylation of DDX24 protein CTD PMID:35688186 Ddx24 Rat crocidolite asbestos decreases expression ISO Ddx24 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of DDX24 mRNA CTD PMID:29279043 Ddx24 Rat cyclosporin A increases expression ISO DDX24 (Homo sapiens) 6480464 Cyclosporine results in increased expression of DDX24 mRNA CTD PMID:25596134 Ddx24 Rat Dibutyl phosphate affects expression ISO DDX24 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of DDX24 mRNA CTD PMID:37042841 Ddx24 Rat dibutyl phthalate decreases expression ISO Ddx24 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of DDX24 mRNA CTD PMID:21266533 Ddx24 Rat elemental selenium multiple interactions ISO DDX24 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of DDX24 mRNA CTD PMID:19244175 Ddx24 Rat elemental selenium decreases expression ISO DDX24 (Homo sapiens) 6480464 Selenium results in decreased expression of DDX24 mRNA CTD PMID:19244175 Ddx24 Rat epoxiconazole decreases expression ISO Ddx24 (Mus musculus) 6480464 epoxiconazole results in decreased expression of DDX24 mRNA CTD PMID:35436446 Ddx24 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of DDX24 mRNA CTD PMID:17618662 Ddx24 Rat ethanol affects splicing ISO Ddx24 (Mus musculus) 6480464 Ethanol affects the splicing of DDX24 mRNA CTD PMID:30319688 Ddx24 Rat ethanol multiple interactions EXP 6480464 [Dronabinol co-treated with Ethanol] results in increased expression of DDX24 mRNA CTD PMID:17618662 Ddx24 Rat fenofibrate decreases expression EXP 6480464 Fenofibrate results in decreased expression of DDX24 mRNA CTD PMID:25596134 Ddx24 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of DDX24 mRNA CTD PMID:24136188 Ddx24 Rat FR900359 affects phosphorylation ISO DDX24 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of DDX24 protein CTD PMID:37730182 Ddx24 Rat hexadecanoic acid decreases phosphorylation ISO DDX24 (Homo sapiens) 6480464 Palmitic Acid results in decreased phosphorylation of DDX24 protein CTD PMID:28073184 Ddx24 Rat lead(0) decreases expression ISO DDX24 (Homo sapiens) 6480464 Lead results in decreased expression of DDX24 mRNA CTD PMID:19921347 Ddx24 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of DDX24 mRNA CTD PMID:25596134 Ddx24 Rat methylmercury chloride increases expression ISO DDX24 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of DDX24 mRNA CTD PMID:28001369 Ddx24 Rat N-methyl-4-phenylpyridinium decreases expression ISO DDX24 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of DDX24 protein CTD PMID:24806433 Ddx24 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of DDX24 mRNA CTD PMID:17602206 Ddx24 Rat nitrates multiple interactions ISO Ddx24 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of DDX24 mRNA CTD PMID:35964746 Ddx24 Rat ochratoxin A increases expression ISO DDX24 (Homo sapiens) 6480464 ochratoxin A results in increased expression of DDX24 mRNA CTD PMID:30559759 Ddx24 Rat ozone multiple interactions ISO DDX24 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of DDX24 mRNA CTD PMID:35430440 Ddx24 Rat paracetamol affects expression ISO Ddx24 (Mus musculus) 6480464 Acetaminophen affects the expression of DDX24 mRNA CTD PMID:17562736 Ddx24 Rat pentachlorophenol increases expression ISO Ddx24 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of DDX24 mRNA CTD PMID:23892564 Ddx24 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ddx24 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DDX24 mRNA CTD PMID:36331819 Ddx24 Rat pirinixic acid multiple interactions ISO DDX24 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of DDX24 mRNA CTD PMID:19710929 Ddx24 Rat selenium atom multiple interactions ISO DDX24 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of DDX24 mRNA CTD PMID:19244175 Ddx24 Rat selenium atom decreases expression ISO DDX24 (Homo sapiens) 6480464 Selenium results in decreased expression of DDX24 mRNA CTD PMID:19244175 Ddx24 Rat sodium arsenite increases expression ISO DDX24 (Homo sapiens) 6480464 sodium arsenite results in increased expression of DDX24 mRNA CTD PMID:28595984 more ... Ddx24 Rat testosterone enanthate affects expression ISO DDX24 (Homo sapiens) 6480464 testosterone enanthate affects the expression of DDX24 mRNA CTD PMID:17440010 Ddx24 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of DDX24 mRNA CTD PMID:31150632 Ddx24 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of DDX24 mRNA] CTD PMID:31150632 Ddx24 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of DDX24 mRNA CTD PMID:23411599 Ddx24 Rat titanium dioxide decreases methylation ISO Ddx24 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DDX24 promoter alternative form CTD PMID:35295148 Ddx24 Rat triacsin C decreases expression ISO DDX24 (Homo sapiens) 6480464 triacsin C results in decreased expression of DDX24 mRNA CTD PMID:16704987 Ddx24 Rat trichloroethene decreases expression ISO Ddx24 (Mus musculus) 6480464 Trichloroethylene results in decreased expression of DDX24 mRNA CTD PMID:19448997 Ddx24 Rat triptonide increases expression ISO Ddx24 (Mus musculus) 6480464 triptonide results in increased expression of DDX24 mRNA CTD PMID:33045310 Ddx24 Rat tungsten decreases expression ISO Ddx24 (Mus musculus) 6480464 Tungsten results in decreased expression of DDX24 mRNA CTD PMID:30912803 Ddx24 Rat valproic acid decreases methylation ISO DDX24 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of DDX24 gene CTD PMID:29154799 Ddx24 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of DDX24 mRNA CTD PMID:19015723 Ddx24 Rat vitamin E multiple interactions ISO DDX24 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of DDX24 mRNA CTD PMID:19244175 Ddx24 Rat vitamin E decreases expression ISO DDX24 (Homo sapiens) 6480464 Vitamin E results in decreased expression of DDX24 mRNA CTD PMID:19244175
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) arachidonic acid (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bisphenol A (EXP) Bisphenol B (ISO) bisphenol F (ISO) C60 fullerene (EXP) cadmium dichloride (ISO) caffeine (ISO) chloroacetaldehyde (ISO) chloroprene (EXP) cisplatin (ISO) clofibric acid (EXP) coumarin (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) elemental selenium (ISO) epoxiconazole (ISO) ethanol (EXP,ISO) fenofibrate (EXP) flutamide (EXP) FR900359 (ISO) hexadecanoic acid (ISO) lead(0) (ISO) metformin (EXP) methylmercury chloride (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) nitrates (ISO) ochratoxin A (ISO) ozone (ISO) paracetamol (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) selenium atom (ISO) sodium arsenite (ISO) testosterone enanthate (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) triacsin C (ISO) trichloroethene (ISO) triptonide (ISO) tungsten (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO)
Ddx24 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 128,329,554 - 128,346,818 (-) NCBI GRCr8 mRatBN7.2 6 122,564,767 - 122,582,032 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 122,564,767 - 122,581,927 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 122,705,614 - 122,722,897 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 123,000,876 - 123,018,159 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 122,335,418 - 122,352,763 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 127,302,201 - 127,319,382 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 127,302,201 - 127,319,362 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 128,996,616 - 129,001,614 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 136,522,732 - 136,539,906 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 127,699,436 - 127,716,597 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 127,703,182 - 127,720,344 (-) NCBI Celera 6 120,045,460 - 120,062,621 (-) NCBI Celera Cytogenetic Map 6 q32 NCBI
DDX24 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 94,048,287 - 94,081,202 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 94,048,287 - 94,081,202 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 94,514,633 - 94,547,548 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 93,587,021 - 93,617,311 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 93,587,021 - 93,617,311 NCBI Celera 14 74,571,013 - 74,601,331 (-) NCBI Celera Cytogenetic Map 14 q32.12 NCBI HuRef 14 74,697,258 - 74,727,325 (-) NCBI HuRef CHM1_1 14 94,455,281 - 94,485,555 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 88,275,602 - 88,308,519 (-) NCBI T2T-CHM13v2.0
Ddx24 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 103,374,235 - 103,392,106 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 103,374,241 - 103,392,089 (-) Ensembl GRCm39 Ensembl GRCm38 12 103,407,976 - 103,425,847 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 103,407,982 - 103,425,830 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 104,646,186 - 104,664,077 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 103,809,033 - 103,826,830 (-) NCBI MGSCv36 mm8 Celera 12 104,624,733 - 104,642,624 (-) NCBI Celera Cytogenetic Map 12 E NCBI cM Map 12 52.92 NCBI
Ddx24 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955438 16,100,594 - 16,114,657 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955438 16,100,345 - 16,116,377 (-) NCBI ChiLan1.0 ChiLan1.0
DDX24 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 95,208,308 - 95,241,312 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 94,424,813 - 94,457,787 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 74,683,068 - 74,713,394 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 94,016,438 - 94,046,635 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 94,016,438 - 94,046,635 (-) Ensembl panpan1.1 panPan2
DDX24 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 63,115,740 - 63,136,402 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 63,115,746 - 63,165,905 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 62,692,199 - 62,712,845 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 63,386,682 - 63,407,257 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 63,386,683 - 63,406,313 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 63,064,220 - 63,084,820 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 63,115,645 - 63,136,269 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 63,445,847 - 63,466,503 (-) NCBI UU_Cfam_GSD_1.0
Ddx24 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 11,534,965 - 11,553,604 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936733 1,913,437 - 1,932,869 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936733 1,913,439 - 1,932,027 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DDX24 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 115,328,121 - 115,352,929 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 115,328,122 - 115,347,355 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 122,186,509 - 122,207,174 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DDX24 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 71,808,721 - 71,838,268 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 71,808,995 - 71,838,262 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 59,048,089 - 59,078,195 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ddx24
.
Predicted Target Of
Count of predictions: 39 Count of miRNA genes: 38 Interacting mature miRNAs: 38 Transcripts: ENSRNOT00000012256 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331797 Bp213 Blood pressure QTL 213 3.291 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 104085867 128713626 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 71111 Iddm8 Insulin dependent diabetes mellitus QTL 8 1.9 0.002 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 6 105156861 140994061 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 61329 Eae9 Experimental allergic encephalomyelitis QTL 9 3.7 body mass (VT:0001259) change in body weight (CMO:0002045) 6 122549046 140994061 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 4145118 Mcs26 Mammary carcinoma susceptibility QTL 26 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 106752656 132339866 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1641917 Colcr5 Colorectal carcinoma resistance QTL 5 3.18 0.0009 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 6 122549046 137801795 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 737976 Pia24 Pristane induced arthritis QTL 24 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 6 112636280 140994061 Rat 1298087 Iddm18 Insulin dependent diabetes mellitus QTL 18 0.0001 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 6 116506292 130245370 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat 2293085 Iddm29 Insulin dependent diabetes mellitus QTL 29 7.66 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 6 122549046 140286318 Rat
RH143701
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 122,580,353 - 122,580,454 (+) MAPPER mRatBN7.2 Rnor_6.0 6 127,317,788 - 127,317,888 NCBI Rnor6.0 Rnor_5.0 6 136,538,319 - 136,538,419 UniSTS Rnor5.0 RGSC_v3.4 6 127,715,023 - 127,715,123 UniSTS RGSC3.4 Celera 6 120,061,047 - 120,061,147 UniSTS RH 3.4 Map 6 836.5 UniSTS Cytogenetic Map 6 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012256 ⟹ ENSRNOP00000012256
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 122,564,768 - 122,581,927 (-) Ensembl Rnor_6.0 Ensembl 6 127,302,201 - 127,319,362 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000084305
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 6 128,996,616 - 129,001,614 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000091301
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 6 128,996,616 - 129,001,614 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109592 ⟹ ENSRNOP00000092622
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 122,564,767 - 122,581,143 (-) Ensembl
RefSeq Acc Id:
NM_199119 ⟹ NP_954550
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 128,329,554 - 128,346,715 (-) NCBI mRatBN7.2 6 122,564,767 - 122,581,928 (-) NCBI Rnor_6.0 6 127,302,201 - 127,319,362 (-) NCBI Rnor_5.0 6 136,522,732 - 136,539,906 (-) NCBI RGSC_v3.4 6 127,699,436 - 127,716,597 (-) RGD Celera 6 120,045,460 - 120,062,621 (-) RGD
Sequence:
GGGTCGGGTTGGCGCAGGCGGTCTGGCGTGTGAGGATACTGCCGCGCAACCATGAAGTTGAAGGAGACAAAATCGAAGCCCAAGTCAGCAAGCCGTGGCACATTTCAGAGGAAGGGCATCAAGGTTGT
hide sequence
RefSeq Acc Id:
XM_006240483 ⟹ XP_006240545
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 128,329,554 - 128,346,754 (-) NCBI mRatBN7.2 6 122,564,767 - 122,581,931 (-) NCBI Rnor_6.0 6 127,302,201 - 127,319,310 (-) NCBI Rnor_5.0 6 136,522,732 - 136,539,906 (-) NCBI
Sequence:
GTTCTTTGTGGATCCGGAGCTGGCAGGCCTTGGCTAGCTGCGGATGTCTCCCCATTGTCTCCGA
hide sequence
RefSeq Acc Id:
XM_006240484 ⟹ XP_006240546
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 128,329,554 - 128,346,718 (-) NCBI mRatBN7.2 6 122,564,767 - 122,581,931 (-) NCBI Rnor_6.0 6 127,302,201 - 127,319,382 (-) NCBI Rnor_5.0 6 136,522,732 - 136,539,906 (-) NCBI
Sequence:
GCAGGAGCTGCTGCAGTTCCGGGTCGGGTTGGCGCAGGCGGTCTGGCGTGTGAGGATACTGCCG
hide sequence
RefSeq Acc Id:
XM_063262243 ⟹ XP_063118313
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 128,329,554 - 128,346,732 (-) NCBI
RefSeq Acc Id:
XM_063262244 ⟹ XP_063118314
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 128,329,554 - 128,346,718 (-) NCBI
RefSeq Acc Id:
XM_063262245 ⟹ XP_063118315
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 128,329,554 - 128,346,718 (-) NCBI
RefSeq Acc Id:
XM_063262246 ⟹ XP_063118316
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 128,332,595 - 128,346,818 (-) NCBI
RefSeq Acc Id:
NP_954550 ⟸ NM_199119
- UniProtKB:
Q6VEU8 (UniProtKB/TrEMBL), A6JEM9 (UniProtKB/TrEMBL), A0A8I6AFW4 (UniProtKB/TrEMBL), F7ETB4 (UniProtKB/TrEMBL)
- Sequence:
MKLKETKSKPKSASRGTFQRKGIKVVGKWKQVTIDPNLFADGQMDDLVCFEELTDYRLVKNPSRLFSDETTKKRKAQAVSEEEEEEEGESSSPKKKIKLKKQRDAILVAEGSAAQDECEGKASEPGAQ
hide sequence
RefSeq Acc Id:
XP_006240546 ⟸ XM_006240484
- Peptide Label:
isoform X1
- UniProtKB:
Q6VEU8 (UniProtKB/TrEMBL), A6JEM9 (UniProtKB/TrEMBL), A0A8I6AFW4 (UniProtKB/TrEMBL), F7ETB4 (UniProtKB/TrEMBL)
- Sequence:
MKLKETKSKPKSASRGTFQRKGIKVVGKWKQVTIDPNLFADGQMDDLVCFEELTDYRLVKNPSRLFSDETTKKRKAQAVSEEEEEEEGESSSPKKKIKLKKQRDAILVAEGSAAQDECEGKASEPGAQ
hide sequence
RefSeq Acc Id:
XP_006240545 ⟸ XM_006240483
- Peptide Label:
isoform X1
- UniProtKB:
Q6VEU8 (UniProtKB/TrEMBL), A6JEM9 (UniProtKB/TrEMBL), A0A8I6AFW4 (UniProtKB/TrEMBL), F7ETB4 (UniProtKB/TrEMBL)
- Sequence:
MKLKETKSKPKSASRGTFQRKGIKVVGKWKQVTIDPNLFADGQMDDLVCFEELTDYRLVKNPSRLFSDETTKKRKAQAVSEEEEEEEGESSSPKKKIKLKKQRDAILVAEGSAAQDECEGKASEPGAQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000012256 ⟸ ENSRNOT00000012256
Ensembl Acc Id:
ENSRNOP00000092622 ⟸ ENSRNOT00000109592
RefSeq Acc Id:
XP_063118313 ⟸ XM_063262243
- Peptide Label:
isoform X1
- UniProtKB:
A6JEM9 (UniProtKB/TrEMBL), F7ETB4 (UniProtKB/TrEMBL), Q6VEU8 (UniProtKB/TrEMBL), A0A8I6AFW4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118314 ⟸ XM_063262244
- Peptide Label:
isoform X1
- UniProtKB:
A6JEM9 (UniProtKB/TrEMBL), F7ETB4 (UniProtKB/TrEMBL), Q6VEU8 (UniProtKB/TrEMBL), A0A8I6AFW4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118315 ⟸ XM_063262245
- Peptide Label:
isoform X1
- UniProtKB:
A6JEM9 (UniProtKB/TrEMBL), F7ETB4 (UniProtKB/TrEMBL), Q6VEU8 (UniProtKB/TrEMBL), A0A8I6AFW4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118316 ⟸ XM_063262246
- Peptide Label:
isoform X2
RGD ID: 13694793 Promoter ID: EPDNEW_R5317 Type: initiation region Name: Ddx24_1 Description: DEAD-box helicase 24 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 127,319,368 - 127,319,428 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Ddx24
DEAD-box helicase 24
LOC100909476
ATP-dependent RNA helicase DDX24-like
Data merged from RGD:6503178
737654 PROVISIONAL
2016-01-13
Ddx24
DEAD-box helicase 24
Ddx24
DEAD (Asp-Glu-Ala-Asp) box helicase 24
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-08-01
Ddx24
DEAD (Asp-Glu-Ala-Asp) box helicase 24
Ddx24
DEAD (Asp-Glu-Ala-Asp) box polypeptide 24
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-05
LOC100909476
ATP-dependent RNA helicase DDX24-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-07-08
Ddx24
DEAD (Asp-Glu-Ala-Asp) box polypeptide 24
Symbol and Name status set to approved
1299863 APPROVED
