Advanced Search (OLGA)

Gene: Cbr4 (carbonyl reductase 4) Rattus norvegicus

Analyze

Symbol:

Cbr4

Name:

carbonyl reductase 4

RGD ID:

727826

Description:

Predicted to enable several functions, including 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity; NADPH binding activity; and NADPH dehydrogenase (quinone) activity. Predicted to be involved in fatty acid biosynthetic process; glycoside metabolic process; and protein tetramerization. Predicted to be located in mitochondrial matrix. Predicted to be part of oxidoreductase complex. Orthologous to human CBR4 (carbonyl reductase 4); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

3-ketoacyl-[acyl-carrier-protein] reductase beta subunit; 3-oxoacyl-[acyl-carrier-protein] reductase; carbonic reductase 4; carbonyl reductase family member 4; KAR beta subunit; LOC100911522; MGC105271; quinone reductase CBR4; uncharacterized LOC100911522

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CBR4 (carbonyl reductase 4)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cbr4 (carbonyl reductase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cbr4 (carbonyl reductase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CBR4 (carbonyl reductase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CBR4 (carbonyl reductase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cbr4 (carbonyl reductase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CBR4 (carbonyl reductase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CBR4 (carbonyl reductase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cbr4 (carbonyl reductase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CBR4 (carbonyl reductase 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cbr4 (carbonyl reductase 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cbr4 (carbonyl reductase 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	OAR1	Alliance	DIOPT (Hieranoid\|OMA\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	cbr4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	33,625,734 - 33,695,067 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	16	33,617,399 - 33,656,832 (-)	Ensembl				GRCr8
mRatBN7.2	16	28,629,928 - 28,684,230 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	28,617,224 - 28,645,712 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	16	32,224,831 - 32,240,582 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	35,658,872 - 35,674,623 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	31,860,531 - 31,876,269 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	31,944,328 - 31,972,553 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	31,956,753 - 31,972,507 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	16	31,794,520 - 31,810,263 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	16	31,943,125 - 31,957,556 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	28,625,441 - 28,641,135 (-)	NCBI		Celera
RGSC_v3.1	16	31,943,200 - 31,957,630 (-)	NCBI
Cytogenetic Map	16	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Hereditary Neoplastic Syndromes (ISO)

pancreatic adenocarcinoma (ISO)

pancreatic cancer (ISO)

pancreatic carcinoma (ISO)

short-rib thoracic dysplasia 6 with or without polydactyly (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

8-Br-cAMP (ISO)

acetamide (EXP)

aflatoxin B1 (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

buspirone (EXP)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

cisplatin (ISO)

cobalt dichloride (EXP,ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

doxorubicin (ISO)

endosulfan (EXP)

folic acid (ISO)

fulvestrant (ISO)

gentamycin (EXP)

glafenine (EXP)

GSK-J4 (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

methylmercury chloride (ISO)

NAD zwitterion (ISO)

NAD(+) (ISO)

nefazodone (EXP)

nitrofen (EXP)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

quercetin (ISO)

sodium arsenate (ISO)

sodium arsenite (EXP,ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiram (ISO)

tolcapone (EXP)

topotecan (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (EXP,ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

daunorubicin metabolic process (IEA,ISO)

doxorubicin metabolic process (IEA,ISO)

fatty acid biosynthetic process (IBA,IEA,ISO,ISS)

fatty acid metabolic process (IEA)

lipid metabolic process (IEA)

protein heterotetramerization (IEA,ISO,ISS)

protein homotetramerization (IEA,ISO)

Cellular Component

mitochondrial matrix (IEA,ISO,ISS)

mitochondrion (IEA)

oxidoreductase complex (IEA,ISO,ISS)

Molecular Function

3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity (IEA,ISO,ISS)

NAD(P)H dehydrogenase (quinone) activity (IEA,ISO)

NADPH binding (IEA,ISO,ISS)

NADPH dehydrogenase (quinone) activity (IEA,ISO,ISS)

oxidoreductase activity (IEA)

oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (IBA)

protein binding (ISO)

quinone binding (IBA,IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:18614015	PMID:19000905	PMID:20837989	PMID:25203508	PMID:34800366

Genomics

Comparative Map Data

Cbr4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	33,625,734 - 33,695,067 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	16	33,617,399 - 33,656,832 (-)	Ensembl				GRCr8
mRatBN7.2	16	28,629,928 - 28,684,230 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	28,617,224 - 28,645,712 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	16	32,224,831 - 32,240,582 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	35,658,872 - 35,674,623 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	31,860,531 - 31,876,269 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	31,944,328 - 31,972,553 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	31,956,753 - 31,972,507 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	16	31,794,520 - 31,810,263 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	16	31,943,125 - 31,957,556 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	28,625,441 - 28,641,135 (-)	NCBI		Celera
RGSC_v3.1	16	31,943,200 - 31,957,630 (-)	NCBI
Cytogenetic Map	16	p12	NCBI

CBR4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	168,894,486 - 169,010,255 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	168,863,770 - 169,010,275 (-)	Ensembl			hg38	GRCh38
GRCh37	4	169,908,741 - 169,931,406 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	170,145,316 - 170,167,997 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	4	167,240,084 - 167,262,804 (-)	NCBI		Celera
Cytogenetic Map	4	q32.3	NCBI
HuRef	4	165,662,191 - 165,684,917 (-)	NCBI		HuRef
CHM1_1	4	169,885,180 - 169,907,907 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	172,254,054 - 172,369,681 (-)	NCBI		T2T-CHM13v2.0

Cbr4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	61,940,768 - 61,956,534 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	61,940,768 - 61,959,728 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	61,487,734 - 61,503,500 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	61,487,734 - 61,506,694 (+)	Ensembl			mm10	GRCm38
MGSCv37	8	63,966,531 - 63,982,297 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	64,379,926 - 64,395,624 (+)	NCBI		MGSCv36	mm8
MGSCv36	8	60,656,117 - 60,671,212 (+)	NCBI		MGSCv36	mm8
Celera	8	64,050,917 - 64,066,676 (+)	NCBI		Celera
Cytogenetic Map	8	B3.1	NCBI
cM Map	8	31.18	NCBI

Cbr4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	37,206,634 - 37,226,407 (+)	Ensembl
ChiLan1.0	NW_004955403	37,201,474 - 37,226,414 (+)	NCBI	ChiLan1.0	ChiLan1.0

CBR4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	166,663,224 - 166,794,172 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	167,015,483 - 167,149,427 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	161,103,477 - 161,235,840 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	173,182,755 - 173,309,905 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	173,282,162 - 173,309,905 (-)	Ensembl			panPan2	panpan1.1

CBR4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	19,475,562 - 19,618,144 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	19,597,518 - 19,618,180 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	19,566,496 - 19,649,192 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	19,673,638 - 19,756,294 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	19,734,924 - 19,756,246 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	19,541,290 - 19,623,984 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	19,541,898 - 19,624,490 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	19,604,132 - 19,686,873 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cbr4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	20,768,596 - 20,791,385 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936516	1,181,524 - 1,205,760 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936516	1,184,859 - 1,205,668 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CBR4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	20,621,981 - 20,682,240 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	20,621,960 - 20,642,351 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	21,908,782 - 21,929,179 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CBR4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	115,223,813 - 115,246,925 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	115,223,386 - 115,246,818 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	95,082,408 - 95,160,389 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cbr4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624769	581,800 - 604,075 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624769	564,148 - 603,402 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Cbr4
234 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	79
Count of miRNA genes:	74
Interacting mature miRNAs:	75
Transcripts:	ENSRNOT00000032199
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	4354822	49354822	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	16	387123	45387123	Rat
1549842	Bp248	Blood pressure QTL 248		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	387123	45387123	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4234212	49757901	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4234212	66955197	Rat
2302057	Pia29	Pristane induced arthritis QTL 29	3.6	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	16	28468701	73468701	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39568015	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39568015	Rat
1357403	Slep4	Serum leptin concentration QTL 4	3.91		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	32361043	77361043	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4234212	53708481	Rat
8694453	Bw172	Body weight QTL 172	8.33	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	16	31058039	76058039	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	839086	66195506	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3386790	49757901	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	4744222	49744222	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	839086	66195506	Rat
6903294	Stl30	Serum triglyceride level QTL 30	2.6	0.0013	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	16	31885271	76885271	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	839086	66195506	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17730818	72536785	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	839086	52786090	Rat
2301406	Kidm39	Kidney mass QTL 39		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	16	15905802	60905802	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	839086	66195506	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	3301683	48301683	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_182672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094606	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094609	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275479	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC115265	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY305858	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086378	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215409	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HB874471	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HC931880	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000032199 ⟹ ENSRNOP00000038351

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	16	33,626,614 - 33,656,832 (-)	Ensembl
mRatBN7.2 Ensembl	16	28,629,927 - 28,645,712 (-)	Ensembl
Rnor_6.0 Ensembl	16	31,956,753 - 31,972,507 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095468 ⟹ ENSRNOP00000085638

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	16	33,617,399 - 33,656,832 (-)	Ensembl
mRatBN7.2 Ensembl	16	28,617,224 - 28,645,712 (-)	Ensembl

RefSeq Acc Id:

NM_182672 ⟹ NP_872613

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	33,640,815 - 33,656,572 (-)	NCBI
mRatBN7.2	16	28,629,928 - 28,645,691 (-)	NCBI
Rnor_6.0	16	31,956,752 - 31,972,507 (-)	NCBI
Rnor_5.0	16	31,794,520 - 31,810,263 (-)	NCBI
RGSC_v3.4	16	31,943,125 - 31,957,556 (-)	RGD
Celera	16	28,625,441 - 28,641,135 (-)	RGD

Sequence:

show sequence

CGGGTCGGTTGTTCAAAGAGCTTGTTGAATTGTTTTTCCAGTTGTTGTGCCTTTATTATAAGTT
CTGTGTCTTAGGGATCCATCTTGCCGGTCCGAGGTCCAAGATGGACAAAGTCTGTGCGGTTTTT
GGAGGCTCCCGGGGCATCGGCAAGGCTGTAGCCCAGCTAATGGCCCAGAAGGGTTACCGCCTGG
CGATCGTCGCCAGAAACTTGGAAGTGGCCAAAGCCACTGCGAGCGAGCTCGGCGGAATCCACTT
GGCATTTAGGTGCAACATTGCCAAAGAAGGAGATGTTCACAGTACATTTGAAGAGATGGAGAAA
CATTTAGGTCCAGTAAATTTCTTGGTAAATGCAGCTGGTATTAACAGAGACAGTCTTTTAGTAA
GAACAAAAACTGAAGATATGCTGTCTCAGCTTCATACCAACCTCTTGGGCACCATGCTGACCTG
CAGAGCCGCTATGAGGACAATGATTCAGCAGGGCGGGTCTATTGTTAATGTCGGGAGTATTATT
GGTTTAAAAGGCAATGTGGGCCAGGCCGCATATAGTGCCACCAAAGGAGGGCTTATCGGGTTTT
CACGCTCGCTTGCTAAAGAGGTTGCCCGGAAGAAAATCAGAGTGAATGTGGTTGCACCAGGATT
TATTCACACGGATATGACAAAACACTTGAAAGAAGAACATTTCAAGAAAAACATCCCTCTTGGG
AGGTTTGGAGAAGCTCTTGAGGTGGCACATGCCGTTGTGTTTCTTTTAGAGTCACCATACATCA
CAGGACATGTTCTTATCGTGGATGGAGGATTACAGCTCACTGCCTAATTAGAGATGATATTACT
GTAATGGTGATCTGGATCAAGCACACATTTTCCTATTAATTAGACAATCATATCTATATGGGTG
ACATTTGCTAATGGAAACAAATTAGCTAATGGATACTACAAATGATTCCTTCCATCTTTGTATG
AACATGTCTCAAAACAAAGTGTGACTAGTTGTAATCTAAAAGGTGTGAAGTCTCTGTCTTTACA
GGCAGCAGCAGTTTTAGTGCATGGACATTCTGTAAGGGCTACACATCAGTATTAATTTCTACAT
TTTTGCCTTGGAAGTAGAAAATTCTGTTGTCTAATTGTGATATACCTGTATCAAGCCGGATGTT
AAAGACTTCAGCCTTCTAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039094606 ⟹ XP_038950534

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	33,640,815 - 33,695,067 (-)	NCBI
mRatBN7.2	16	28,629,928 - 28,684,230 (-)	NCBI

RefSeq Acc Id:

XM_039094607 ⟹ XP_038950535

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	33,640,815 - 33,695,067 (-)	NCBI
mRatBN7.2	16	28,629,928 - 28,684,230 (-)	NCBI

RefSeq Acc Id:

XM_039094609 ⟹ XP_038950537

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	33,640,815 - 33,695,067 (-)	NCBI
mRatBN7.2	16	28,629,928 - 28,684,230 (-)	NCBI

RefSeq Acc Id:

XM_063275479 ⟹ XP_063131549

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	33,625,734 - 33,656,609 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_872613	(Get FASTA)	NCBI Sequence Viewer
	XP_038950534	(Get FASTA)	NCBI Sequence Viewer
	XP_038950535	(Get FASTA)	NCBI Sequence Viewer
	XP_038950537	(Get FASTA)	NCBI Sequence Viewer
	XP_063131549	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86378	(Get FASTA)	NCBI Sequence Viewer
	AAP70488	(Get FASTA)	NCBI Sequence Viewer
	CBF61552	(Get FASTA)	NCBI Sequence Viewer
	CBU86504	(Get FASTA)	NCBI Sequence Viewer
	EDL87203	(Get FASTA)	NCBI Sequence Viewer
	EDL87204	(Get FASTA)	NCBI Sequence Viewer
	EDL87205	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000038351.6
GenBank Protein	Q7TS56	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_872613 ⟸ NM_182672

- UniProtKB:

Q7TS56 (UniProtKB/Swiss-Prot), A6KIR4 (UniProtKB/TrEMBL), A0A8I6A1W1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDKVCAVFGGSRGIGKAVAQLMAQKGYRLAIVARNLEVAKATASELGGIHLAFRCNIAKEGDVH
STFEEMEKHLGPVNFLVNAAGINRDSLLVRTKTEDMLSQLHTNLLGTMLTCRAAMRTMIQQGGS
IVNVGSIIGLKGNVGQAAYSATKGGLIGFSRSLAKEVARKKIRVNVVAPGFIHTDMTKHLKEEH
FKKNIPLGRFGEALEVAHAVVFLLESPYITGHVLIVDGGLQLTA

hide sequence

Ensembl Acc Id:

ENSRNOP00000038351 ⟸ ENSRNOT00000032199

RefSeq Acc Id:	XP_038950534 ⟸ XM_039094606
- Peptide Label:	isoform X2
- UniProtKB:	A6KIR6 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038950537 ⟸ XM_039094609
- Peptide Label:	isoform X2
- UniProtKB:	A6KIR6 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038950535 ⟸ XM_039094607
- Peptide Label:	isoform X2
- UniProtKB:	A6KIR6 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000085638 ⟸ ENSRNOT00000095468

RefSeq Acc Id:	XP_063131549 ⟸ XM_063275479
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q7TS56-F1-model_v2	AlphaFold	Q7TS56	1-236	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700071

Promoter ID:

EPDNEW_R10593

Type:

single initiation site

Name:

Cbr4_1

Description:

carbonyl reductase 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	31,972,528 - 31,972,588	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:727826	AgrOrtholog
BioCyc Gene	G2FUF-11584	BioCyc
Ensembl Genes	ENSRNOG00000024411	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000032199.7	UniProtKB/Swiss-Prot
Gene3D-CATH	NAD(P)-binding Rossmann-like Domain	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7302014	IMAGE-MGC_LOAD
InterPro	NAD(P)-bd_dom_sf	UniProtKB/Swiss-Prot
	Sc_DH/Rdtase_CS	UniProtKB/Swiss-Prot
	SDR_fam	UniProtKB/Swiss-Prot
KEGG Report	rno:359725	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105271	IMAGE-MGC_LOAD
NCBI Gene	359725	ENTREZGENE
PANTHER	3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE	UniProtKB/Swiss-Prot
	SHORT-CHAIN DEHYDROGENASES/REDUCTASES FAMILY MEMBER	UniProtKB/Swiss-Prot
Pfam	adh_short_C2	UniProtKB/Swiss-Prot
PhenoGen	Cbr4	PhenoGen
PRINTS	GDHRDH	UniProtKB/Swiss-Prot
	SDRFAMILY	UniProtKB/Swiss-Prot
PROSITE	ADH_SHORT	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000024411	RatGTEx
SMART	PKS_KR	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF51735	UniProtKB/Swiss-Prot
UniProt	A0A8I6A1W1	ENTREZGENE, UniProtKB/TrEMBL
	A6KIR4	ENTREZGENE, UniProtKB/TrEMBL
	A6KIR5_RAT	UniProtKB/TrEMBL
	A6KIR6	ENTREZGENE, UniProtKB/TrEMBL
	CBR4_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Cbr4	carbonyl reductase 4	LOC100911522	uncharacterized LOC100911522	Data merged from RGD:6492350	737654	PROVISIONAL
2012-07-05	LOC100911522	uncharacterized LOC100911522			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-03-03	Cbr4	carbonyl reductase 4	Cbr4	carbonic reductase 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-08	Cbr4	carbonic reductase 4		carbonyl reductase 4	Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar