Advanced Search (OLGA)

Gene: Mertk (MER proto-oncogene, tyrosine kinase) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Mertk

Name:

MER proto-oncogene, tyrosine kinase

RGD ID:

69283

Description:

Predicted to enable transmembrane receptor protein tyrosine kinase activity. Involved in phagocytosis; positive regulation of phagocytosis; and protein phosphorylation. Located in photoreceptor outer segment. Used to study retinal degeneration. Human ortholog(s) of this gene implicated in retinitis pigmentosa 38. Orthologous to human MERTK (MER proto-oncogene, tyrosine kinase); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

c-mer proto-oncogene tyrosine kinase; proto-oncogene c-Mer; proto-oncogene tyrosine-protein kinase Mer; Rdy; receptor tyrosine kinase MerTK; Receptor tyrosine tinase gene probably the gene for Rdy; retinal dystrophy; tyrosine-protein kinase Mer

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

Mertk^rdy

Is Marker For:

Strains: (LE x RCS-p⁺/LavRrrc)F1

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	136,391,936 - 136,498,366 (+)	NCBI		GRCr8
mRatBN7.2	3	115,939,351 - 116,045,141 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	115,939,351 - 116,046,554 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	119,836,222 - 119,942,080 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	128,431,776 - 128,537,642 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	126,092,272 - 126,198,124 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	121,235,230 - 121,340,932 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	121,235,119 - 121,342,444 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	128,669,534 - 128,777,078 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	116,308,387 - 116,416,414 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	116,213,959 - 116,321,987 (+)	NCBI
Celera	3	114,768,654 - 114,872,632 (+)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mertk	Rat	COVID-19		ISO	RGD:731631	9068941	mRNA:increased expression:peripheral blood mononuclear cell (human)	RGD	PMID:32228226\|REF_RGD_ID:28912744
Mertk	Rat	pulmonary embolism		ISO	RGD:731632	1582496		RGD
Mertk	Rat	retinal degeneration	treatment	IDA		69668		RGD
Mertk	Rat	thrombosis		ISO	RGD:731632	1582496		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mertk	Rat	fundus dystrophy		ISO	RGD:731631	8554872	ClinVar Annotator: match by term: Retinal dystrophy	ClinVar	PMID:11062461\|PMID:11727200\|PMID:15111602\|PMID:16199547\|PMID:17301963\|PMID:17576681\|PMID:20300561\|PMID:21677792\|PMID:22180149\|PMID:22581970\|PMID:22939401\|PMID:24033266\|PMID:24265693\|PMID:24625443\|PMID:24938718\|PMID:25097241\|PMID:25324289\|PMID:25525159\|PMID:25741868\|PMID:26103963\|PMID:26355662\|PMID:26667666\|PMID:26700204\|PMID:27208204\|PMID:28041643\|PMID:28378820\|PMID:28462455\|PMID:28492532\|PMID:28559085\|PMID:29068140\|PMID:29074561\|PMID:29555955\|PMID:29659094\|PMID:30416333\|PMID:3055739\|PMID:30557390\|PMID:30718709\|PMID:31054281\|PMID:31370859\|PMID:31429209\|PMID:31456290\|PMID:31589614\|PMID:31736247\|PMID:3196484\|PMID:31964843\|PMID:32036094\|PMID:32037395\|PMID:32326409\|PMID:32483926\|PMID:3253185\|PMID:32531858\|PMID:32552793\|PMID:32581362\|PMID:32783370\|PMID:33090715\|PMID:33353011\|PMID:33921607\|PMID:34315337\|PMID:34598035\|PMID:34906470\|PMID:35836572\|PMID:36036427\|PMID:36284670\|PMID:36460718\|PMID:36524988\|PMID:36819107\|PMID:36909829\|PMID:9536098
Mertk	Rat	genetic disease		ISO	RGD:731631	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:16199547\|PMID:17301963\|PMID:24265693\|PMID:25525159\|PMID:25741868\|PMID:26355662\|PMID:28492532\|PMID:29659094\|PMID:31370859\|PMID:31429209\|PMID:31589614\|PMID:31964843\|PMID:32326409\|PMID:32552793\|PMID:34598035\|PMID:36909829
Mertk	Rat	optic atrophy		ISO	RGD:731631	8554872	ClinVar Annotator: match by term: Optic atrophy	ClinVar	PMID:22939401\|PMID:25741868\|PMID:28492532
Mertk	Rat	retinitis pigmentosa		ISO	RGD:731631	8554872	ClinVar Annotator: match by term: Autosomal recessive retinitis pigmentosa \| ClinVar Annotator: match by term: more ...	ClinVar	PMID:11062461\|PMID:15111602\|PMID:16199547\|PMID:16714263\|PMID:17301963\|PMID:17576681\|PMID:19956407\|PMID:20300561\|PMID:22180149\|PMID:22581970\|PMID:22939401\|PMID:24265693\|PMID:24625443\|PMID:24938718\|PMID:25097241\|PMID:25324289\|PMID:25525159\|PMID:25741868\|PMID:26355662\|PMID:26700204\|PMID:27208204\|PMID:28041643\|PMID:28492532\|PMID:28559085\|PMID:29068140\|PMID:29659094\|PMID:30054919\|PMID:30718709\|PMID:31054281\|PMID:31370859\|PMID:31429209\|PMID:31456290\|PMID:31589614\|PMID:31725702\|PMID:31964843\|PMID:32036094\|PMID:32326409\|PMID:32483926\|PMID:32531858\|PMID:32552793\|PMID:32581362\|PMID:33090715\|PMID:33353011\|PMID:34598035\|PMID:34906470\|PMID:36460718\|PMID:36819107\|PMID:36909829\|PMID:9536098
Mertk	Rat	retinitis pigmentosa		ISO	RGD:731631	8554872	ClinVar Annotator: match by term: Autosomal recessive retinitis pigmentosa \| ClinVar Annotator: match by term: more ...	ClinVar	PMID:11062461\|PMID:15111602\|PMID:16199547\|PMID:16714263\|PMID:17301963\|PMID:17576681\|PMID:19956407\|PMID:20300561\|PMID:22180149\|PMID:22939401\|PMID:24265693\|PMID:24625443\|PMID:24938718\|PMID:25097241\|PMID:25324289\|PMID:25741868\|PMID:25741905\|PMID:25741913\|PMID:25741914\|PMID:26355662\|PMID:26700204\|PMID:27208204\|PMID:28041643\|PMID:28492532\|PMID:28559085\|PMID:29068140\|PMID:29659094\|PMID:30054919\|PMID:30718709\|PMID:31054281\|PMID:31725702\|PMID:32036094\|PMID:33353011\|PMID:34906470\|PMID:36909829\|PMID:9536098
Mertk	Rat	retinitis pigmentosa		ISO	RGD:731631	8554872	ClinVar Annotator: match by term: Autosomal recessive retinitis pigmentosa \| ClinVar Annotator: match by term: more ...	ClinVar	PMID:11062461\|PMID:11592982\|PMID:15111602\|PMID:16199547\|PMID:16714263\|PMID:17301963\|PMID:17576681\|PMID:19956407\|PMID:20300561\|PMID:22180149\|PMID:22939401\|PMID:24265693\|PMID:24625443\|PMID:24938718\|PMID:25097241\|PMID:25741868\|PMID:26263531\|PMID:26355662\|PMID:26700204\|PMID:27208204\|PMID:28041643\|PMID:28492532\|PMID:28559085\|PMID:29068140\|PMID:29659094\|PMID:30054919\|PMID:30718709\|PMID:31725702\|PMID:9536098
Mertk	Rat	retinitis pigmentosa		ISO	RGD:731631	8554872	ClinVar Annotator: match by term: Autosomal recessive retinitis pigmentosa \| ClinVar Annotator: match by term: more ...	ClinVar	PMID:11062461\|PMID:15111602\|PMID:16199547\|PMID:16714263\|PMID:17301963\|PMID:17576681\|PMID:19956407\|PMID:20300561\|PMID:22180149\|PMID:22939401\|PMID:24265693\|PMID:24625443\|PMID:24938718\|PMID:25097241\|PMID:25324289\|PMID:25741868\|PMID:26355662\|PMID:26700204\|PMID:27208204\|PMID:28041643\|PMID:28492532\|PMID:28559085\|PMID:29068140\|PMID:29659094\|PMID:30054919\|PMID:30718709\|PMID:31054281\|PMID:31725702\|PMID:32036094\|PMID:33353011\|PMID:34906470\|PMID:36909829\|PMID:9536098
Mertk	Rat	retinitis pigmentosa 38		ISO	RGD:731631	8554872	ClinVar Annotator: match by term: MERTK-related condition \| ClinVar Annotator: match by term: Retinitis pigmentosa more ...	ClinVar	PMID:11062461\|PMID:11727200\|PMID:15111602\|PMID:16199547\|PMID:16714263\|PMID:17301963\|PMID:17576681\|PMID:19956407\|PMID:20300561\|PMID:21677792\|PMID:22180149\|PMID:22939401\|PMID:24033266\|PMID:24265693\|PMID:24938718\|PMID:25097241\|PMID:25324289\|PMID:25326637\|PMID:25412400\|PMID:25525159\|PMID:25741868\|PMID:26147992\|PMID:26263531\|PMID:26355662\|PMID:26872967\|PMID:27160483\|PMID:28041643\|PMID:28462455\|PMID:28492532\|PMID:28559085\|PMID:29068140\|PMID:29074561\|PMID:29659094\|PMID:30054919\|PMID:30718709\|PMID:30851773\|PMID:31054281\|PMID:31370859\|PMID:31429209\|PMID:31456290\|PMID:31589614\|PMID:31690835\|PMID:31725702\|PMID:31964843\|PMID:32036094\|PMID:32037395\|PMID:32326409\|PMID:32552793\|PMID:32581362\|PMID:32783370\|PMID:33090715\|PMID:33353011\|PMID:34598035\|PMID:34906470\|PMID:36460718\|PMID:36819107\|PMID:36909829\|PMID:9536098

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mertk	Rat	carcinoma		ISO	RGD:731631	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:19028587
Mertk	Rat	IgA glomerulonephritis		ISO	RGD:731631	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25133636
Mertk	Rat	pulmonary embolism		ISO	RGD:731631	11554173	CTD Direct Evidence: therapeutic	CTD	PMID:19028587
Mertk	Rat	retinitis pigmentosa		ISO	RGD:731631	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:11062461
Mertk	Rat	Thromboembolism		ISO	RGD:731631	11554173	CTD Direct Evidence: therapeutic	CTD	PMID:17047157
Mertk	Rat	thrombosis		ISO	RGD:731631	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:15130911

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mertk	Rat	retinitis pigmentosa 38		ISO	RGD:731631	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mertk	Rat	1,1-dichloroethene	decreases expression	ISO	RGD:731632	6480464	vinylidene chloride results in decreased expression of MERTK mRNA	CTD	PMID:26682919
Mertk	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:731632	6480464	1,2-Dimethylhydrazine results in decreased expression of MERTK mRNA	CTD	PMID:22206623
Mertk	Rat	17beta-estradiol	increases expression	ISO	RGD:731631	6480464	Estradiol results in increased expression of MERTK mRNA	CTD	PMID:24758408
Mertk	Rat	17beta-estradiol	decreases expression	ISO	RGD:731632	6480464	Estradiol results in decreased expression of MERTK mRNA	CTD	PMID:39298647
Mertk	Rat	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of MERTK mRNA	CTD	PMID:32145629
Mertk	Rat	17beta-estradiol	multiple interactions	ISO	RGD:731631	6480464	[Estradiol co-treated with EGF protein] results in increased expression of MERTK mRNA; [Estradiol co-treated with more ...	CTD	PMID:24758408\|PMID:30165855
Mertk	Rat	17beta-hydroxy-5alpha-androstan-3-one	increases expression	ISO	RGD:731631	6480464	Dihydrotestosterone results in increased expression of MERTK mRNA	CTD	PMID:29581250
Mertk	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:731631	6480464	Tetrachlorodibenzodioxin results in decreased expression of MERTK mRNA	CTD	PMID:20106945
Mertk	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of MERTK mRNA	CTD	PMID:33387578
Mertk	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of MERTK mRNA	CTD	PMID:22298810
Mertk	Rat	2-palmitoylglycerol	increases expression	ISO	RGD:731631	6480464	2-palmitoylglycerol results in increased expression of MERTK mRNA	CTD	PMID:37199045
Mertk	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	RGD:731632	6480464	N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of MERTK mRNA	CTD	PMID:26251327
Mertk	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:731632	6480464	bisphenol S results in increased expression of MERTK mRNA	CTD	PMID:30951980
Mertk	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:731632	6480464	bisphenol S results in decreased expression of MERTK mRNA	CTD	PMID:39298647
Mertk	Rat	5-aza-2'-deoxycytidine	affects expression	ISO	RGD:731631	6480464	Decitabine affects the expression of MERTK mRNA	CTD	PMID:23300844
Mertk	Rat	8-Br-cAMP	decreases expression	ISO	RGD:731631	6480464	8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of MERTK mRNA	CTD	PMID:22079614
Mertk	Rat	acrylamide	increases expression	ISO	RGD:731631	6480464	Acrylamide results in increased expression of MERTK mRNA	CTD	PMID:32763439
Mertk	Rat	ADP	increases response to substance	ISO	RGD:731631	6480464	MERTK protein results in increased susceptibility to Adenosine Diphosphate	CTD	PMID:15733062
Mertk	Rat	aflatoxin B1	increases methylation	ISO	RGD:731631	6480464	Aflatoxin B1 results in increased methylation of MERTK gene; Aflatoxin B1 results in increased methylation more ...	CTD	PMID:27153756\|PMID:30157460
Mertk	Rat	aflatoxin B1	decreases expression	ISO	RGD:731631	6480464	Aflatoxin B1 results in decreased expression of MERTK mRNA	CTD	PMID:32234424
Mertk	Rat	aldrin	multiple interactions	ISO	RGD:731631	6480464	[Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated more ...	CTD	PMID:28263720
Mertk	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:731631	6480464	Tretinoin results in increased expression of MERTK mRNA	CTD	PMID:33167477
Mertk	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of MERTK mRNA	CTD	PMID:35163327
Mertk	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of MERTK mRNA	CTD	PMID:16483693
Mertk	Rat	antirheumatic drug	decreases expression	ISO	RGD:731631	6480464	Antirheumatic Agents results in decreased expression of MERTK mRNA	CTD	PMID:24449571
Mertk	Rat	arsenite(3-)	multiple interactions	ISO	RGD:731631	6480464	arsenite inhibits the reaction [G3BP1 protein binds to MERTK mRNA]	CTD	PMID:32406909
Mertk	Rat	arsenous acid	decreases expression	ISO	RGD:731631	6480464	Arsenic Trioxide results in decreased expression of MERTK mRNA	CTD	PMID:20458559
Mertk	Rat	arsenous acid	increases expression	ISO	RGD:731631	6480464	Arsenic Trioxide results in increased expression of MERTK mRNA	CTD	PMID:29633893
Mertk	Rat	benzo[a]pyrene	increases mutagenesis	ISO	RGD:731631	6480464	Benzo(a)pyrene results in increased mutagenesis of MERTK gene	CTD	PMID:25435355
Mertk	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:731631	6480464	Benzo(a)pyrene affects the methylation of MERTK promoter	CTD	PMID:27901495
Mertk	Rat	benzo[a]pyrene	increases expression	ISO	RGD:731632	6480464	Benzo(a)pyrene results in increased expression of MERTK mRNA	CTD	PMID:21569818\|PMID:22228805\|PMID:22610609
Mertk	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:731631	6480464	Benzo(a)pyrene results in decreased expression of MERTK mRNA	CTD	PMID:20064835\|PMID:20106945
Mertk	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of MERTK mRNA	CTD	PMID:25181051\|PMID:30816183\|PMID:32528016\|PMID:34947998
Mertk	Rat	bisphenol F	increases expression	ISO	RGD:731632	6480464	bisphenol F results in increased expression of MERTK mRNA	CTD	PMID:30951980
Mertk	Rat	bleomycin A2	multiple interactions	ISO	RGD:731632	6480464	Bleomycin affects the localization of and affects the expression of MERTK protein	CTD	PMID:22687607
Mertk	Rat	bleomycin A2	increases phosphorylation	ISO	RGD:731632	6480464	Bleomycin results in increased phosphorylation of MERTK protein	CTD	PMID:22687607
Mertk	Rat	cadmium dichloride	decreases expression	ISO	RGD:731631	6480464	Cadmium Chloride results in decreased expression of MERTK mRNA	CTD	PMID:38382870
Mertk	Rat	caffeine	decreases phosphorylation	ISO	RGD:731631	6480464	Caffeine results in decreased phosphorylation of MERTK protein	CTD	PMID:35688186
Mertk	Rat	calcitriol	increases expression	ISO	RGD:731631	6480464	Calcitriol results in increased expression of MERTK mRNA	CTD	PMID:21592394
Mertk	Rat	calcitriol	multiple interactions	ISO	RGD:731631	6480464	[Testosterone co-treated with Calcitriol] results in increased expression of MERTK mRNA	CTD	PMID:21592394
Mertk	Rat	calix[6]arene	decreases expression	ISO	RGD:731631	6480464	calix(6)arene results in decreased expression of MERTK protein	CTD	PMID:23872419
Mertk	Rat	carbon nanotube	affects expression	ISO	RGD:731632	6480464	Nanotubes, Carbon affects the expression of MERTK mRNA	CTD	PMID:25554681
Mertk	Rat	CGP 52608	multiple interactions	ISO	RGD:731631	6480464	CGP 52608 promotes the reaction [RORA protein binds to MERTK gene]	CTD	PMID:28238834
Mertk	Rat	chlordecone	increases expression	ISO	RGD:731632	6480464	Chlordecone results in increased expression of MERTK mRNA	CTD	PMID:33711761
Mertk	Rat	chloroprene	increases expression	ISO	RGD:731632	6480464	Chloroprene results in increased expression of MERTK mRNA	CTD	PMID:23125180
Mertk	Rat	chromium(6+)	affects expression	ISO	RGD:731632	6480464	chromium hexavalent ion affects the expression of MERTK mRNA	CTD	PMID:28472532
Mertk	Rat	cisplatin	affects expression	ISO	RGD:731631	6480464	Cisplatin affects the expression of MERTK mRNA	CTD	PMID:23300844
Mertk	Rat	cisplatin	multiple interactions	ISO	RGD:731631	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of MERTK mRNA	CTD	PMID:27392435
Mertk	Rat	cisplatin	increases expression	ISO	RGD:731631	6480464	Cisplatin results in increased expression of MERTK mRNA	CTD	PMID:27392435
Mertk	Rat	clobetasol	increases expression	ISO	RGD:731632	6480464	Clobetasol results in increased expression of MERTK mRNA	CTD	PMID:27462272
Mertk	Rat	clofibrate	decreases expression	ISO	RGD:731632	6480464	Clofibrate results in decreased expression of MERTK mRNA	CTD	PMID:17585979
Mertk	Rat	clofibrate	multiple interactions	ISO	RGD:731632	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of MERTK mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
Mertk	Rat	copper atom	multiple interactions	ISO	RGD:731631	6480464	[NSC 689534 binds to Copper] which results in increased expression of MERTK mRNA	CTD	PMID:20971185
Mertk	Rat	copper(0)	multiple interactions	ISO	RGD:731631	6480464	[NSC 689534 binds to Copper] which results in increased expression of MERTK mRNA	CTD	PMID:20971185
Mertk	Rat	crocidolite asbestos	decreases expression	ISO	RGD:731632	6480464	Asbestos, Crocidolite results in decreased expression of MERTK mRNA	CTD	PMID:29279043
Mertk	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of MERTK mRNA	CTD	PMID:27523638
Mertk	Rat	cypermethrin	affects expression	ISO	RGD:731632	6480464	cypermethrin affects the expression of MERTK mRNA	CTD	PMID:29020013
Mertk	Rat	cytarabine	decreases expression	ISO	RGD:731631	6480464	Cytarabine results in decreased expression of MERTK mRNA	CTD	PMID:21198554
Mertk	Rat	dabigatran	increases expression	ISO	RGD:731632	6480464	Dabigatran results in increased expression of MERTK mRNA	CTD	PMID:27397090
Mertk	Rat	DDD	multiple interactions	ISO	RGD:731631	6480464	[Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated more ...	CTD	PMID:28263720
Mertk	Rat	DDE	multiple interactions	ISO	RGD:731631	6480464	[Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated more ...	CTD	PMID:28263720
Mertk	Rat	DDT	multiple interactions	ISO	RGD:731631	6480464	[Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated more ...	CTD	PMID:28263720
Mertk	Rat	dexamethasone	increases expression	ISO	RGD:731632	6480464	Dexamethasone results in increased expression of MERTK mRNA	CTD	PMID:22733784
Mertk	Rat	diarsenic trioxide	decreases expression	ISO	RGD:731631	6480464	Arsenic Trioxide results in decreased expression of MERTK mRNA	CTD	PMID:20458559
Mertk	Rat	diarsenic trioxide	increases expression	ISO	RGD:731631	6480464	Arsenic Trioxide results in increased expression of MERTK mRNA	CTD	PMID:29633893
Mertk	Rat	dieldrin	multiple interactions	ISO	RGD:731631	6480464	[Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated more ...	CTD	PMID:28263720
Mertk	Rat	disodium selenite	decreases expression	ISO	RGD:731632	6480464	Sodium Selenite results in decreased expression of MERTK mRNA	CTD	PMID:23274088
Mertk	Rat	doxorubicin	decreases expression	ISO	RGD:731631	6480464	Doxorubicin results in decreased expression of MERTK mRNA	CTD	PMID:29803840
Mertk	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of MERTK mRNA	CTD	PMID:29391264
Mertk	Rat	endrin	multiple interactions	ISO	RGD:731631	6480464	[Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated more ...	CTD	PMID:28263720
Mertk	Rat	epoxiconazole	decreases expression	ISO	RGD:731632	6480464	epoxiconazole results in decreased expression of MERTK mRNA	CTD	PMID:35436446
Mertk	Rat	ethanol	increases expression	ISO	RGD:731632	6480464	Ethanol results in increased expression of MERTK mRNA	CTD	PMID:30319688
Mertk	Rat	ethanol	affects expression	ISO	RGD:731632	6480464	Ethanol affects the expression of MERTK mRNA	CTD	PMID:30319688
Mertk	Rat	fenofibrate	increases expression	ISO	RGD:731631	6480464	Fenofibrate results in increased expression of MERTK mRNA	CTD	PMID:25572481
Mertk	Rat	folic acid	decreases expression	ISO	RGD:731632	6480464	Folic Acid results in decreased expression of MERTK mRNA	CTD	PMID:25629700
Mertk	Rat	gamma-hexachlorocyclohexane	multiple interactions	ISO	RGD:731631	6480464	[Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated more ...	CTD	PMID:28263720
Mertk	Rat	lead diacetate	increases expression	EXP		6480464	lead acetate results in increased expression of MERTK mRNA	CTD	PMID:22641619
Mertk	Rat	lidocaine	increases expression	EXP		6480464	Lidocaine results in increased expression of MERTK mRNA	CTD	PMID:35283115
Mertk	Rat	lipopolysaccharide	increases cleavage	ISO	RGD:731631	6480464	Lipopolysaccharides results in increased cleavage of MERTK protein	CTD	PMID:17047157
Mertk	Rat	lipopolysaccharide	decreases expression	ISO	RGD:731631	6480464	Lipopolysaccharides results in decreased expression of MERTK mRNA	CTD	PMID:35811015
Mertk	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:731631	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of MERTK mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
Mertk	Rat	lipopolysaccharide	decreases expression	ISO	RGD:731632	6480464	Lipopolysaccharides results in decreased expression of MERTK mRNA	CTD	PMID:25890327
Mertk	Rat	methylisothiazolinone	increases expression	ISO	RGD:731631	6480464	2-methyl-4-isothiazolin-3-one results in increased expression of MERTK mRNA	CTD	PMID:31629900
Mertk	Rat	nickel atom	decreases expression	ISO	RGD:731631	6480464	Nickel results in decreased expression of MERTK mRNA	CTD	PMID:24768652\|PMID:25583101
Mertk	Rat	nickel dichloride	decreases expression	ISO	RGD:731631	6480464	nickel chloride results in decreased expression of MERTK mRNA	CTD	PMID:17312168
Mertk	Rat	organophosphorus compound	decreases expression	ISO	RGD:731631	6480464	Organophosphorus Compounds results in decreased expression of MERTK protein	CTD	PMID:39115886
Mertk	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of MERTK mRNA	CTD	PMID:25729387
Mertk	Rat	oxaliplatin	increases expression	EXP		6480464	oxaliplatin results in increased expression of MERTK mRNA	CTD	PMID:25729387
Mertk	Rat	ozone	multiple interactions	ISO	RGD:731631	6480464	[Air Pollutants results in increased abundance of Ozone] which results in increased expression of MERTK more ...	CTD	PMID:26035830
Mertk	Rat	ozone	multiple interactions	ISO	RGD:731632	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ...	CTD	PMID:34911549
Mertk	Rat	paracetamol	multiple interactions	ISO	RGD:731632	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of MERTK mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
Mertk	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of MERTK mRNA	CTD	PMID:33387578
Mertk	Rat	paracetamol	increases expression	ISO	RGD:731631	6480464	Acetaminophen results in increased expression of MERTK mRNA	CTD	PMID:29067470
Mertk	Rat	paraquat	increases expression	ISO	RGD:731632	6480464	Paraquat results in increased expression of MERTK mRNA	CTD	PMID:21463325
Mertk	Rat	perfluorooctane-1-sulfonic acid	increases expression	ISO	RGD:731631	6480464	perfluorooctane sulfonic acid results in increased expression of MERTK protein	CTD	PMID:38758093
Mertk	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of MERTK mRNA	CTD	PMID:35163327
Mertk	Rat	perfluorooctanoic acid	increases expression	ISO	RGD:731631	6480464	perfluorooctanoic acid results in increased expression of MERTK mRNA	CTD	PMID:36326898
Mertk	Rat	perfluorooctanoic acid	decreases expression	EXP		6480464	perfluorooctanoic acid results in decreased expression of MERTK mRNA	CTD	PMID:35163327
Mertk	Rat	phorbol 13-acetate 12-myristate	increases cleavage	ISO	RGD:731631	6480464	Tetradecanoylphorbol Acetate results in increased cleavage of MERTK protein	CTD	PMID:17047157
Mertk	Rat	pirinixic acid	multiple interactions	ISO	RGD:731631	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ...	CTD	PMID:19710929
Mertk	Rat	potassium chromate	increases expression	ISO	RGD:731631	6480464	potassium chromate(VI) results in increased expression of MERTK mRNA	CTD	PMID:22714537
Mertk	Rat	propiconazole	decreases expression	ISO	RGD:731632	6480464	propiconazole results in decreased expression of MERTK mRNA	CTD	PMID:21278054
Mertk	Rat	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of MERTK mRNA	CTD	PMID:19013527\|PMID:28374803
Mertk	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:731631	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of MERTK mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
Mertk	Rat	serpentine asbestos	decreases expression	ISO	RGD:731631	6480464	Asbestos, Serpentine results in decreased expression of MERTK mRNA	CTD	PMID:21148743
Mertk	Rat	silicon dioxide	increases expression	ISO	RGD:731632	6480464	Silicon Dioxide results in increased expression of MERTK mRNA; Silicon Dioxide results in increased expression more ...	CTD	PMID:33232774
Mertk	Rat	silicon dioxide	affects response to substance	ISO	RGD:731632	6480464	MERTK protein affects the susceptibility to Silicon Dioxide	CTD	PMID:31284023
Mertk	Rat	silicon dioxide	multiple interactions	ISO	RGD:731632	6480464	GAS6 gene mutant form inhibits the reaction [Silicon Dioxide results in increased expression of MERTK more ...	CTD	PMID:31284023\|PMID:33232774
Mertk	Rat	simvastatin	multiple interactions	ISO	RGD:731631	6480464	[Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated more ...	CTD	PMID:28263720
Mertk	Rat	sodium arsenite	increases expression	ISO	RGD:731631	6480464	sodium arsenite results in increased expression of MERTK mRNA	CTD	PMID:22714537
Mertk	Rat	sodium arsenite	decreases expression	ISO	RGD:731631	6480464	sodium arsenite results in decreased expression of MERTK mRNA	CTD	PMID:29301061
Mertk	Rat	sodium arsenite	decreases expression	ISO	RGD:731632	6480464	sodium arsenite results in decreased expression of MERTK mRNA	CTD	PMID:16014739
Mertk	Rat	sodium dichromate	decreases expression	ISO	RGD:731631	6480464	sodium bichromate results in decreased expression of MERTK mRNA	CTD	PMID:17685462
Mertk	Rat	sulforaphane	decreases expression	ISO	RGD:731632	6480464	sulforaphane results in decreased expression of MERTK mRNA	CTD	PMID:30529165
Mertk	Rat	sunitinib	decreases expression	ISO	RGD:731631	6480464	Sunitinib results in decreased expression of MERTK mRNA	CTD	PMID:31533062
Mertk	Rat	tamoxifen	multiple interactions	ISO	RGD:731631	6480464	Tamoxifen inhibits the reaction [[Estradiol co-treated with EGF protein] results in increased expression of MERTK more ...	CTD	PMID:24758408
Mertk	Rat	testosterone	multiple interactions	ISO	RGD:731631	6480464	[Testosterone co-treated with Calcitriol] results in increased expression of MERTK mRNA	CTD	PMID:21592394
Mertk	Rat	testosterone	increases expression	ISO	RGD:731631	6480464	Testosterone results in increased expression of MERTK mRNA	CTD	PMID:21592394
Mertk	Rat	tetrachloromethane	affects expression	ISO	RGD:731632	6480464	Carbon Tetrachloride affects the expression of MERTK mRNA	CTD	PMID:17484886
Mertk	Rat	tetrachloromethane	increases expression	ISO	RGD:731632	6480464	Carbon Tetrachloride results in increased expression of MERTK mRNA	CTD	PMID:27339419
Mertk	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of MERTK mRNA	CTD	PMID:34492290
Mertk	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of MERTK mRNA	CTD	PMID:25729387
Mertk	Rat	tremolite asbestos	decreases expression	ISO	RGD:731632	6480464	tremolite results in decreased expression of MERTK mRNA	CTD	PMID:29279043
Mertk	Rat	trichostatin A	decreases expression	ISO	RGD:731631	6480464	trichostatin A results in decreased expression of MERTK mRNA	CTD	PMID:24935251
Mertk	Rat	trichostatin A	affects expression	ISO	RGD:731631	6480464	trichostatin A affects the expression of MERTK mRNA	CTD	PMID:28542535
Mertk	Rat	triclosan	increases expression	ISO	RGD:731631	6480464	Triclosan results in increased expression of MERTK mRNA	CTD	PMID:30510588
Mertk	Rat	urethane	increases expression	ISO	RGD:731631	6480464	Urethane results in increased expression of MERTK mRNA	CTD	PMID:28818685
Mertk	Rat	valproic acid	increases expression	ISO	RGD:731631	6480464	Valproic Acid results in increased expression of MERTK mRNA	CTD	PMID:19101580\|PMID:23179753\|PMID:23527032\|PMID:24935251\|PMID:28001369\|PMID:29154799\|PMID:37505509
Mertk	Rat	vinclozolin	decreases methylation	EXP		6480464	vinclozolin results in decreased methylation of MERTK gene	CTD	PMID:31079544

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mertk	Rat	apoptotic cell clearance	involved_in	ISO	RGD:731632	1624291	PMID:18159085	RGD	PMID:18159085
Mertk	Rat	apoptotic cell clearance	acts_upstream_of_or_within	IEA	UniProtKB:Q60805\|ensembl:ENSMUSP00000014505	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	apoptotic cell clearance	acts_upstream_of_or_within	ISO	RGD:731632	1624291	MGI:104294\|MGI:1347244\|MGI:2387768 PMID:17442946, PMID:18159085, PMID:23878224, PMID:29440417	RGD	PMID:17442946\|PMID:18159085\|PMID:23878224\|PMID:29440417
Mertk	Rat	cell migration	involved_in	IBA	MGI:104294\|MGI:1347244\|PANTHER:PTN002814495	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mertk	Rat	cell surface receptor protein tyrosine kinase signaling pathway	involved_in	IBA	FB:FBgn0003366\|FB:FBgn0003731\|FB:FBgn0003733\|FB:FBgn0010389\|FB:FBgn0032006\|FB:FBgn0040505\|FB:FBgn0283499\|FB:FBgn0285896\|MGI:104757\|MGI:104771\|MGI:1339758\|MGI:1345277\|MGI:95294\|MGI:95410\|MGI:95411\|MGI:95522\|MGI:95525\|MGI:95558\|MGI:96433\|MGI:96575\|MGI:97384\|MGI:97530\|MGI:97531\|MGI:97902\|MGI:99216\|MGI:99654\|PANTHER:PTN001230349\|RGD:2561\|RGD:2611\|RGD:2612\|RGD:2917\|RGD:2965\|RGD:3213\|RGD:620486\|UniProtKB:A0A8J1L5W1\|UniProtKB:A0A8M1NUM7\|UniProtKB:A0A8M1PBN6\|UniProtKB:A0A8M9QKL5\|UniProtKB:A0A8N7UZS2\|UniProtKB:P00533\|UniProtKB:P04626\|UniProtKB:P04629\|UniProtKB:P06213\|UniProtKB:P07949\|UniProtKB:P08069\|UniProtKB:P09619\|UniProtKB:P10721\|UniProtKB:P11362\|UniProtKB:P16234\|UniProtKB:P17948\|UniProtKB:P21860\|UniProtKB:P22455\|UniProtKB:P22607\|UniProtKB:P29317\|UniProtKB:P29376\|UniProtKB:P35916\|UniProtKB:P54760\|UniProtKB:Q02763\|UniProtKB:Q15303\|UniProtKB:Q16288\|UniProtKB:Q16620\|UniProtKB:Q9UM73\|WB:WBGene00001184\|ZFIN:ZDB-GENE-980526-255	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mertk	Rat	establishment of localization in cell	acts_upstream_of_or_within	ISO	RGD:731632	1624291	MGI:2387765 PMID:15650770	RGD	PMID:15650770
Mertk	Rat	establishment of localization in cell	acts_upstream_of_or_within	IEA	UniProtKB:Q60805\|ensembl:ENSMUSP00000014505	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	lymphocyte activation	acts_upstream_of	IEA	UniProtKB:Q60805\|ensembl:ENSMUSP00000014505	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	lymphocyte activation	acts_upstream_of	ISO	RGD:731632	1624291	MGI:104294\|MGI:1347244 PMID:11452127	RGD	PMID:11452127
Mertk	Rat	natural killer cell differentiation	acts_upstream_of_or_within	ISO	RGD:731632	1624291	MGI:104294\|MGI:1347244 PMID:16751775	RGD	PMID:16751775
Mertk	Rat	natural killer cell differentiation	acts_upstream_of_or_within	IEA	UniProtKB:Q60805\|ensembl:ENSMUSP00000014505	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	negative regulation of cytokine production	acts_upstream_of_or_within	ISO	RGD:731632	1624291	MGI:1347244 PMID:23878224	RGD	PMID:23878224
Mertk	Rat	negative regulation of cytokine production	acts_upstream_of_or_within	IEA	UniProtKB:Q60805\|ensembl:ENSMUSP00000014505	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	negative regulation of leukocyte apoptotic process	involved_in	ISO	RGD:731631	1624291	PMID:23353780	RGD	PMID:23353780
Mertk	Rat	negative regulation of leukocyte apoptotic process	involved_in	IEA	UniProtKB:Q12866\|ensembl:ENSP00000295408	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	negative regulation of lymphocyte activation	acts_upstream_of_or_within	ISO	RGD:731632	1624291	MGI:104294\|MGI:1347244 PMID:11452127	RGD	PMID:11452127
Mertk	Rat	negative regulation of lymphocyte activation	acts_upstream_of_or_within	IEA	UniProtKB:Q60805\|ensembl:ENSMUSP00000014505	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	nervous system development	involved_in	IBA	MGI:104294\|MGI:1347244\|PANTHER:PTN002814495\|WB:WBGene00020504	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mertk	Rat	neutrophil clearance	acts_upstream_of_or_within	IEA	UniProtKB:Q60805\|ensembl:ENSMUSP00000014505	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	neutrophil clearance	acts_upstream_of_or_within	ISO	RGD:731632	1624291	MGI:1347244 PMID:23878224	RGD	PMID:23878224
Mertk	Rat	phagocytosis		IMP		1299193		RGD
Mertk	Rat	phagocytosis	involved_in	IEA	UniProtKB:Q12866\|ensembl:ENSP00000295408	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	phagocytosis	involved_in	IBA	MGI:104294\|MGI:1347244\|MGI:96965\|PANTHER:PTN001231011\|RGD:69283\|UniProtKB:P30530\|UniProtKB:Q12866	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mertk	Rat	phagocytosis	involved_in	ISO	RGD:731631	1624291	PMID:19204785	RGD	PMID:19204785
Mertk	Rat	phagocytosis		IDA		1299193		RGD
Mertk	Rat	platelet activation	acts_upstream_of_or_within	ISO	RGD:731632	1624291	MGI:2387765 PMID:15650770	RGD	PMID:15650770
Mertk	Rat	platelet activation	acts_upstream_of_or_within	IEA	UniProtKB:Q60805\|ensembl:ENSMUSP00000014505	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	positive regulation of phagocytosis		IDA		69668		RGD
Mertk	Rat	positive regulation of phagocytosis	involved_in	IEA	UniProtKB:Q12866\|ensembl:ENSP00000295408	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	positive regulation of phagocytosis	involved_in	ISO	RGD:731631	1624291	PMID:18395422	RGD	PMID:18395422
Mertk	Rat	positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	acts_upstream_of_or_within	ISO	RGD:731632	1624291	MGI:95660 PMID:15650770	RGD	PMID:15650770
Mertk	Rat	positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	acts_upstream_of_or_within	IEA	UniProtKB:Q60805\|ensembl:ENSMUSP00000014505	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	protein phosphorylation		IDA		1299193		RGD
Mertk	Rat	retina development in camera-type eye	acts_upstream_of_or_within	IEA	UniProtKB:Q60805\|ensembl:ENSMUSP00000014505	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	retina development in camera-type eye	acts_upstream_of_or_within	ISO	RGD:731632	1624291	PMID:21052544	RGD	PMID:21052544
Mertk	Rat	secretion by cell	acts_upstream_of_or_within	ISO	RGD:731632	1624291	MGI:2387765 PMID:15650770	RGD	PMID:15650770
Mertk	Rat	secretion by cell	acts_upstream_of_or_within	IEA	UniProtKB:Q60805\|ensembl:ENSMUSP00000014505	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	spermatogenesis	acts_upstream_of_or_within	ISO	RGD:731632	1624291	MGI:104294\|MGI:1347244 PMID:10227296	RGD	PMID:10227296
Mertk	Rat	spermatogenesis	acts_upstream_of_or_within	IEA	UniProtKB:Q60805\|ensembl:ENSMUSP00000014505	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	substrate adhesion-dependent cell spreading	acts_upstream_of_or_within	ISO	RGD:731632	1624291	MGI:2387765 PMID:15650770	RGD	PMID:15650770
Mertk	Rat	substrate adhesion-dependent cell spreading	acts_upstream_of_or_within	IEA	UniProtKB:Q60805\|ensembl:ENSMUSP00000014505	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	vagina development	acts_upstream_of_or_within	ISO	RGD:731632	1624291	MGI:104294\|MGI:1347244 PMID:18393392	RGD	PMID:18393392
Mertk	Rat	vagina development	acts_upstream_of_or_within	IEA	UniProtKB:Q60805\|ensembl:ENSMUSP00000014505	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mertk	Rat	cytoplasm	located_in	ISO	RGD:731631	1624291	PMID:18395422, PMID:19204785	RGD	PMID:18395422\|PMID:19204785
Mertk	Rat	cytoplasm	located_in	IEA	UniProtKB:Q12866\|ensembl:ENSP00000295408	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	extracellular space	located_in	ISO	RGD:731631	1624291	PMID:18395422	RGD	PMID:18395422
Mertk	Rat	extracellular space	located_in	IEA	UniProtKB:Q12866\|ensembl:ENSP00000295408	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mertk	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Mertk	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mertk	Rat	photoreceptor outer segment		IDA		1299193		RGD
Mertk	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Mertk	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mertk	Rat	plasma membrane	is_active_in	IBA	FB:FBgn0003731\|FB:FBgn0003733\|FB:FBgn0010389\|FB:FBgn0011829\|FB:FBgn0032006\|FB:FBgn0283499\|MGI:103581\|MGI:104771\|MGI:1339758\|MGI:95294\|MGI:95410\|MGI:95411\|MGI:95522\|MGI:95524\|MGI:95559\|MGI:96433\|MGI:96575\|MGI:96683\|MGI:97530\|MGI:99614\|PANTHER:PTN001230349\|RGD:2252\|RGD:2543\|RGD:2869\|RGD:2917\|RGD:3082\|RGD:3211\|RGD:3213\|RGD:3214\|RGD:3284\|RGD:3285\|RGD:619855\|RGD:620144\|RGD:69323\|UniProtKB:A0A8J1L5W1\|UniProtKB:G1K218\|UniProtKB:P00533\|UniProtKB:P04626\|UniProtKB:P04629\|UniProtKB:P06213\|UniProtKB:P07333\|UniProtKB:P08069\|UniProtKB:P08581\|UniProtKB:P09619\|UniProtKB:P10721\|UniProtKB:P11362\|UniProtKB:P16234\|UniProtKB:P17948\|UniProtKB:P21709\|UniProtKB:P21802\|UniProtKB:P21860\|UniProtKB:P22455\|UniProtKB:P22607\|UniProtKB:P29317\|UniProtKB:P30530\|UniProtKB:P35968\|UniProtKB:P54760\|UniProtKB:Q01973\|UniProtKB:Q05688\|UniProtKB:Q15303\|UniProtKB:Q16832\|WB:WBGene00000289\|WB:WBGene00000898\|WB:WBGene00002299\|WB:WBGene00003007\|WB:WBGene00006868\|ZFIN:ZDB-GENE-030131-6458	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mertk	Rat	receptor complex	part_of	IBA	FB:FBgn0015380\|FB:FBgn0024245\|FB:FBgn0033791\|FB:FBgn0283499\|MGI:95410\|PANTHER:PTN001230349\|UniProtKB:A6QR62\|UniProtKB:O15146\|UniProtKB:P00533\|UniProtKB:P04626\|UniProtKB:P04629\|UniProtKB:P06213\|UniProtKB:P07949\|UniProtKB:P08069\|UniProtKB:P11362\|UniProtKB:P14616\|UniProtKB:P17948\|UniProtKB:P21860\|UniProtKB:P35916\|UniProtKB:Q01973\|UniProtKB:Q08345\|UniProtKB:Q15303\|UniProtKB:Q16288\|UniProtKB:Q16620	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mertk	Rat	ATP binding	enables	IEA	UniRule:UR001503341	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Mertk	Rat	ATP binding	enables	IEA	InterPro:IPR000719\|InterPro:IPR017441	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Mertk	Rat	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mertk	Rat	kinase activity	enables	IEA	UniProtKB-KW:KW-0418	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mertk	Rat	nucleotide binding	enables	IEA	UniRule:UR001503341	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Mertk	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mertk	Rat	protein binding	enables	ISO	RGD:731631	1624291	UniProtKB:Q14393 PMID:20103767	RGD	PMID:20103767
Mertk	Rat	protein kinase activity	enables	IEA	InterPro:IPR000719\|InterPro:IPR001245\|InterPro:IPR008266	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Mertk	Rat	protein tyrosine kinase activity	enables	IEA	UniProtKB-KW:KW-0829	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mertk	Rat	protein tyrosine kinase activity	enables	IEA	RHEA:10596	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Mertk	Rat	protein tyrosine kinase activity	enables	IEA	InterPro:IPR020635	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Mertk	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mertk	Rat	transmembrane receptor protein tyrosine kinase activity		NAS		1299193		RGD
Mertk	Rat	transmembrane receptor protein tyrosine kinase activity	enables	IEA	EC:2.7.10.1	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Mertk	Rat	transmembrane receptor protein tyrosine kinase activity	enables	IBA	FB:FBgn0003366\|FB:FBgn0003731\|FB:FBgn0003733\|FB:FBgn0010389\|FB:FBgn0032006\|FB:FBgn0040505\|FB:FBgn0283499\|FB:FBgn0285896\|MGI:104771\|MGI:107381\|MGI:1339758\|MGI:1345277\|MGI:95294\|MGI:95522\|MGI:95558\|MGI:95561\|MGI:96433\|MGI:96575\|MGI:96677\|MGI:96683\|MGI:97384\|MGI:97530\|MGI:97531\|MGI:97902\|MGI:99654\|PANTHER:PTN001230349\|RGD:2611\|RGD:2621\|RGD:2917\|RGD:2965\|RGD:3082\|RGD:3213\|RGD:3284\|RGD:620144\|UniProtKB:A0A8J1L5W1\|UniProtKB:P00533\|UniProtKB:P04626\|UniProtKB:P04629\|UniProtKB:P06213\|UniProtKB:P07333\|UniProtKB:P07949\|UniProtKB:P08069\|UniProtKB:P09619\|UniProtKB:P10721\|UniProtKB:P11362\|UniProtKB:P14616\|UniProtKB:P16234\|UniProtKB:P17948\|UniProtKB:P21709\|UniProtKB:P22455\|UniProtKB:P22607\|UniProtKB:P29317\|UniProtKB:P29376\|UniProtKB:P35916\|UniProtKB:P35968\|UniProtKB:P54760\|UniProtKB:Q02763\|UniProtKB:Q15303\|UniProtKB:Q16620\|UniProtKB:Q91987\|UniProtKB:Q9UM73\|WB:WBGene00000289\|WB:WBGene00006868\|WB:WBGene00020504\|ZFIN:ZDB-GENE-980526-255	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mertk	Rat	thin retina outer nuclear layer		IAGP		69668		RGD

#	Reference Title	Reference Citation
1.	Mer receptor tyrosine kinase signaling participates in platelet function.	Chen C, etal., Arterioscler Thromb Vasc Biol. 2004 Jun;24(6):1118-23. Epub 2004 May 6.
2.	Mutation of the receptor tyrosine kinase gene Mertk in the retinal dystrophic RCS rat.	D'Cruz PM, etal., Hum Mol Genet 2000 Mar 1;9(4):645-51.
3.	Mertk triggers uptake of photoreceptor outer segments during phagocytosis by cultured retinal pigment epithelial cells.	Feng W, etal., J Biol Chem 2002 May 10;277(19):17016-22. Epub 2002 Feb 22.
4.	Focal adhesion kinase signaling promotes phagocytosis of integrin-bound photoreceptors.	Finnemann SC EMBO J 2003 Aug 15;22(16):4143-54.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Correction of the retinal dystrophy phenotype of the RCS rat by viral gene transfer of Mertk.	Vollrath D, etal., Proc Natl Acad Sci U S A 2001 Oct 23;98(22):12584-9.

PMID:1299193	PMID:10227296	PMID:11452127	PMID:15180281	PMID:15650770	PMID:16751775	PMID:17442946	PMID:18159085	PMID:18393392	PMID:18395422	PMID:19204785	PMID:20238011
PMID:21052544	PMID:22871113	PMID:23353780	PMID:23878224	PMID:26283020	PMID:26458944	PMID:28210098	PMID:28500071	PMID:29440417	PMID:29659094	PMID:30054542	PMID:34440696
PMID:34829984	PMID:38588709	PMID:38783191

Mertk
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	136,391,936 - 136,498,366 (+)	NCBI		GRCr8
mRatBN7.2	3	115,939,351 - 116,045,141 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	115,939,351 - 116,046,554 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	119,836,222 - 119,942,080 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	128,431,776 - 128,537,642 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	126,092,272 - 126,198,124 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	121,235,230 - 121,340,932 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	121,235,119 - 121,342,444 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	128,669,534 - 128,777,078 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	116,308,387 - 116,416,414 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	116,213,959 - 116,321,987 (+)	NCBI
Celera	3	114,768,654 - 114,872,632 (+)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

MERTK
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	111,898,607 - 112,029,561 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	111,898,607 - 112,029,561 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	112,656,184 - 112,787,138 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	112,372,662 - 112,503,416 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	112,372,415 - 112,503,168	NCBI
Celera	2	106,258,379 - 106,389,184 (-)	NCBI		Celera
Cytogenetic Map	2	q13	NCBI
HuRef	2	105,169,541 - 105,300,438 (+)	NCBI		HuRef
CHM1_1	2	112,661,190 - 112,791,926 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	112,325,012 - 112,456,507 (+)	NCBI		T2T-CHM13v2.0

Mertk
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	128,540,836 - 128,645,082 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	128,540,876 - 128,644,814 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	128,698,915 - 128,803,162 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	128,698,956 - 128,802,894 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	128,524,733 - 128,627,923 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	128,390,438 - 128,493,628 (+)	NCBI		MGSCv36	mm8
Celera	2	129,929,620 - 130,029,340 (+)	NCBI		Celera
Cytogenetic Map	2	F1	NCBI
cM Map	2	62.63	NCBI

Mertk
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955470	2,065,411 - 2,167,909 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955470	2,065,468 - 2,167,909 (-)	NCBI	ChiLan1.0	ChiLan1.0

MERTK
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	16,046,414 - 16,179,196 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	16,049,177 - 16,181,960 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	89,977,226 - 90,109,970 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	113,055,554 - 113,162,556 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	113,056,852 - 113,162,052 (+)	Ensembl	panpan1.1		panPan2

MERTK
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	36,336,787 - 36,445,796 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	36,336,861 - 36,445,380 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	36,106,597 - 36,218,038 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	37,111,333 - 37,223,997 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	37,111,394 - 37,223,995 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	36,231,212 - 36,343,496 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	36,303,304 - 36,415,155 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	36,515,620 - 36,628,095 (+)	NCBI		UU_Cfam_GSD_1.0

Mertk
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	81,712,891 - 81,810,395 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936783	607,382 - 704,889 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936783	607,425 - 704,879 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MERTK
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	44,349,385 - 44,483,402 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	44,349,377 - 44,483,400 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	45,947,411 - 45,961,016 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MERTK
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	14,971,858 - 15,100,736 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	15,001,471 - 15,101,025 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666080	4,589,380 - 4,720,259 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mertk
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624749	341,289 - 443,640 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624749	337,441 - 444,730 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Mertk
715 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	233
Count of miRNA genes:	172
Interacting mature miRNAs:	198
Transcripts:	ENSRNOT00000023419
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
7387306	Bw124	Body weight QTL 124	3.2	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	3	84091273	129091273	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1358204	Insglur1	Insulin/glucose ratio QTL 1	3.8		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	3	115638168	135181505	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
1331758	Bp207	Blood pressure QTL 207	2.848		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	112287552	135181505	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat

AU048840

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	115,948,841 - 115,949,055 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	121,244,720 - 121,244,933	NCBI	Rnor6.0
Rnor_5.0	3	128,767,375 - 128,767,588	UniSTS	Rnor5.0
RGSC_v3.4	3	116,317,877 - 116,318,090	UniSTS	RGSC3.4
Celera	3	114,778,144 - 114,778,357	UniSTS
Cytogenetic Map	3	q36	UniSTS

MERTK

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	116,036,473 - 116,038,063 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	121,332,265 - 121,333,854	NCBI	Rnor6.0
Rnor_5.0	3	128,678,440 - 128,680,029	UniSTS	Rnor5.0
RGSC_v3.4	3	116,407,747 - 116,409,336	UniSTS	RGSC3.4
Celera	3	114,863,955 - 114,865,544	UniSTS
Cytogenetic Map	3	q36	UniSTS

The following Strains have been annotated to Mertk

(LE x RCS-p⁺/LavRrrc)F1

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_022943	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284527	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF208235	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF208236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221127	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KY305009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023419 ⟹ ENSRNOP00000023419

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	115,968,752 - 116,046,554 (+)	Ensembl
Rnor_6.0 Ensembl	3	121,235,119 - 121,342,444 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097978 ⟹ ENSRNOP00000076826

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	115,939,351 - 116,046,554 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107394 ⟹ ENSRNOP00000082953

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	115,944,529 - 116,046,554 (+)	Ensembl

RefSeq Acc Id:

NM_022943 ⟹ NP_075232

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	136,392,574 - 136,498,366 (+)	NCBI
mRatBN7.2	3	115,939,351 - 116,045,141 (+)	NCBI
Rnor_6.0	3	121,235,230 - 121,340,932 (+)	NCBI
Rnor_5.0	3	128,669,534 - 128,777,078 (-)	NCBI
RGSC_v3.4	3	116,308,387 - 116,416,414 (+)	RGD
Celera	3	114,768,654 - 114,872,632 (+)	RGD

Sequence:

show sequence

CATCTGTCCGGAGAGAACTGCCAGATCCGCGGCCCCGCGATGGTTCTGGCCCCACTACTGCTGGGGCTGCTGCTGCTATCCGCACTCTGGAATGGAGGCACTGCTGAAAAGGAGGAAGAAATCAAGCC
AGATCAGCCATTTTCAGGGCCTTTACCAGGGAGCCTACCAGCTGACCACAGGCCATTCTTCGCCCCTCACTCCAGTGGGGACCAGCTGTCACCATCCCAGACTGGAAGATCACATCCAGCACACACAG
CCACTCCCCAGATGACCTCTGCAGCATCAAACCTCCTGCCTCCTGTTGCATTTAAAAACACAATTGGACGCATAGTACTTTCGGAACATAAAAGTGTCAAATTTAATTGCTCGATCAACATTCCTAAC
GTGTATCAAGAAACAGCTGGCATTTCGTGGTGGAAAGATGGAAAGGAACTGCTTGGGGCACATCATTCAATCACACAGTTTTATCCTGATGAGGAAGGGGTATCAATAATTGCATTGTTCAGCATAAC
CAGTGTGCAGCGCTCAGACAATGGGTCGTACATCTGTAAGATGAAGGTGAACGATAGAGAGGTTGTGTCTGATCCCATATACGTGGAAGTCCAAGGACTCCCTTACTTTACTAAGCAGCCTGAGAGCG
TGAATGTCACCAGAAACACAGCCTTCAACCTCACCTGCCAGGCTGTGGGACCCCCTGAGCCCGTCAACATCTTCTGGGTTCAAAATAGCAGCCGTGTTAATGAAAATCCAGAAAGGTCCCCGTCTGTC
CTAACTGTCGCTGGTCTGACAGAGACCGCAGTCTTCAGCTGTGAGGCCCACAACGACAAAGGACTGACGGTGTCCAAGGGTGTACAGATCAACATCAAAGTCATCCCTTCCCCACCCACTGAAGTCCA
TATCCTCAACAGCACAGCGCACAGCATCCTGGTCTCCTGGGTCCCAGGGTTTGATGGCTACTCCCCACTTCAGAACTGCAGCATTCAGGTCAAGGAAGCTGACCAGCTGAGTAATGGCTCAGTCATGG
TTTTTAATACCTCTGCTTCGCCACATCTGTATGAAGTCCAGCAGCTGCAAGCCCTGGCTAATTACAGCGTCACTGTGTCCTGTCGGAATGAGATTGGCTGGTCTGCAGTGAGCCCTTGGATCCTGGCC
AGCACTACAGAAGGAGCTCCAGCAGTGGCGCCTCTAAACATCACTGTGTTTCTGAACGAATCCAGCAACAACCTGGAAATCAGATGGACGAAGCCTCCAATTAAGCGGCAGGATGGGGAACTGGTGGG
CTACCGGATATCTCACGTGTGGGAGAGTGCGGGGACTTCCAAAGAGCTTTCTGAAGAAGTCAGCCAGAATGGCAGCTGGGCTCAGGTTCCTGTCCAAATGCACAATGCCACCTGCACAGTGAGAATCG
CCGTCATCACTAAAGGGGGCATTGGGCCCTTCAGTGAGCCAGTGGACGTAGCCATTCCGGAGCACAGTAGGGTAGATTACGCACCCTCATCAACCCCAGCCCCTGGCAACACCGAGTCTATGCTCATC
ATCCTGGGCTGCTTCTGCGGGTTTGTTCTCATGGGGTTGATTCTGTATCTTTCTCTGGCCATCAAAAGGAGAGTCCAGGAAACAAAGTTTGGGGGTGCATTCTCCGAGGAGGACTCCCAATTAGTTGT
AAATTACAGAGCAAAGAAGTCCTTCTGTCGGCGAGCCATCGAGCTTACCTTGCAAAGCCTGGGGGTGAGCGAGGAGCTGCAAAACAAGCTAGAAGATGTTGTGGTTGACAGAAATCTTCTAATTCTTG
GGAAAGTTCTGGGCGAAGGAGAGTTTGGGTCTGTAATGGAAGGAAATCTGAAGCAGGAAGATGGGACTTCTCAGAAGGTGGCAGTGAAGACCATGAAGTTGGACAACTTTTCTCTACGGGAGATCGAG
GAGTTTCTCAGCGAAGCAGCGTGCATGAAAGACTTCAATCACCCAAACGTCATCCGGCTTCTAGGCGTGTGTATAGAACTGAGCTCTCAAGGCATCCCGAAGCCCATGGTGATTTTACCCTTCATGAA
ATACGGAGACCTCCACACCTTCCTGCTATATTCCCGGATAGAATCAGTACCGAAGTCCATCCCCCTGCAGACACTGCTGAAGTTCATGGTGGACATTGCCCAGGGAATGGAGTACCTGAGCAGCAGGA
ATTTTCTCCACAGGGATTTAGCTGCTCGGAATTGCATGTTGCGGGATGACATGACTGTCTGCGTGGCAGACTTTGGCCTCTCTAAGAAGATTTACAGTGGTGATTATTACCGCCAAGGCCGCATTGCC
AAAATGCCTGTGAAGTGGATCGCCATAGAGAGCCTGGCGGACCGAGTCTACACAAGCAAGAGTGACGTGTGGGCTTTTGGCGTGACCATGTGGGAAATAGCAACACGGGGAATGACTCCCTATCCTGG
AGTCCAGAACCATGAGATGTACGATTACCTTCTCCACGGCCACAGGCTGAAGCAGCCCGAGGACTGCCTGGATGATCTGTATGAAATCATGTACTCTTGCTGGAGTGCTGATCCCCTGGACCGACCCA
CCTTCTCAGTGCTGAGGCTGCAGCTGGAAAAGCTCTCCGAGAGTTTGCCTGATGCCCAGGACAAAGAATCCATCATCTACATCAATACACAGTTACTAGAGAGCTGCGAGGGCCTAGCCAACAGGTCC
TCCCTCGCAGGGCTAGACATGAACATTGATCCTGACTCCATCATTGCCTCTTGCACAGCAGGTGCTGCTGTCAGCGTGGTCATGGCGGAAGTTCACGAGAACAACCTTCATGAGGAAAGATACATCTT
AAATGGGGGCAACGAGGAATGGGAAGATGTGGCCTCCACTCCATTTGCTACAGTCACAGCTGGAAAAGATGGTGTGTTACCAGAGGACAGACTCACCAAAAATGGCATCTCCTGGTCTCACCATAGTA
CGCTACCCTTGGGGAGCCCATCACCAGATGAACTTCTGTTTGCAGACGACTCCTCGGGAGACTCTGAAGTTCTGATGTGA

hide sequence

RefSeq Acc Id:

XM_063284527 ⟹ XP_063140597

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	136,391,936 - 136,480,115 (+)	NCBI


Protein RefSeqs	NP_075232	(Get FASTA)	NCBI Sequence Viewer
	XP_063140597	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF44060	(Get FASTA)	NCBI Sequence Viewer
	AAF44061	(Get FASTA)	NCBI Sequence Viewer
	APO36716	(Get FASTA)	NCBI Sequence Viewer
	EDL80138	(Get FASTA)	NCBI Sequence Viewer
	EDL80139	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000076826
	ENSRNOP00000076826.1
GenBank Protein	P57097	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_075232 ⟸ NM_022943
- Peptide Label:	precursor
- UniProtKB:	P57097 (UniProtKB/Swiss-Prot), A6HQ37 (UniProtKB/TrEMBL), A0A8I5ZYY3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVLAPLLLGLLLLSALWNGGTAEKEEEIKPDQPFSGPLPGSLPADHRPFFAPHSSGDQLSPSQTGRSHPAHTATPQMTSAASNLLPPVAFKNTIGRIVLSEHKSVKFNCSINIPNVYQETAGISWWKD GKELLGAHHSITQFYPDEEGVSIIALFSITSVQRSDNGSYICKMKVNDREVVSDPIYVEVQGLPYFTKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNENPERSPSVLTVAGLTETAVFS CEAHNDKGLTVSKGVQINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADQLSNGSVMVFNTSASPHLYEVQQLQALANYSVTVSCRNEIGWSAVSPWILASTTEGAPAVAPLN ITVFLNESSNNLEIRWTKPPIKRQDGELVGYRISHVWESAGTSKELSEEVSQNGSWAQVPVQMHNATCTVRIAVITKGGIGPFSEPVDVAIPEHSRVDYAPSSTPAPGNTESMLIILGCFCGFVLMGL ILYLSLAIKRRVQETKFGGAFSEEDSQLVVNYRAKKSFCRRAIELTLQSLGVSEELQNKLEDVVVDRNLLILGKVLGEGEFGSVMEGNLKQEDGTSQKVAVKTMKLDNFSLREIEEFLSEAACMKDFN HPNVIRLLGVCIELSSQGIPKPMVILPFMKYGDLHTFLLYSRIESVPKSIPLQTLLKFMVDIAQGMEYLSSRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLA DRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDDLYEIMYSCWSADPLDRPTFSVLRLQLEKLSESLPDAQDKESIIYINTQLLESCEGLANRSSLAGLDMNIDPDS IIASCTAGAAVSVVMAEVHENNLHEERYILNGGNEEWEDVASTPFATVTAGKDGVLPEDRLTKNGISWSHHSTLPLGSPSPDELLFADDSSGDSEVLM hide sequence

Ensembl Acc Id:

ENSRNOP00000023419 ⟸ ENSRNOT00000023419

Ensembl Acc Id:

ENSRNOP00000076826 ⟸ ENSRNOT00000097978

Ensembl Acc Id:

ENSRNOP00000082953 ⟸ ENSRNOT00000107394

RefSeq Acc Id:	XP_063140597 ⟸ XM_063284527
- Peptide Label:	isoform X1

Protein Domains

Fibronectin type-III Ig-like Ig-like C2-type Protein kinase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P57097-F1-model_v2	AlphaFold	P57097	1-994	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13692414

Promoter ID:

EPDNEW_R2939

Type:

multiple initiation site

Name:

Mertk_1

Description:

MER proto-oncogene, tyrosine kinase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	121,235,112 - 121,235,172	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-47937	BioCyc
Ensembl Genes	ENSRNOG00000017319	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000097978	ENTREZGENE
	ENSRNOT00000097978.1	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot
	Phosphorylase Kinase, domain 1	UniProtKB/Swiss-Prot
	Transferase(Phosphotransferase) domain 1	UniProtKB/Swiss-Prot
InterPro	FN3_dom	UniProtKB/Swiss-Prot
	FN3_sf	UniProtKB/Swiss-Prot
	Ig-like_dom	UniProtKB/Swiss-Prot
	Ig-like_dom_sf	UniProtKB/Swiss-Prot
	Ig-like_fold	UniProtKB/Swiss-Prot
	Ig_sub	UniProtKB/Swiss-Prot
	Immunoglobulin	UniProtKB/Swiss-Prot
	Kinase-like_dom_sf	UniProtKB/Swiss-Prot
	Prot_kinase_dom	UniProtKB/Swiss-Prot
	Protein_kinase_ATP_BS	UniProtKB/Swiss-Prot
	RTK	UniProtKB/Swiss-Prot
	Ser-Thr/Tyr_kinase_cat_dom	UniProtKB/Swiss-Prot
	Tyr_kinase_AS	UniProtKB/Swiss-Prot
	Tyr_kinase_cat_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:65037	UniProtKB/Swiss-Prot
NCBI Gene	65037	ENTREZGENE
PANTHER	TYROSINE-PROTEIN KINASE MER	UniProtKB/Swiss-Prot
	TYROSINE-PROTEIN KINASE RECEPTOR	UniProtKB/Swiss-Prot
Pfam	fn3	UniProtKB/Swiss-Prot
	Ig_3	UniProtKB/Swiss-Prot
	PF00047	UniProtKB/Swiss-Prot
	Pkinase_Tyr	UniProtKB/Swiss-Prot
PhenoGen	Mertk	PhenoGen
PRINTS	TYRKINASE	UniProtKB/Swiss-Prot
PROSITE	FN3	UniProtKB/Swiss-Prot
	IG_LIKE	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_ATP	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_DOM	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_TYR	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000017319	RatGTEx
SMART	FN3	UniProtKB/Swiss-Prot
	SM00409	UniProtKB/Swiss-Prot
	TyrKc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot
	SSF49265	UniProtKB/Swiss-Prot
	SSF56112	UniProtKB/Swiss-Prot
UniProt	A0A1L5L8Q5_RAT	UniProtKB/TrEMBL
	A0A8I5ZYY3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2QC30_RAT	UniProtKB/TrEMBL
	A6HQ37	ENTREZGENE, UniProtKB/TrEMBL
	A6HQ38_RAT	UniProtKB/TrEMBL
	MERTK_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q9JL63_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-10	Mertk	MER proto-oncogene, tyrosine kinase	Mertk	c-mer proto-oncogene tyrosine kinase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-06-06	Mertk	c-mer proto-oncogene tyrosine kinase	Rdy	retinal dystrophy	Data merged from RGD:3550	737654	APPROVED
2003-04-09	Rdy	retinal dystrophy		Retinal dystrophy	Name updated	629478	APPROVED
2002-06-10	Rdy	Retinal dystrophy			Symbol and Name status set to approved	70586	APPROVED
2002-06-10	Mertk	c-mer proto-oncogene tyrosine kinase			Symbol and Name status set to approved	70586	APPROVED

Note Type	Note	Reference
gene_disease	mutation causes the retinal dystrophy (rdy) phenotype in the Royal College of Surgeons (RCS) rat	69668
gene_disease	mutation causes the retinal dystrophy (rdy) phenotype in the Royal College of Surgeons (RCS) rat	1299193
gene_function	tyrosine kinase receptor	61793
gene_function	tyrosine kinase receptor	69668
gene_mutations_overexpression	gene transfer corrects a defect in retinal pigment epithelium (RPE) phagocytosis in the retinal dystrophy (rdy) locus of the Royal College of Surgeons (RCS) rat by restoring normal phagocytosis of shed photoreceptor outer segments	69668
gene_mutations_overexpression	gene transfer to the eyes of young Royal College of Surgeons (RCS) rats with (rdy) retinal dystrophy increases sensitivity to low intensity light	69668
gene_process	required for proper retina functioning	61793
gene_process	required for proper retina functioning	69668
gene_process	involved as a signaling molecule triggering outer segment uptake during phagocytosis	1299193
gene_product	member of the axl family	61793
gene_product	member of the axl family	69668
gene_protein	994 amino acids	61793
gene_protein	994 amino acids	69668

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Mammalian Phenotype