Advanced Search (OLGA)

Gene: Chrna6 (cholinergic receptor nicotinic alpha 6 subunit) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Chrna6

Name:

cholinergic receptor nicotinic alpha 6 subunit

RGD ID:

69281

Description:

Contributes to heterocyclic compound binding activity. Predicted to be involved in several processes, including behavioral response to nicotine; presynaptic modulation of chemical synaptic transmission; and synaptic signaling. Predicted to act upstream of or within regulation of dopamine secretion. Part of protein-containing complex. Is active in postsynaptic membrane and presynaptic membrane. Human ortholog(s) of this gene implicated in alcohol use disorder; cocaine abuse; and nicotine dependence. Orthologous to human CHRNA6 (cholinergic receptor nicotinic alpha 6 subunit); PARTICIPATES IN acetylcholine signaling pathway via nicotinic acetylcholine receptor; INTERACTS WITH ammonium chloride; bisphenol A; chlorpyrifos.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cholinergic receptor, nicotinic, alpha 6; cholinergic receptor, nicotinic, alpha 6 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 6; neuronal acetylcholine receptor subunit alpha-6

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CHRNA6 (cholinergic receptor nicotinic alpha 6 subunit)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Chrna6 (cholinergic receptor, nicotinic, alpha polypeptide 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Chrna6 (cholinergic receptor nicotinic alpha 6 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CHRNA6 (cholinergic receptor nicotinic alpha 6 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CHRNA6 (cholinergic receptor nicotinic alpha 6 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Chrna6 (cholinergic receptor nicotinic alpha 6 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CHRNA6 (cholinergic receptor nicotinic alpha 6 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CHRNA6 (cholinergic receptor nicotinic alpha 6 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Chrna6 (cholinergic receptor nicotinic alpha 6 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CHRNA6 (cholinergic receptor nicotinic alpha 6 subunit)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Chrna6 (cholinergic receptor, nicotinic, alpha polypeptide 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	chrna6 (cholinergic receptor, nicotinic, alpha 6)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	acr-12	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	acr-2	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	acr-6	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	acr-8	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	nAChRalpha1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	nAChRalpha2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	nAChRbeta1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	nAChRbeta2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	nAChRalpha3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	nAChRalpha4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	unc-38	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	unc-63	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	lev-8	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	acr-3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	chrna6	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Allele / Splice:

Chrna6^em1Slot ; Chrna6^em2Slot

Genetic Models:

SD-Chrna6^em1Slot ; SD-Chrna6^em2Slot

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	71,400,615 - 71,407,315 (+)	NCBI		GRCr8
mRatBN7.2	16	64,697,741 - 64,704,441 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	64,697,741 - 64,704,441 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	69,989,064 - 69,996,216 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	73,395,406 - 73,402,558 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	68,633,137 - 68,639,837 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	68,860,018 - 68,866,718 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	68,860,018 - 68,866,718 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	68,486,608 - 68,493,308 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	69,012,201 - 69,018,901 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	69,012,406 - 69,019,107 (+)	NCBI
Celera	16	62,621,116 - 62,627,795 (+)	NCBI		Celera
Cytogenetic Map	16	q12.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrna6	Rat	alcohol use disorder	severity	ISO	RGD:733511	405849410	DNA:haplotypes: :	RGD
Chrna6	Rat	cocaine abuse	susceptibility	ISO	RGD:733511	405849277	DNA:SNP::rs892413(human)	RGD
Chrna6	Rat	nicotine dependence		ISO	RGD:733511	405849394	DNA:SNP: :rs2304297(human)	RGD
Chrna6	Rat	nicotine dependence	susceptibility	ISO	RGD:733511	405849281	DNA:SNP,haplotypes: :	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrna6	Rat	Idiopathic Basal Ganglia Calcification 1		ISO	RGD:733511	8554872	ClinVar Annotator: match by term: Idiopathic basal ganglia calcification 1	ClinVar	PMID:27726124
Chrna6	Rat	IMMUNODEFICIENCY 15		ISO	RGD:733511	8554872	ClinVar Annotator: match by term: Immunodeficiency 15	ClinVar	PMID:28492532
Chrna6	Rat	immunodeficiency 15B		ISO	RGD:733511	8554872	ClinVar Annotator: match by term: IMMUNODEFICIENCY 15B	ClinVar	PMID:28492532
Chrna6	Rat	torsion dystonia 6		ISO	RGD:733511	8554872	ClinVar Annotator: match by term: Torsion dystonia 6	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrna6	Rat	nicotine dependence		ISO	RGD:733511	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:28851948
Chrna6	Rat	withdrawal disorder		ISO	RGD:733511	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:19644040

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrna6	Rat	(S)-nicotine	multiple interactions	ISO	RGD:736285	6480464	Nicotine inhibits the reaction [[CHRNA6 protein binds to CHRNB2 protein] which results in increased secretion more ...	CTD	PMID:17227438
Chrna6	Rat	(S)-nicotine	increases expression	ISO	RGD:733511	6480464	Nicotine results in increased expression of CHRNA6 mRNA	CTD	PMID:30959089
Chrna6	Rat	(S)-nicotine	increases expression	ISO	RGD:736285	6480464	Nicotine results in increased expression of CHRNA6 mRNA	CTD	PMID:29293602
Chrna6	Rat	(S)-nicotine	affects response to substance	ISO	RGD:736285	6480464	CHRNA6 gene polymorphism affects the susceptibility to Nicotine	CTD	PMID:10734154
Chrna6	Rat	(S)-nicotine	decreases expression	ISO	RGD:733511	6480464	Nicotine results in decreased expression of CHRNA6 mRNA	CTD	PMID:12628473
Chrna6	Rat	1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine	decreases expression	ISO	RGD:736285	6480464	1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine results in decreased expression of CHRNA6 protein	CTD	PMID:19594327
Chrna6	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:736285	6480464	Tetrachlorodibenzodioxin results in increased expression of CHRNA6 mRNA	CTD	PMID:15034205
Chrna6	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of CHRNA6 mRNA	CTD	PMID:16483693
Chrna6	Rat	arsenous acid	decreases expression	ISO	RGD:733511	6480464	Arsenic Trioxide results in decreased expression of CHRNA6 mRNA	CTD	PMID:27829220
Chrna6	Rat	arsenous acid	increases expression	ISO	RGD:733511	6480464	Arsenic Trioxide results in increased expression of CHRNA6 mRNA	CTD	PMID:20458559
Chrna6	Rat	benzo[a]pyrene	increases expression	ISO	RGD:736285	6480464	Benzo(a)pyrene results in increased expression of CHRNA6 mRNA	CTD	PMID:15034205
Chrna6	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:733511	6480464	Benzo(a)pyrene affects the methylation of CHRNA6 intron; Benzo(a)pyrene affects the methylation of CHRNA6 promoter	CTD	PMID:27901495\|PMID:30157460
Chrna6	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CHRNA6 mRNA	CTD	PMID:25181051
Chrna6	Rat	cadmium dichloride	increases expression	ISO	RGD:733511	6480464	Cadmium Chloride results in increased expression of CHRNA6 mRNA	CTD	PMID:38568856
Chrna6	Rat	chlorpyrifos	affects expression	EXP		6480464	Chlorpyrifos affects the expression of CHRNA6 mRNA	CTD	PMID:18977431
Chrna6	Rat	diarsenic trioxide	decreases expression	ISO	RGD:733511	6480464	Arsenic Trioxide results in decreased expression of CHRNA6 mRNA	CTD	PMID:27829220
Chrna6	Rat	diarsenic trioxide	increases expression	ISO	RGD:733511	6480464	Arsenic Trioxide results in increased expression of CHRNA6 mRNA	CTD	PMID:20458559
Chrna6	Rat	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of CHRNA6 mRNA	CTD	PMID:21266533
Chrna6	Rat	dopamine	multiple interactions	ISO	RGD:736285	6480464	[pozanicline binds to and results in increased activity of [CHRNA6 protein binds to CHRNB2 protein]] more ...	CTD	PMID:17227438\|PMID:19481067
Chrna6	Rat	epibatidine	affects binding	EXP		8549526	epibatidine and alpha-Conotoxin MII bind to Chrna6 protein	RGD
Chrna6	Rat	ethanol	decreases expression	ISO	RGD:736285	6480464	Ethanol results in decreased expression of CHRNA6 mRNA	CTD	PMID:29293602
Chrna6	Rat	ethyl methanesulfonate	increases expression	ISO	RGD:733511	6480464	Ethyl Methanesulfonate results in increased expression of CHRNA6 mRNA	CTD	PMID:23649840
Chrna6	Rat	formaldehyde	decreases expression	EXP		6480464	Formaldehyde results in decreased expression of CHRNA6 mRNA	CTD	PMID:12679049
Chrna6	Rat	formaldehyde	increases expression	ISO	RGD:733511	6480464	Formaldehyde results in increased expression of CHRNA6 mRNA	CTD	PMID:23649840
Chrna6	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of CHRNA6 gene	CTD	PMID:22079235
Chrna6	Rat	glyphosate	increases expression	ISO	RGD:736285	6480464	Glyphosate results in increased expression of CHRNA6 mRNA	CTD	PMID:35897073
Chrna6	Rat	methylmercury chloride	decreases expression	ISO	RGD:736285	6480464	methylmercuric chloride results in decreased expression of CHRNA6 mRNA	CTD	PMID:21385734
Chrna6	Rat	methylphenidate	decreases expression	ISO	RGD:736285	6480464	Methylphenidate results in decreased expression of CHRNA6 mRNA	CTD	PMID:22470460
Chrna6	Rat	Muraglitazar	decreases expression	EXP		6480464	muraglitazar results in decreased expression of CHRNA6 mRNA	CTD	PMID:21515302
Chrna6	Rat	N-ethyl-N-nitrosourea	increases mutagenesis	EXP		6480464	Ethylnitrosourea results in increased mutagenesis of CHRNA6 gene	CTD	PMID:16495775
Chrna6	Rat	nicotine	multiple interactions	EXP		8549526	nicotine inhibits the reaction [alpha-Conotoxin MII binds to Chrna6]; nicotine inhibits the reaction [epibatidine binds more ...	RGD
Chrna6	Rat	nicotine	increases expression	ISO	RGD:736285	6480464	Nicotine results in increased expression of CHRNA6 mRNA	CTD	PMID:29293602
Chrna6	Rat	nicotine	increases expression	ISO	RGD:733511	6480464	Nicotine results in increased expression of CHRNA6 mRNA	CTD	PMID:30959089
Chrna6	Rat	nicotine	decreases expression	ISO	RGD:733511	6480464	Nicotine results in decreased expression of CHRNA6 mRNA	CTD	PMID:12628473
Chrna6	Rat	nicotine	affects response to substance	ISO	RGD:736285	6480464	CHRNA6 gene polymorphism affects the susceptibility to Nicotine	CTD	PMID:10734154
Chrna6	Rat	nicotine	multiple interactions	ISO	RGD:736285	6480464	Nicotine inhibits the reaction [[CHRNA6 protein binds to CHRNB2 protein] which results in increased secretion more ...	CTD	PMID:17227438
Chrna6	Rat	nicotine	affects binding	EXP		8549526	nicotine binds to Chrna6 protein	RGD
Chrna6	Rat	ozone	multiple interactions	ISO	RGD:736285	6480464	[Air Pollutants results in increased abundance of Ozone] which results in decreased expression of CHRNA6 more ...	CTD	PMID:27106289
Chrna6	Rat	paracetamol	decreases expression	ISO	RGD:733511	6480464	Acetaminophen results in decreased expression of CHRNA6 mRNA	CTD	PMID:22230336
Chrna6	Rat	paraquat	multiple interactions	ISO	RGD:736285	6480464	Nicotine inhibits the reaction [Paraquat results in decreased expression of [CHRNA6 protein binds to CHRNB2 more ...	CTD	PMID:17227438
Chrna6	Rat	paraquat	affects expression	EXP		6480464	Paraquat affects the expression of CHRNA6 mRNA	CTD	PMID:18198484
Chrna6	Rat	parathion-methyl	increases expression	EXP		6480464	Methyl Parathion results in increased expression of CHRNA6 mRNA	CTD	PMID:18977431
Chrna6	Rat	silver atom	increases expression	ISO	RGD:736285	6480464	Silver results in increased expression of CHRNA6 mRNA	CTD	PMID:27131904
Chrna6	Rat	silver(0)	increases expression	ISO	RGD:736285	6480464	Silver results in increased expression of CHRNA6 mRNA	CTD	PMID:27131904
Chrna6	Rat	Tesaglitazar	decreases expression	EXP		6480464	tesaglitazar results in decreased expression of CHRNA6 mRNA	CTD	PMID:21515302
Chrna6	Rat	troglitazone	decreases expression	EXP		6480464	troglitazone results in decreased expression of CHRNA6 mRNA	CTD	PMID:21515302
Chrna6	Rat	valproic acid	decreases methylation	ISO	RGD:733511	6480464	Valproic Acid results in decreased methylation of CHRNA6 gene	CTD	PMID:29154799
Chrna6	Rat	varenicline	affects binding	EXP		8549526	Varenicline binds to Chrna6 protein	RGD
Chrna6	Rat	varenicline	multiple interactions	EXP		6480464	Varenicline binds to and results in increased activity of CHRNA6 protein	CTD	PMID:16766716
Chrna6	Rat	varenicline	multiple interactions	EXP		8549526	Varenicline inhibits the reaction [alpha-Conotoxin MII binds to Chrna6]; Varenicline inhibits the reaction [epibatidine binds more ...	RGD

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrna6	Rat	acetylcholine receptor signaling pathway	involved_in	IBA	MGI:87888\|PANTHER:PTN000436077\|RGD:2345	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrna6	Rat	behavioral response to nicotine	involved_in	IEA	UniProtKB:Q9R0W9\|ensembl:ENSMUSP00000033882	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrna6	Rat	behavioral response to nicotine	involved_in	ISS	UniProtKB:Q9R0W9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Chrna6	Rat	behavioral response to nicotine	involved_in	ISO	RGD:736285	1624291	PMID:24266758	RGD	PMID:24266758
Chrna6	Rat	excitatory postsynaptic potential	involved_in	IEA	GO:0022848	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Chrna6	Rat	membrane depolarization	acts_upstream_of_or_within	ISO	RGD:736285	1624291	MGI:2179133 PMID:12944511	RGD	PMID:12944511
Chrna6	Rat	membrane depolarization	involved_in	IBA	MGI:106213\|MGI:87888\|PANTHER:PTN000436077	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrna6	Rat	membrane depolarization	acts_upstream_of_or_within	IEA	UniProtKB:Q9R0W9\|ensembl:ENSMUSP00000033882	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrna6	Rat	monoatomic ion transmembrane transport	involved_in	IEA	UniProtKB-KW:KW-0407	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Chrna6	Rat	monoatomic ion transmembrane transport	involved_in	IBA	FB:FBgn0000036\|FB:FBgn0000039\|PANTHER:PTN000434994\|RGD:2348\|UniProtKB:P36544\|UniProtKB:Q401N2\|WB:WBGene00000042\|WB:WBGene00000043\|WB:WBGene00000051\|WB:WBGene00000055\|WB:WBGene00002974\|WB:WBGene00006774\|WB:WBGene00006797	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrna6	Rat	monoatomic ion transmembrane transport	involved_in	IEA	InterPro:IPR006201	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrna6	Rat	monoatomic ion transport	involved_in	IEA	InterPro:IPR002394\|InterPro:IPR006029\|InterPro:IPR006202\|InterPro:IPR036719\|InterPro:IPR036734	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrna6	Rat	monoatomic ion transport	involved_in	IEA	UniProtKB-KW:KW-0406	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Chrna6	Rat	neuromuscular synaptic transmission	involved_in	IBA	MGI:87887\|PANTHER:PTN000436077\|UniProtKB:P02708\|UniProtKB:P32297\|ZFIN:ZDB-GENE-980526-137	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrna6	Rat	presynaptic modulation of chemical synaptic transmission	involved_in	IEA	UniProtKB:Q9R0W9\|ensembl:ENSMUSP00000033882	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrna6	Rat	presynaptic modulation of chemical synaptic transmission	involved_in	ISO	RGD:736285	1624291	PMID:12944511	RGD	PMID:12944511
Chrna6	Rat	regulation of dopamine secretion	acts_upstream_of_or_within	ISO	RGD:736285	1624291	MGI:2179133 PMID:12944511, PMID:22836257, PMID:24266758	RGD	PMID:12944511\|PMID:22836257\|PMID:24266758
Chrna6	Rat	regulation of dopamine secretion	acts_upstream_of_or_within	IEA	UniProtKB:Q9R0W9\|ensembl:ENSMUSP00000033882	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrna6	Rat	regulation of dopamine secretion	acts_upstream_of_or_within	ISS	UniProtKB:Q9R0W9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Chrna6	Rat	regulation of postsynaptic membrane potential	involved_in	IEA	GO:0022848	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Chrna6	Rat	response to nicotine	involved_in	IBA	MGI:87887\|MGI:87888\|MGI:87889\|PANTHER:PTN000436077\|RGD:2345\|RGD:2347\|RGD:621533\|UniProtKB:P30532\|UniProtKB:P32297\|UniProtKB:P43681\|ZFIN:ZDB-GENE-040108-2\|ZFIN:ZDB-GENE-090505-3	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrna6	Rat	synaptic transmission, cholinergic	involved_in	IBA	MGI:87887\|MGI:87888\|PANTHER:PTN000436077\|RGD:2346\|ZFIN:ZDB-GENE-980526-137	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrna6	Rat	acetylcholine-gated channel complex	part_of	IEA	UniProtKB:Q9R0W9\|ensembl:ENSMUSP00000033882	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrna6	Rat	acetylcholine-gated channel complex	part_of	ISO	RGD:733511	1624291	PMID:16835356	RGD	PMID:16835356
Chrna6	Rat	acetylcholine-gated channel complex	part_of	ISO	RGD:736285	1624291	PMID:12944511	RGD	PMID:12944511
Chrna6	Rat	acetylcholine-gated channel complex	part_of	IBA	FB:FBgn0000036\|FB:FBgn0000039\|FB:FBgn0015519\|FB:FBgn0266347\|MGI:106213\|MGI:87885\|MGI:87887\|MGI:87888\|MGI:87889\|MGI:87890\|MGI:87891\|MGI:87893\|MGI:87895\|PANTHER:PTN000435923\|RGD:2345\|RGD:2346\|RGD:2347\|RGD:2349\|RGD:2350\|RGD:2351\|RGD:2352\|RGD:2353\|RGD:2354\|RGD:621544\|RGD:69277\|UniProtKB:P11230\|UniProtKB:P17787\|UniProtKB:P30926\|UniProtKB:P32297\|UniProtKB:P43681\|UniProtKB:Q15822\|ZFIN:ZDB-GENE-030131-3805\|ZFIN:ZDB-GENE-040108-2\|ZFIN:ZDB-GENE-040808-32\|ZFIN:ZDB-GENE-060811-1\|ZFIN:ZDB-GENE-070821-4\|ZFIN:ZDB-GENE-090505-3\|ZFIN:ZDB-GENE-120809-1\|ZFIN:ZDB-GENE-980526-137	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrna6	Rat	acetylcholine-gated channel complex	part_of	IEA	UniProtKB:Q15825\|ensembl:ENSP00000276410	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrna6	Rat	cation channel complex	part_of	IEA	UniProtKB:Q15825\|ensembl:ENSP00000276410	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrna6	Rat	cation channel complex	part_of	ISO	RGD:733511	1624291	PMID:16835356	RGD	PMID:16835356
Chrna6	Rat	dopaminergic synapse	is_active_in	ISO	RGD:736285	1624291	PMID:12944511, PMID:22836257	RGD	PMID:12944511\|PMID:22836257
Chrna6	Rat	dopaminergic synapse	is_active_in	IEA	UniProtKB:Q9R0W9\|ensembl:ENSMUSP00000033882	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrna6	Rat	dopaminergic synapse	is_active_in	ISS	UniProtKB:Q9R0W9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Chrna6	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Chrna6	Rat	membrane	located_in	IEA	InterPro:IPR002394\|InterPro:IPR006029\|InterPro:IPR006201\|InterPro:IPR006202\|InterPro:IPR036719\|InterPro:IPR036734	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrna6	Rat	neuron projection	is_active_in	IBA	FB:FBgn0086778\|MGI:99779\|PANTHER:PTN000434994\|RGD:2345\|RGD:2346\|RGD:2347\|RGD:2348\|RGD:61818\|RGD:61820\|RGD:620142\|RGD:621533\|UniProtKB:P09484\|UniProtKB:P22770\|UniProtKB:Q03481\|WB:WBGene00000042\|WB:WBGene00002974\|WB:WBGene00006765\|WB:WBGene00006774	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrna6	Rat	neurotransmitter receptor complex	part_of	IEA	UniProtKB:Q15825\|ensembl:ENSP00000276410	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrna6	Rat	neurotransmitter receptor complex	part_of	ISO	RGD:733511	1624291	PMID:16835356	RGD	PMID:16835356
Chrna6	Rat	plasma membrane	is_active_in	IBA	FB:FBgn0000036\|FB:FBgn0000038\|FB:FBgn0000039\|FB:FBgn0015519\|FB:FBgn0028875\|FB:FBgn0032151\|FB:FBgn0086778\|FB:FBgn0266347\|MGI:106213\|MGI:1861899\|MGI:87885\|MGI:87888\|MGI:87889\|MGI:87890\|MGI:87891\|MGI:87892\|MGI:87894\|MGI:87895\|MGI:96282\|MGI:99779\|PANTHER:PTN000434994\|RGD:2346\|RGD:2347\|RGD:2349\|RGD:2350\|RGD:2351\|RGD:2354\|RGD:61818\|RGD:620142\|RGD:621534\|RGD:621544\|RGD:69281\|UniProtKB:A5X5Y0\|UniProtKB:O95264\|UniProtKB:P02708\|UniProtKB:P11230\|UniProtKB:P17787\|UniProtKB:P30926\|UniProtKB:P32297\|UniProtKB:P36544\|UniProtKB:P43681\|UniProtKB:P46098\|UniProtKB:Q07001\|UniProtKB:Q15822\|UniProtKB:Q401N2\|UniProtKB:Q70Z44\|UniProtKB:Q866A2\|UniProtKB:Q8WXA8\|UniProtKB:Q9UGM1\|WB:WBGene00000955\|WB:WBGene00002974\|WB:WBGene00006765\|WB:WBGene00006774\|WB:WBGene00006797\|ZFIN:ZDB-GENE-030131-3805\|ZFIN:ZDB-GENE-030131-6665\|ZFIN:ZDB-GENE-040108-3\|ZFIN:ZDB-GENE-040808-32\|ZFIN:ZDB-GENE-060811-1\|ZFIN:ZDB-GENE-070821-4\|ZFIN:ZDB-GENE-090505-3\|ZFIN:ZDB-GENE-120809-1\|ZFIN:ZDB-GENE-980526-137	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrna6	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Chrna6	Rat	postsynaptic membrane	located_in	IEA	UniProtKB-SubCell:SL-0219	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Chrna6	Rat	postsynaptic membrane	is_active_in	IEA	UniProtKB:Q9R0W9\|ensembl:ENSMUSP00000033882	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrna6	Rat	postsynaptic membrane	located_in	IEA	UniProtKB-KW:KW-0628	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Chrna6	Rat	postsynaptic membrane	is_active_in	ISO	RGD:736285	1624291	PMID:24607281	RGD	PMID:24607281
Chrna6	Rat	postsynaptic membrane	located_in	IEA	InterPro:IPR002394	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrna6	Rat	postsynaptic membrane	is_active_in	IEP		13702281	PMID:24607281	SynGO
Chrna6	Rat	postsynaptic membrane	is_active_in	IDA		13702281	PMID:24607281	SynGO
Chrna6	Rat	presynaptic membrane	is_active_in	IEA	UniProtKB:Q9R0W9\|ensembl:ENSMUSP00000033882	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrna6	Rat	presynaptic membrane	is_active_in	ISS	UniProtKB:Q9R0W9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Chrna6	Rat	presynaptic membrane	is_active_in	ISO	RGD:736285	1624291	PMID:22836257, PMID:24607281	RGD	PMID:22836257\|PMID:24607281
Chrna6	Rat	presynaptic membrane	is_active_in	IEP		13702281	PMID:24607281	SynGO
Chrna6	Rat	presynaptic membrane	is_active_in	IDA		13702281	PMID:24607281	SynGO
Chrna6	Rat	protein-containing complex		IDA		2303195		RGD
Chrna6	Rat	synapse	is_active_in	IBA	FB:FBgn0000038\|FB:FBgn0086778\|MGI:106212\|MGI:106213\|MGI:87885\|MGI:87887\|MGI:87888\|MGI:87889\|MGI:87890\|MGI:87891\|MGI:87892\|MGI:87893\|MGI:87894\|MGI:87895\|MGI:99779\|PANTHER:PTN000434994\|RGD:2345\|RGD:2346\|RGD:2348\|RGD:2350\|RGD:61818\|RGD:620142\|RGD:621534\|RGD:69281\|UniProtKB:P02708\|UniProtKB:P02715\|UniProtKB:P11230\|UniProtKB:P13536\|UniProtKB:P36544\|UniProtKB:Q04844\|UniProtKB:Q07001\|UniProtKB:Q866A2\|WB:WBGene00000051\|WB:WBGene00001133\|WB:WBGene00002974\|WB:WBGene00006765\|WB:WBGene00006774\|WB:WBGene00006797	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrna6	Rat	synapse	located_in	IEA	UniProtKB-KW:KW-0770	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Chrna6	Rat	synaptic membrane	located_in	IEA	UniProtKB-SubCell:SL-0531	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrna6	Rat	acetylcholine receptor activity	contributes_to	IBA	MGI:87885\|MGI:87888\|PANTHER:PTN000436077\|ZFIN:ZDB-GENE-040108-2\|ZFIN:ZDB-GENE-090505-3\|ZFIN:ZDB-GENE-980526-137	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrna6	Rat	acetylcholine-gated monoatomic cation-selective channel activity	enables	IEA	UniProtKB:Q9R0W9\|ensembl:ENSMUSP00000033882	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrna6	Rat	acetylcholine-gated monoatomic cation-selective channel activity	enables	IEA	InterPro:IPR002394	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrna6	Rat	acetylcholine-gated monoatomic cation-selective channel activity	enables	IBA	MGI:106213\|MGI:87887\|MGI:87888\|PANTHER:PTN000436077\|RGD:2345\|RGD:2346\|RGD:2347\|RGD:621533\|RGD:69277\|UniProtKB:P02708\|UniProtKB:P32297\|UniProtKB:P43681\|UniProtKB:Q15822	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrna6	Rat	acetylcholine-gated monoatomic cation-selective channel activity	enables	ISS	UniProtKB:Q9R0W9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Chrna6	Rat	acetylcholine-gated monoatomic cation-selective channel activity	enables	ISO	RGD:736285	1624291	MGI:2179133 PMID:11850448, PMID:22836257, PMID:24266758	RGD	PMID:11850448\|PMID:22836257\|PMID:24266758
Chrna6	Rat	extracellular ligand-gated monoatomic ion channel activity	enables	IEA	InterPro:IPR006202\|InterPro:IPR036734	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrna6	Rat	heterocyclic compound binding	contributes_to	IDA		8549526		RGD
Chrna6	Rat	monoatomic ion channel activity	enables	IEA	InterPro:IPR002394\|InterPro:IPR006201	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrna6	Rat	protein binding	enables	ISO	RGD:733511	1624291	UniProtKB:Q86Y78 PMID:27344019	RGD	PMID:27344019
Chrna6	Rat	protein binding	enables	ISO	RGD:736285	1624291	PR:O70174\|PR:Q9ERK7 PMID:12944511	RGD	PMID:12944511
Chrna6	Rat	transmembrane signaling receptor activity	enables	IEA	InterPro:IPR006201	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrna6	Rat	acetylcholine signaling pathway via nicotinic acetylcholine receptor		ISO	RGD:733511	8549510		RGD

#	Reference Title	Reference Citation
1.	Mammalian nicotinic acetylcholine receptors: from structure to function.	Albuquerque EX, etal., Physiol Rev. 2009 Jan;89(1):73-120. doi: 10.1152/physrev.00015.2008.
2.	Varenicline is a potent partial agonist at alpha6beta2* nicotinic acetylcholine receptors in rat and monkey striatum.	Bordia T, etal., J Pharmacol Exp Ther. 2012 Aug;342(2):327-34. doi: 10.1124/jpet.112.194852. Epub 2012 May 1.
3.	Genomic organization and promoter analysis of the human nicotinic acetylcholine receptor alpha6 subunit (CHNRA6) gene: Alu and other elements direct transcriptional repression.	Ebihara M, etal., Gene 2002 Sep 18;298(1):101-8.
4.	Subsynaptic localization of nicotinic acetylcholine receptor subunits: a comparative study in the mouse and rat striatum.	Garção P, etal., Neurosci Lett. 2014 Apr 30;566:106-10. doi: 10.1016/j.neulet.2014.02.018. Epub 2014 Mar 4.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Genetic association of the CHRNA6 and CHRNB3 genes with tobacco dependence in a nationally representative sample.	Hoft NR, etal., Neuropsychopharmacology. 2009 Feb;34(3):698-706. doi: 10.1038/npp.2008.122. Epub 2008 Aug 13.
8.	Association of nAChR gene haplotypes with heavy alcohol use and body mass.	Landgren S, etal., Brain Res. 2009 Dec 11;1305 Suppl:S72-9. doi: 10.1016/j.brainres.2009.08.026. Epub 2009 Aug 19.
9.	Nicotinic cholinergic receptors in the rat retina: simple and mixed heteromeric subtypes.	Marritt AM, etal., Mol Pharmacol. 2005 Dec;68(6):1656-68. Epub 2005 Aug 29.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Variants near CHRNB3-CHRNA6 are associated with DSM-5 cocaine use disorder: evidence for pleiotropy.	Sadler B, etal., Sci Rep. 2014 Mar 28;4:4497. doi: 10.1038/srep04497.
16.	Significant association of the CHRNB3-CHRNA6 gene cluster with nicotine dependence in the Chinese Han population.	Wen L, etal., Sci Rep. 2017 Aug 29;7(1):9745. doi: 10.1038/s41598-017-09492-8.

PMID:11850448	PMID:12944511	PMID:18266937	PMID:18299323	PMID:18583454	PMID:22024738	PMID:23624852	PMID:23846688	PMID:24398291	PMID:28666811

Chrna6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	71,400,615 - 71,407,315 (+)	NCBI		GRCr8
mRatBN7.2	16	64,697,741 - 64,704,441 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	64,697,741 - 64,704,441 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	69,989,064 - 69,996,216 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	73,395,406 - 73,402,558 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	68,633,137 - 68,639,837 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	68,860,018 - 68,866,718 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	68,860,018 - 68,866,718 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	68,486,608 - 68,493,308 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	69,012,201 - 69,018,901 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	69,012,406 - 69,019,107 (+)	NCBI
Celera	16	62,621,116 - 62,627,795 (+)	NCBI		Celera
Cytogenetic Map	16	q12.3	NCBI

CHRNA6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	42,752,620 - 42,768,786 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	42,752,620 - 42,796,392 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	42,607,763 - 42,623,929 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	42,726,920 - 42,742,776 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	42,726,936 - 42,742,776	NCBI
Celera	8	41,555,760 - 41,571,616 (-)	NCBI		Celera
Cytogenetic Map	8	p11.21	NCBI
HuRef	8	41,129,999 - 41,146,165 (-)	NCBI		HuRef
CHM1_1	8	42,654,698 - 42,670,848 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	43,020,720 - 43,036,889 (-)	NCBI		T2T-CHM13v2.0

Chrna6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	27,893,240 - 27,903,972 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	27,893,240 - 27,903,972 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	27,403,212 - 27,413,944 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	27,403,212 - 27,413,944 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	28,513,684 - 28,524,416 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	28,869,148 - 28,879,880 (-)	NCBI		MGSCv36	mm8
Celera	8	28,895,511 - 28,906,624 (-)	NCBI		Celera
Cytogenetic Map	8	A2	NCBI
cM Map	8	16.02	NCBI

Chrna6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955536	166,212 - 172,551 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955536	166,212 - 172,551 (+)	NCBI	ChiLan1.0	ChiLan1.0

CHRNA6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	61,210,352 - 61,225,975 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	36,926,422 - 36,942,028 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	42,000,748 - 42,016,913 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	39,444,447 - 39,460,569 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	39,444,447 - 39,460,569 (-)	Ensembl	panpan1.1		panPan2

CHRNA6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	22,990,377 - 23,009,257 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	22,990,167 - 23,009,106 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	23,495,595 - 23,514,480 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	24,742,037 - 24,760,849 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	24,742,086 - 24,760,838 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	23,110,331 - 23,129,174 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	23,675,367 - 23,694,204 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	23,726,376 - 23,745,181 (+)	NCBI		UU_Cfam_GSD_1.0

Chrna6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	45,430,209 - 46,072,980 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936785	18,147 - 27,409 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936785	17,588 - 28,565 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CHRNA6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	11,725,880 - 11,739,747 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	11,725,880 - 11,739,949 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	12,640,324 - 12,654,370 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CHRNA6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	40,750,839 - 40,767,010 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	40,751,375 - 40,766,236 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666052	1,004,827 - 1,022,056 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Chrna6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624780	462,195 - 477,568 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Chrna6
108 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	40
Count of miRNA genes:	39
Interacting mature miRNAs:	39
Transcripts:	ENSRNOT00000016452
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2300163	Bmd64	Bone mineral density QTL 64	5.3	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	16	37752156	82752156	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	19004435	75226532	Rat
1578768	Stresp22	Stress response QTL 22	2.8		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	16	35288870	80288870	Rat
2302057	Pia29	Pristane induced arthritis QTL 29	3.6	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	16	21735975	66735975	Rat
7205510	Activ5	Activity QTL 5	3.78	0.00028	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	42396345	84729064	Rat
631525	Pia14	Pristane induced arthritis QTL 14	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	16	55711087	83402471	Rat
8694453	Bw172	Body weight QTL 172	8.33	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	16	24325513	69325513	Rat
7411648	Foco22	Food consumption QTL 22	15	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	52726464	84729064	Rat
6903294	Stl30	Serum triglyceride level QTL 30	2.6	0.0013	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	16	25152793	70152793	Rat
2293690	Bss45	Bone structure and strength QTL 45	5.13	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	16	37752156	82752156	Rat
8694364	Abfw7	Abdominal fat weight QTL 7	12.22	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	16	52726464	84729064	Rat
8694429	Bw164	Body weight QTL 164	5	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	16	52726464	84729064	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat

This gene Chrna6 is modified in the following models/strains:

SD-Chrna6^em1Slot SD-Chrna6^em2Slot

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	ectoderm	endocrine system	endoderm	hemolymphoid system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	56	17	10	2	45	10	50	27	25	10


RefSeq Transcripts	NM_057184	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC126482	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L08227	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016452 ⟹ ENSRNOP00000016452

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	64,697,741 - 64,704,441 (+)	Ensembl
Rnor_6.0 Ensembl	16	68,860,018 - 68,866,718 (+)	Ensembl

RefSeq Acc Id:

NM_057184 ⟹ NP_476532

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	71,400,615 - 71,407,315 (+)	NCBI
mRatBN7.2	16	64,697,741 - 64,704,441 (+)	NCBI
Rnor_6.0	16	68,860,018 - 68,866,718 (+)	NCBI
Rnor_5.0	16	68,486,608 - 68,493,308 (+)	NCBI
RGSC_v3.4	16	69,012,201 - 69,018,901 (+)	RGD
Celera	16	62,621,116 - 62,627,795 (+)	RGD

Sequence:

show sequence

GCTGCTTCAGCCAGGACACAGGGAGCAACCGTGTGGTAGCCCGTGTTTTCACTTCACAGAAGATCCGTGTGGACTTCAGGAGCTTCCCGAGGCTTTCGTGGTCTGATTCTTGCAGCTGACTGACAGCT
TCGGTTTCCACAGCCCTCTGTGTCGGGATCAGAATTCGTGTGCTTTTATCATGCTGAACGGCTGGGGTCGGGGAGACCTTCGCTCCGGTTTGTGTCTGTGGATATGTGGATTCTTGGCTTTCTTTAAA
GGCAGTAGAGGCTGTGTGTCTGAAGAACAGCTCTTCCACACGCTCTTCGCCCACTACAACCGCTTCATCCGGCCAGTGGAAAACGTTTCTGATCCCGTCACGGTGCACTTTGAGTTGGCCATCACGCA
GCTGGCCAATGTGGATGAAGTCAACCAGATTATGGAGACCAATCTGTGGCTGCGTCACGTCTGGAAGGACTACAGATTGTGTTGGGATCCAACGGAGTACGATGGCATCGAGACGCTTCGTGTTCCAG
CAGATAACATCTGGAAGCCTGACATCGTTCTGTATAATAATGCCGTCGGTGACTTCCAGGTCGAAGGCAAGACCAAAGCTCTTCTTAAGTACGATGGGGTGATAACCTGGACCCCGCCAGCCATCTTT
AAGAGTTCCTGTCCAATGGACATCACCTTCTTCCCATTTGATCATCAAAACTGCTCCCTGAAATTTGGGTCCTGGACTTACGACAAGGCTGAAATCGACCTTCTCATCATTGGCTCTAAAGTGGACAT
GAACGACTTTTGGGAAAACAGTGAGTGGGAAATTGTCGATGCCTCTGGCTACAAGCATGACATCAAGTACAACTGCTGTGAAGAGATTTACACAGATATCACCTACTCCTTCTACATCAGGAGGCTGC
CCATGTTTTATACCATCAATCTCATCATCCCCTGCCTCTTCATTTCCTTTCTCACCGTGCTAGTCTTTTACCTTCCTTCTGACTGTGGCGAGAAAGTGACTCTTTGCATCTCGGTTCTGCTTTCTCTG
ACTGTCTTTTTGCTGGTGATTACAGAGACCATCCCATCCACATCTCTCGTGATCCCACTAGTGGGTGAGTATCTACTGTTCACCATGATCTTTGTCACGCTGTCCATTGTGGTGACCGTGTTTGTGTT
GAACATACACTACAGGACCCCAGCAACGCATACCATGCCCAAGTGGGTGAAGACCATGTTCCTTCAGGTCTTCCCCTCGATTCTGATGATGAGGAGACCTCTGGACAAGACAAAGGAAATGGATGGTG
TTAAGGACCCCAAAACCCACACCAAGAGGCCGGCCAAAGTCAAGTTTACTCATCGAAAAGAACCCAAACTTCTAAAGGAATGCCGCCACTGCCATAAGTCAAGTGAGATAGCACCTGGCAAGAGGTTA
AGCCAGCAGCCTGCACAGTGGGTAACAGAGAATTCAGAGCACCCACCTGATGTTGAAGACGTGATCGATAGTGTTCAATTCATAGCAGAAAACATGAAAAGCCACAATGAAACAAAGGAGGTAGAAGA
TGACTGGAAATACATGGCCATGGTGGTGGACAGAGTCTTCCTCTGGGTGTTTATAATCGTCTGTGTGTTTGGAACTGTGGGGCTCTTTCTACAGCCACTGCTTGGGAACACAGGAGCATCTTAATTGG
GATTTTCCTCTTGCCTTCTAAATCTTTTAAATGTTGTGTTTTTTCCTCCACTACTTACCACAAGAAAAAGTCAAGTTTGCAGTCTCCTAAACCAAG

hide sequence


Protein RefSeqs	NP_476532	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41674	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016452
GenBank Protein	P43143	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_476532 ⟸ NM_057184
- Peptide Label:	precursor
- UniProtKB:	P43143 (UniProtKB/Swiss-Prot), G3V7L7 (UniProtKB/TrEMBL), A6IVW8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLNGWGRGDLRSGLCLWICGFLAFFKGSRGCVSEEQLFHTLFAHYNRFIRPVENVSDPVTVHFELAITQLANVDEVNQIMETNLWLRHVWKDYRLCWDPTEYDGIETLRVPADNIWKPDIVLYNNAVG DFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISF LTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTMPKWVKTMFLQVFPSILMMRRPLDKTKEMDGVKDPKTHTKRPAKVKFT HRKEPKLLKECRHCHKSSEIAPGKRLSQQPAQWVTENSEHPPDVEDVIDSVQFIAENMKSHNETKEVEDDWKYMAMVVDRVFLWVFIIVCVFGTVGLFLQPLLGNTGAS hide sequence

Ensembl Acc Id:

ENSRNOP00000016452 ⟸ ENSRNOT00000016452

Protein Domains

Neurotransmitter-gated ion-channel ligand-binding Neurotransmitter-gated ion-channel transmembrane

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P43143-F1-model_v2	AlphaFold	P43143	1-493	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-11041	BioCyc
Ensembl Genes	ENSRNOG00000012283	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000016452	ENTREZGENE
Gene3D-CATH	1.20.58.390	UniProtKB/Swiss-Prot
	2.70.170.10	UniProtKB/Swiss-Prot
InterPro	Neur_chan_lig-bd	UniProtKB/Swiss-Prot
	Neur_chan_lig-bd_sf	UniProtKB/Swiss-Prot
	Neur_channel	UniProtKB/Swiss-Prot
	Neuro-gated_channel_TM_sf	UniProtKB/Swiss-Prot
	Neuro_actylchol_rec	UniProtKB/Swiss-Prot
	Neurotrans-gated_channel_TM	UniProtKB/Swiss-Prot
	Neurotransmitter_ion_chnl_CS	UniProtKB/Swiss-Prot
	Nicotinic_acetylcholine_rcpt	UniProtKB/Swiss-Prot
KEGG Report	rno:81721	UniProtKB/Swiss-Prot
NCBI Gene	81721	ENTREZGENE
PANTHER	PTHR18945	UniProtKB/Swiss-Prot
Pfam	Neur_chan_LBD	UniProtKB/Swiss-Prot
	Neur_chan_memb	UniProtKB/Swiss-Prot
PhenoGen	Chrna6	PhenoGen
PRINTS	NICOTINICR	UniProtKB/Swiss-Prot
	NRIONCHANNEL	UniProtKB/Swiss-Prot
PROSITE	NEUROTR_ION_CHANNEL	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000012283	RatGTEx
Superfamily-SCOP	SSF63712	UniProtKB/Swiss-Prot
	SSF90112	UniProtKB/Swiss-Prot
UniProt	A6IVW8	ENTREZGENE, UniProtKB/TrEMBL
	ACHA6_RAT	UniProtKB/Swiss-Prot
	G3V7L7	ENTREZGENE, UniProtKB/TrEMBL
	P43143	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	Chrna6	cholinergic receptor nicotinic alpha 6 subunit	Chrna6	cholinergic receptor, nicotinic, alpha 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-11-12	Chrna6	cholinergic receptor, nicotinic, alpha 6	Chrna6	cholinergic receptor, nicotinic, alpha 6 (neuronal)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-16	Chrna6	cholinergic receptor, nicotinic, alpha 6 (neuronal)	Chrna6	cholinergic receptor, nicotinic, alpha 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-29	Chrna6	cholinergic receptor, nicotinic, alpha 6	Chrna6	cholinergic receptor, nicotinic, alpha polypeptide 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Chrna6	cholinergic receptor, nicotinic, alpha polypeptide 6			Name updated	70584	APPROVED

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations