Advanced Search (OLGA)

Gene: Ahcy (adenosylhomocysteinase) Rattus norvegicus

Analyze

Symbol:

Ahcy

Name:

adenosylhomocysteinase

RGD ID:

69260

Description:

Enables NAD binding activity; adenosylhomocysteinase activity; and identical protein binding activity. Involved in several processes, including S-adenosylhomocysteine catabolic process; chronic inflammatory response to antigenic stimulus; and circadian sleep/wake cycle. Predicted to be located in endoplasmic reticulum; melanosome; and nucleus. Predicted to be active in cytosol. Used to study hyperhomocysteinemia and pyridoxine deficiency anemia. Human ortholog(s) of this gene implicated in abdominal aortic aneurysm and hypermethioninemia with deficiency of S-adenosylhomocysteine hydrolase. Orthologous to human AHCY (adenosylhomocysteinase); PARTICIPATES IN methionine cycle/metabolic pathway; choline metabolic pathway; glycine N-methyltransferase deficiency pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dibromophenyl 2,4,5-tribromophenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

adoHcyase; S-adenosyl-L-homocysteine hydrolase; S-adenosylhomocysteine hydrolase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AHCY (adenosylhomocysteinase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ahcy (S-adenosylhomocysteine hydrolase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ahcy (adenosylhomocysteinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AHCY (adenosylhomocysteinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AHCY (adenosylhomocysteinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ahcy (adenosylhomocysteinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AHCY (adenosylhomocysteinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	AHCY (adenosylhomocysteinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ahcy (adenosylhomocysteinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MAP3K2 (mitogen-activated protein kinase kinase kinase 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	AHCY (adenosylhomocysteinase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Ahcy (S-adenosylhomocysteine hydrolase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ahcyl (adenosylhomocysteinase like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ahcy (adenosylhomocysteinase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ahcy	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SAH1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ahcy-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ahcy	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Related Pseudogenes:

Ahcy-ps4

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	164,029,338 - 164,044,562 (-)	NCBI		GRCr8
mRatBN7.2	3	143,569,134 - 143,584,359 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	143,569,094 - 143,584,393 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	147,436,772 - 147,451,996 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	156,054,058 - 156,069,282 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	153,793,593 - 153,808,817 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	150,587,833 - 150,603,057 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	150,587,833 - 150,603,082 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	156,957,240 - 156,972,464 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	145,544,834 - 145,560,058 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	145,450,455 - 145,465,680 (-)	NCBI
Celera	3	142,299,485 - 142,314,709 (-)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ahcy	Rat	abdominal aortic aneurysm	susceptibility	ISO	RGD:731745	329853746	DNA:SNPs,haplotypes:intron: (rs819146, rs7271501) (human)	RGD
Ahcy	Rat	Experimental Arthritis		IDA		1598898		RGD
Ahcy	Rat	hyperhomocysteinemia		IDA		1598896		RGD
Ahcy	Rat	hypertension		ISO	RGD:736014	1601153	associated with hyperhomocysteinemia	RGD
Ahcy	Rat	pyridoxine deficiency anemia		IDA		1598897		RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ahcy	Rat	genetic disease		ISO	RGD:731745	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:15024124\|PMID:16435181\|PMID:16736098\|PMID:16872278\|PMID:18211827\|PMID:19177456\|PMID:20385918\|PMID:20852937\|PMID:22959829\|PMID:25473036\|PMID:25660390\|PMID:25741868\|PMID:28492532\|PMID:28647132\|PMID:28779239\|PMID:29205322\|PMID:33072517
Ahcy	Rat	glutathione synthetase deficiency		ISO	RGD:731745	8554872	ClinVar Annotator: match by term: PYROGLUTAMIC ACIDURIA	ClinVar	PMID:12638941\|PMID:15717202\|PMID:28492532
Ahcy	Rat	glutatione synthetase deficiency with 5-oxoprolinuria		ISO	RGD:731745	8554872	ClinVar Annotator: match by term: 5-OXOPROLINURIA DUE TO GLUTATHIONE SYNTHETASE DEFICIENCY	ClinVar	PMID:12638941\|PMID:15717202\|PMID:28492532
Ahcy	Rat	hypermethioninemia		ISO	RGD:731745	8554872	ClinVar Annotator: match by term: Hypermethioninemia	ClinVar	PMID:25741868
Ahcy	Rat	hypermethioninemia with deficiency of S-adenosylhomocysteine hydrolase		ISO	RGD:731745	8554872	ClinVar Annotator: match by term: Hypermethioninemia with deficiency of S-adenosylhomocysteine hydrolase	ClinVar	PMID:15024124\|PMID:16435181\|PMID:16736098\|PMID:16872278\|PMID:17576681\|PMID:18211827\|PMID:19177456\|PMID:19619139\|PMID:20385918\|PMID:20852937\|PMID:22959829\|PMID:25473036\|PMID:25660390\|PMID:25741868\|PMID:28492532\|PMID:28647132\|PMID:28779239\|PMID:29205322\|PMID:31957987\|PMID:33072517\|PMID:9536098
Ahcy	Rat	long QT syndrome		ISO	RGD:731745	8554872	ClinVar Annotator: match by term: Long QT syndrome	ClinVar	PMID:28492532
Ahcy	Rat	Multisystem Autoimmune Disease with Facial Dysmorphism		ISO	RGD:731745	8554872	ClinVar Annotator: match by term: AUTOIMMUNE DISEASE, MULTISYSTEM, WITH FACIAL DYSMORPHISM	ClinVar	PMID:28492532
Ahcy	Rat	Obesity and Hypopigmentation		ISO	RGD:731745	8554872	ClinVar Annotator: match by term: Obesity and hypopigmentation	ClinVar	PMID:36536132
Ahcy	Rat	Rhabdomyolysis		ISO	RGD:731745	8554872	ClinVar Annotator: match by term: Rhabdomyolysis	ClinVar	PMID:15024124\|PMID:16435181\|PMID:16736098\|PMID:16872278\|PMID:18211827\|PMID:25473036\|PMID:25741868\|PMID:28492532\|PMID:28647132\|PMID:28779239\|PMID:33072517
Ahcy	Rat	Sunburn		ISO	RGD:731745	8554872	ClinVar Annotator: match by term: ASIP-related condition \| ClinVar Annotator: match by term: SKIN/HAIR/EYE PIGMENTATION more ...	ClinVar	PMID:11833005\|PMID:18488028\|PMID:25741868\|PMID:28492532

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ahcy	Rat	amino acid metabolic disorder		ISO	RGD:731745	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:15024124
Ahcy	Rat	Animal Disease Models		ISO	RGD:731745	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:27602772
Ahcy	Rat	hypermethioninemia		ISO	RGD:731745	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:26974671
Ahcy	Rat	Hypoxia		ISO	RGD:731745	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:19579223
Ahcy	Rat	lung adenocarcinoma		ISO	RGD:731745	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:27602772
Ahcy	Rat	metabolic dysfunction-associated steatotic liver disease		ISO	RGD:731745	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:29127188
Ahcy	Rat	Wilson disease		ISO	RGD:731745	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:23519153

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ahcy	Rat	hypermethioninemia with deficiency of S-adenosylhomocysteine hydrolase		ISO	RGD:731745	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ahcy	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	RGD:731745	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of AHCY mRNA	CTD	PMID:22079256
Ahcy	Rat	(-)-epigallocatechin 3-gallate	decreases expression	ISO	RGD:731745	6480464	epigallocatechin gallate results in decreased expression of AHCY protein	CTD	PMID:31195006
Ahcy	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:736014	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of AHCY mRNA	CTD	PMID:36331819
Ahcy	Rat	1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene	multiple interactions	ISO	RGD:736014	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Ahcy	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:736014	6480464	1,2-Dimethylhydrazine results in decreased expression of AHCY mRNA	CTD	PMID:22206623
Ahcy	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:736014	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of AHCY mRNA	CTD	PMID:22206623
Ahcy	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of AHCY mRNA	CTD	PMID:32145629
Ahcy	Rat	17beta-estradiol	decreases expression	ISO	RGD:736014	6480464	Estradiol results in decreased expression of AHCY mRNA	CTD	PMID:39298647
Ahcy	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	RGD:736014	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Ahcy	Rat	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	ISO	RGD:736014	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Ahcy	Rat	2,3,7,8-tetrabromodibenzodioxine	increases expression	ISO	RGD:736014	6480464	2,3,7,8-tetrabromodibenzo-4-dioxin results in increased expression of AHCY protein	CTD	PMID:27604104
Ahcy	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of AHCY mRNA	CTD	PMID:18465118\|PMID:33387578
Ahcy	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of AHCY mRNA	CTD	PMID:34747641
Ahcy	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:736014	6480464	Tetrachlorodibenzodioxin affects the expression of AHCY mRNA	CTD	PMID:21570461\|PMID:26377647
Ahcy	Rat	2,4,4'-trichlorobiphenyl	multiple interactions	ISO	RGD:736014	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Ahcy	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	decreases expression	EXP		6480464	2,2',4,4',5-brominated diphenyl ether results in decreased expression of AHCY protein	CTD	PMID:19954255
Ahcy	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	RGD:736014	6480464	2,2',4,4',5-brominated diphenyl ether affects the expression of AHCY mRNA	CTD	PMID:38648751
Ahcy	Rat	2,6-dimethoxyphenol	multiple interactions	ISO	RGD:731745	6480464	[pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization more ...	CTD	PMID:38598786
Ahcy	Rat	2-hydroxypropanoic acid	decreases expression	ISO	RGD:731745	6480464	Lactic Acid results in decreased expression of AHCY mRNA	CTD	PMID:30851411
Ahcy	Rat	2-palmitoylglycerol	increases expression	ISO	RGD:731745	6480464	2-palmitoylglycerol results in increased expression of AHCY mRNA	CTD	PMID:37199045
Ahcy	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	RGD:736014	6480464	N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of AHCY mRNA	CTD	PMID:20188158
Ahcy	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	RGD:736014	6480464	4,4'-diaminodiphenylmethane results in decreased expression of AHCY mRNA	CTD	PMID:18648102
Ahcy	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:736014	6480464	bisphenol S results in decreased expression of AHCY mRNA	CTD	PMID:30951980
Ahcy	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:731745	6480464	bisphenol S results in increased expression of AHCY protein	CTD	PMID:34186270
Ahcy	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:736014	6480464	bisphenol S results in increased expression of AHCY mRNA	CTD	PMID:39298647
Ahcy	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:736014	6480464	Fenretinide results in increased expression of AHCY mRNA	CTD	PMID:28973697
Ahcy	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of AHCY mRNA	CTD	PMID:31881176
Ahcy	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of AHCY mRNA	CTD	PMID:28959563
Ahcy	Rat	actinomycin D	multiple interactions	ISO	RGD:731745	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of AHCY protein	CTD	PMID:38460933
Ahcy	Rat	aflatoxin B1	increases methylation	ISO	RGD:731745	6480464	Aflatoxin B1 results in increased methylation of AHCY gene	CTD	PMID:27153756
Ahcy	Rat	aflatoxin B1	increases mutagenesis	EXP		6480464	Aflatoxin B1 results in increased mutagenesis of AHCY gene	CTD	PMID:36908029
Ahcy	Rat	all-trans-retinoic acid	decreases expression	ISO	RGD:731745	6480464	Tretinoin results in decreased expression of AHCY mRNA	CTD	PMID:33167477
Ahcy	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of AHCY mRNA	CTD	PMID:16483693
Ahcy	Rat	aristolochic acid A	increases expression	ISO	RGD:731745	6480464	aristolochic acid I results in increased expression of AHCY protein	CTD	PMID:33212167
Ahcy	Rat	arsane	multiple interactions	ISO	RGD:731745	6480464	[Arsenic results in increased expression of and results in increased activity of AHCY protein] which more ...	CTD	PMID:18487201
Ahcy	Rat	arsane	increases expression	ISO	RGD:731745	6480464	Arsenic results in increased expression of AHCY mRNA	CTD	PMID:18487201
Ahcy	Rat	arsenic atom	increases expression	ISO	RGD:731745	6480464	Arsenic results in increased expression of AHCY mRNA	CTD	PMID:18487201
Ahcy	Rat	arsenic atom	multiple interactions	ISO	RGD:731745	6480464	[Arsenic results in increased expression of and results in increased activity of AHCY protein] which more ...	CTD	PMID:18487201
Ahcy	Rat	arsenite(3-)	multiple interactions	ISO	RGD:731745	6480464	arsenite promotes the reaction [G3BP1 protein binds to AHCY mRNA]; arsenite promotes the reaction [G3BP1 more ...	CTD	PMID:32406909
Ahcy	Rat	arsenous acid	increases expression	ISO	RGD:731745	6480464	Arsenic Trioxide results in increased expression of AHCY mRNA	CTD	PMID:22521957
Ahcy	Rat	azoxystrobin	increases expression	ISO	RGD:731745	6480464	azoxystrobin results in increased expression of AHCY mRNA	CTD	PMID:33512557
Ahcy	Rat	benzene	increases expression	ISO	RGD:736014	6480464	Benzene results in increased expression of AHCY mRNA	CTD	PMID:15120971\|PMID:15122651
Ahcy	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:731745	6480464	Benzo(a)pyrene results in increased methylation of AHCY promoter	CTD	PMID:27901495
Ahcy	Rat	benzo[b]fluoranthene	decreases expression	ISO	RGD:736014	6480464	benzo(b)fluoranthene results in decreased expression of AHCY mRNA	CTD	PMID:26377693
Ahcy	Rat	benzoates	decreases expression	ISO	RGD:731745	6480464	Benzoates analog results in decreased expression of AHCY mRNA	CTD	PMID:29472718
Ahcy	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:736014	6480464	Diethylhexyl Phthalate results in increased expression of AHCY mRNA	CTD	PMID:34319233
Ahcy	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of AHCY mRNA	CTD	PMID:25181051\|PMID:30903817
Ahcy	Rat	bisphenol A	decreases expression	ISO	RGD:731745	6480464	bisphenol A results in decreased expression of AHCY protein	CTD	PMID:34186270
Ahcy	Rat	bisphenol A	decreases expression	ISO	RGD:736014	6480464	bisphenol A results in decreased expression of AHCY mRNA; bisphenol A results in decreased expression more ...	CTD	PMID:30951980\|PMID:35999755
Ahcy	Rat	bisphenol A	affects expression	ISO	RGD:731745	6480464	bisphenol A affects the expression of AHCY mRNA	CTD	PMID:30903817
Ahcy	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of AHCY mRNA; bisphenol A results in decreased expression more ...	CTD	PMID:22649256\|PMID:32145629
Ahcy	Rat	bisphenol AF	increases expression	ISO	RGD:731745	6480464	bisphenol AF results in increased expression of AHCY protein	CTD	PMID:34186270
Ahcy	Rat	bisphenol F	decreases expression	ISO	RGD:736014	6480464	bisphenol F results in decreased expression of AHCY mRNA	CTD	PMID:30951980
Ahcy	Rat	buspirone	increases expression	EXP		6480464	Buspirone results in increased expression of AHCY mRNA	CTD	PMID:24136188
Ahcy	Rat	buta-1,3-diene	decreases expression	ISO	RGD:736014	6480464	1,3-butadiene results in decreased expression of AHCY mRNA	CTD	PMID:29038090
Ahcy	Rat	cadmium atom	multiple interactions	ISO	RGD:731745	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of AHCY more ...	CTD	PMID:33040242
Ahcy	Rat	cadmium dichloride	multiple interactions	ISO	RGD:731745	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of AHCY more ...	CTD	PMID:33040242
Ahcy	Rat	cadmium dichloride	increases expression	ISO	RGD:731745	6480464	Cadmium Chloride results in increased expression of AHCY protein	CTD	PMID:24527689
Ahcy	Rat	caffeine	decreases expression	ISO	RGD:731745	6480464	Caffeine results in decreased expression of AHCY protein	CTD	PMID:31195006
Ahcy	Rat	carbon nanotube	increases expression	ISO	RGD:736014	6480464	Nanotubes, Carbon analog results in increased expression of AHCY mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25554681\|PMID:25620056
Ahcy	Rat	ceruletide	decreases expression	EXP		6480464	Ceruletide results in decreased expression of AHCY protein	CTD	PMID:18024178
Ahcy	Rat	chloropicrin	decreases expression	ISO	RGD:731745	6480464	chloropicrin results in decreased expression of AHCY mRNA	CTD	PMID:26352163\|PMID:28476498
Ahcy	Rat	chlorpyrifos	decreases expression	ISO	RGD:736014	6480464	Chlorpyrifos results in decreased expression of AHCY mRNA	CTD	PMID:37019170
Ahcy	Rat	choline	multiple interactions	ISO	RGD:736014	6480464	[Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in decreased expression more ...	CTD	PMID:20938992\|PMID:23439872\|PMID:29127188
Ahcy	Rat	choline	multiple interactions	EXP		6480464	[Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression more ...	CTD	PMID:19566968
Ahcy	Rat	cisplatin	increases expression	ISO	RGD:731745	6480464	Cisplatin results in increased expression of AHCY mRNA; Cisplatin results in increased expression of AHCY more ...	CTD	PMID:21424131\|PMID:27392435
Ahcy	Rat	cisplatin	multiple interactions	ISO	RGD:731745	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of AHCY mRNA	CTD	PMID:27392435
Ahcy	Rat	clofibrate	decreases expression	ISO	RGD:736014	6480464	Clofibrate results in decreased expression of AHCY mRNA	CTD	PMID:17585979
Ahcy	Rat	copper atom	decreases expression	EXP		6480464	Copper results in decreased expression of AHCY mRNA	CTD	PMID:22465980
Ahcy	Rat	copper(0)	decreases expression	EXP		6480464	Copper results in decreased expression of AHCY mRNA	CTD	PMID:22465980
Ahcy	Rat	CU-O LINKAGE	decreases expression	ISO	RGD:731745	6480464	cupric oxide results in decreased expression of AHCY protein	CTD	PMID:25470785
Ahcy	Rat	D-penicillamine	multiple interactions	ISO	RGD:736014	6480464	Penicillamine promotes the reaction [ATP7B protein mutant form results in decreased expression of AHCY protein]	CTD	PMID:22945834
Ahcy	Rat	D-penicillamine	increases activity	ISO	RGD:736014	6480464	Penicillamine results in increased activity of AHCY protein	CTD	PMID:22945834
Ahcy	Rat	diarsenic trioxide	increases expression	ISO	RGD:731745	6480464	Arsenic Trioxide results in increased expression of AHCY mRNA	CTD	PMID:22521957
Ahcy	Rat	doxorubicin	decreases expression	ISO	RGD:731745	6480464	Doxorubicin results in decreased expression of AHCY mRNA	CTD	PMID:18510171
Ahcy	Rat	doxorubicin	increases expression	ISO	RGD:731745	6480464	Doxorubicin results in increased expression of AHCY mRNA	CTD	PMID:29803840
Ahcy	Rat	enzyme inhibitor	multiple interactions	ISO	RGD:731745	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ...	CTD	PMID:23301498
Ahcy	Rat	flavonoids	decreases expression	EXP		6480464	Flavonoids results in decreased expression of AHCY mRNA	CTD	PMID:18035473
Ahcy	Rat	folic acid	multiple interactions	ISO	RGD:736014	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of AHCY mRNA; [Choline deficiency co-treated more ...	CTD	PMID:20938992\|PMID:22206623\|PMID:23439872\|PMID:29127188
Ahcy	Rat	folic acid	multiple interactions	EXP		6480464	[Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression more ...	CTD	PMID:19566968
Ahcy	Rat	folic acid	decreases expression	ISO	RGD:736014	6480464	Folic Acid deficiency results in decreased expression of AHCY mRNA; Folic Acid deficiency results in more ...	CTD	PMID:25384423
Ahcy	Rat	folic acid	increases expression	ISO	RGD:736014	6480464	Folic Acid results in increased expression of AHCY mRNA; Folic Acid results in increased expression more ...	CTD	PMID:30920123
Ahcy	Rat	formaldehyde	decreases expression	ISO	RGD:731745	6480464	Formaldehyde results in decreased expression of AHCY mRNA	CTD	PMID:23649840
Ahcy	Rat	fumonisin B1	decreases expression	ISO	RGD:736014	6480464	fumonisin B1 results in decreased expression of AHCY mRNA	CTD	PMID:16221962
Ahcy	Rat	furfural	multiple interactions	ISO	RGD:731745	6480464	[pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization more ...	CTD	PMID:38598786
Ahcy	Rat	glafenine	decreases expression	EXP		6480464	Glafenine results in decreased expression of AHCY mRNA	CTD	PMID:24136188
Ahcy	Rat	glycine betaine	decreases expression	ISO	RGD:736014	6480464	Betaine results in decreased expression of AHCY mRNA	CTD	PMID:22945834
Ahcy	Rat	glycine betaine	decreases expression	EXP		6480464	Betaine results in decreased expression of AHCY mRNA	CTD	PMID:26391144
Ahcy	Rat	homocysteine	multiple interactions	ISO	RGD:731745	6480464	[Arsenic results in increased expression of and results in increased activity of AHCY protein] which more ...	CTD	PMID:18487201
Ahcy	Rat	isoprenaline	increases expression	ISO	RGD:736014	6480464	Isoproterenol results in increased expression of AHCY mRNA	CTD	PMID:20003209
Ahcy	Rat	ivermectin	decreases expression	ISO	RGD:731745	6480464	Ivermectin results in decreased expression of AHCY protein	CTD	PMID:32959892
Ahcy	Rat	L-methionine	multiple interactions	ISO	RGD:736014	6480464	[Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in decreased expression more ...	CTD	PMID:20938992\|PMID:29127188
Ahcy	Rat	L-methionine	multiple interactions	EXP		6480464	[Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression more ...	CTD	PMID:19566968
Ahcy	Rat	leflunomide	increases expression	EXP		6480464	leflunomide results in increased expression of AHCY mRNA	CTD	PMID:24136188
Ahcy	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:731745	6480464	[NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of AHCY mRNA	CTD	PMID:35877022
Ahcy	Rat	lovastatin	decreases expression	ISO	RGD:736014	6480464	Lovastatin results in decreased expression of AHCY mRNA	CTD	PMID:20493250
Ahcy	Rat	methapyrilene	increases expression	EXP		6480464	Methapyrilene results in increased expression of AHCY protein	CTD	PMID:30467583
Ahcy	Rat	methidathion	increases expression	ISO	RGD:736014	6480464	methidathion results in increased expression of AHCY mRNA	CTD	PMID:34813904
Ahcy	Rat	methotrexate	affects expression	ISO	RGD:736014	6480464	Methotrexate affects the expression of AHCY mRNA	CTD	PMID:18502557
Ahcy	Rat	methylmercury chloride	decreases expression	ISO	RGD:731745	6480464	methylmercuric chloride results in decreased expression of AHCY mRNA	CTD	PMID:23179753\|PMID:27188386
Ahcy	Rat	mono(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:736014	6480464	mono-(2-ethylhexyl)phthalate results in decreased expression of AHCY mRNA	CTD	PMID:22401849
Ahcy	Rat	N-nitrosodiethylamine	decreases expression	EXP		6480464	Diethylnitrosamine results in decreased expression of AHCY mRNA	CTD	PMID:20360939
Ahcy	Rat	N-nitrosodiethylamine	multiple interactions	ISO	RGD:736014	6480464	[Diethylnitrosamine co-treated with Carbon Tetrachloride] results in decreased expression of AHCY mRNA	CTD	PMID:29127188
Ahcy	Rat	N-nitrosomorpholine	decreases expression	EXP		6480464	N-nitrosomorpholine results in decreased expression of AHCY protein	CTD	PMID:19716841
Ahcy	Rat	nitrofen	increases expression	EXP		6480464	nitrofen results in increased expression of AHCY mRNA	CTD	PMID:33484710
Ahcy	Rat	Nonylphenol	decreases expression	EXP		6480464	nonylphenol results in decreased expression of AHCY protein	CTD	PMID:19260726
Ahcy	Rat	Nutlin-3	multiple interactions	ISO	RGD:731745	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of AHCY protein	CTD	PMID:38460933
Ahcy	Rat	ozone	multiple interactions	ISO	RGD:736014	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ...	CTD	PMID:34911549
Ahcy	Rat	paracetamol	affects expression	EXP		6480464	Acetaminophen affects the expression of AHCY mRNA; Acetaminophen affects the expression of AHCY protein	CTD	PMID:16687475\|PMID:19103213
Ahcy	Rat	paracetamol	increases expression	ISO	RGD:731745	6480464	Acetaminophen results in increased expression of AHCY mRNA	CTD	PMID:22230336
Ahcy	Rat	parathion	increases expression	ISO	RGD:736014	6480464	Parathion results in increased expression of AHCY mRNA	CTD	PMID:34813904
Ahcy	Rat	PCB138	multiple interactions	ISO	RGD:736014	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Ahcy	Rat	PCB138	increases expression	EXP		6480464	2,2',3',4,4',5-hexachlorobiphenyl results in increased expression of AHCY protein	CTD	PMID:21673325
Ahcy	Rat	perfluorododecanoic acid	decreases expression	EXP		6480464	perfluorododecanoic acid results in decreased expression of AHCY protein	CTD	PMID:26168851
Ahcy	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:736014	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of AHCY mRNA	CTD	PMID:36331819
Ahcy	Rat	perfluorooctanoic acid	increases expression	ISO	RGD:736014	6480464	perfluorooctanoic acid results in increased expression of AHCY protein	CTD	PMID:37422089
Ahcy	Rat	phenobarbital	decreases expression	EXP		6480464	Phenobarbital results in decreased expression of AHCY mRNA	CTD	PMID:19162173
Ahcy	Rat	picoxystrobin	increases expression	ISO	RGD:731745	6480464	picoxystrobin results in increased expression of AHCY mRNA	CTD	PMID:33512557
Ahcy	Rat	pirinixic acid	increases expression	ISO	RGD:736014	6480464	pirinixic acid results in increased expression of AHCY protein	CTD	PMID:15226431
Ahcy	Rat	pirinixic acid	decreases expression	ISO	RGD:736014	6480464	pirinixic acid results in decreased expression of AHCY mRNA	CTD	PMID:16221962\|PMID:23811191
Ahcy	Rat	pirinixic acid	multiple interactions	ISO	RGD:736014	6480464	PPARA protein affects the reaction [pirinixic acid results in decreased expression of AHCY mRNA]	CTD	PMID:16221962
Ahcy	Rat	potassium chromate	increases expression	ISO	RGD:731745	6480464	potassium chromate(VI) results in increased expression of AHCY mRNA	CTD	PMID:22079256
Ahcy	Rat	potassium chromate	multiple interactions	ISO	RGD:731745	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of AHCY mRNA	CTD	PMID:22079256
Ahcy	Rat	pregnenolone 16alpha-carbonitrile	increases expression	ISO	RGD:736014	6480464	Pregnenolone Carbonitrile results in increased expression of AHCY mRNA	CTD	PMID:28903501
Ahcy	Rat	propiconazole	increases metabolic processing	ISO	RGD:736014	6480464	propiconazole results in increased metabolism of AHCY protein	CTD	PMID:19714882
Ahcy	Rat	Propiverine	affects binding	EXP		6480464	propiverine binds to AHCY protein	CTD	PMID:29273565
Ahcy	Rat	pyrimidifen	increases expression	ISO	RGD:731745	6480464	pyrimidifen results in increased expression of AHCY mRNA	CTD	PMID:33512557
Ahcy	Rat	rac-lactic acid	decreases expression	ISO	RGD:731745	6480464	Lactic Acid results in decreased expression of AHCY mRNA	CTD	PMID:30851411
Ahcy	Rat	resveratrol	affects expression	ISO	RGD:731745	6480464	resveratrol affects the expression of AHCY protein	CTD	PMID:22234583
Ahcy	Rat	rotenone	increases expression	ISO	RGD:731745	6480464	Rotenone results in increased expression of AHCY mRNA	CTD	PMID:33512557
Ahcy	Rat	S-adenosyl-L-homocysteine	increases hydrolysis	ISO	RGD:731745	6480464	AHCY results in increased hydrolysis of S-Adenosylhomocysteine	CTD	PMID:26974671
Ahcy	Rat	sarin	decreases expression	ISO	RGD:731745	6480464	Sarin results in decreased expression of AHCY mRNA	CTD	PMID:19522546
Ahcy	Rat	SB 431542	multiple interactions	ISO	RGD:731745	6480464	[LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of AHCY more ...	CTD	PMID:37664457
Ahcy	Rat	sodium arsenite	affects methylation	ISO	RGD:731745	6480464	sodium arsenite affects the methylation of AHCY gene	CTD	PMID:28589171
Ahcy	Rat	sodium arsenite	decreases expression	ISO	RGD:731745	6480464	sodium arsenite results in decreased expression of AHCY mRNA	CTD	PMID:38568856
Ahcy	Rat	sodium arsenite	increases expression	ISO	RGD:731745	6480464	sodium arsenite results in increased expression of AHCY protein	CTD	PMID:29207610
Ahcy	Rat	sodium chloride	multiple interactions	ISO	RGD:731745	6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ...	CTD	PMID:38598786
Ahcy	Rat	streptozocin	multiple interactions	ISO	RGD:736014	6480464	[Streptozocin co-treated with Dietary Fats] results in decreased expression of AHCY mRNA; [Streptozocin co-treated with more ...	CTD	PMID:29127188
Ahcy	Rat	T-2 toxin	increases expression	ISO	RGD:731745	6480464	T-2 Toxin results in increased expression of AHCY protein	CTD	PMID:34581912
Ahcy	Rat	tetrachloromethane	multiple interactions	ISO	RGD:736014	6480464	[Diethylnitrosamine co-treated with Carbon Tetrachloride] results in decreased expression of AHCY mRNA	CTD	PMID:29127188
Ahcy	Rat	tetrahydrocurcumin	affects expression	ISO	RGD:736014	41410880	Tetrahydrocurcumin affects expression of protein and mRNA in ischemia/reperfusion CBS+/- mice	RGD
Ahcy	Rat	thimerosal	decreases expression	ISO	RGD:731745	6480464	Thimerosal results in decreased expression of AHCY mRNA	CTD	PMID:27188386
Ahcy	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of AHCY mRNA	CTD	PMID:34492290
Ahcy	Rat	thiram	decreases expression	ISO	RGD:731745	6480464	Thiram results in decreased expression of AHCY mRNA	CTD	PMID:38568856
Ahcy	Rat	titanium dioxide	increases expression	ISO	RGD:736014	6480464	titanium dioxide results in increased expression of AHCY mRNA	CTD	PMID:29264374
Ahcy	Rat	titanium dioxide	decreases methylation	ISO	RGD:736014	6480464	titanium dioxide results in decreased methylation of AHCY gene	CTD	PMID:35295148
Ahcy	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of AHCY mRNA	CTD	PMID:19448997
Ahcy	Rat	trimellitic anhydride	increases expression	ISO	RGD:736014	6480464	trimellitic anhydride results in increased expression of AHCY mRNA	CTD	PMID:19042947
Ahcy	Rat	Triptolide	decreases expression	ISO	RGD:736014	6480464	triptolide results in decreased expression of AHCY mRNA	CTD	PMID:32835833
Ahcy	Rat	tungsten	increases expression	ISO	RGD:736014	6480464	Tungsten results in increased expression of AHCY mRNA	CTD	PMID:30912803
Ahcy	Rat	valproic acid	affects expression	ISO	RGD:736014	6480464	Valproic Acid affects the expression of AHCY mRNA	CTD	PMID:17292431
Ahcy	Rat	valproic acid	decreases expression	ISO	RGD:731745	6480464	Valproic Acid results in decreased expression of AHCY mRNA	CTD	PMID:23179753\|PMID:27188386
Ahcy	Rat	vancomycin	increases expression	ISO	RGD:736014	6480464	Vancomycin results in increased expression of AHCY mRNA	CTD	PMID:18930951
Ahcy	Rat	vinclozolin	increases methylation	EXP		6480464	vinclozolin results in increased methylation of AHCY gene	CTD	PMID:31079544
Ahcy	Rat	warfarin	decreases expression	ISO	RGD:736014	6480464	Warfarin results in decreased expression of AHCY mRNA	CTD	PMID:20493250

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ahcy	Rat	chronic inflammatory response to antigenic stimulus		IMP		1598898		RGD
Ahcy	Rat	circadian sleep/wake cycle		IDA		1598901		RGD
Ahcy	Rat	one-carbon metabolic process	involved_in	IEA	UniProtKB-KW:KW-0554	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ahcy	Rat	response to hypoxia		IEP		1598899		RGD
Ahcy	Rat	response to nutrient		IDA		1598897		RGD
Ahcy	Rat	S-adenosylhomocysteine catabolic process		IDA		730275		RGD
Ahcy	Rat	S-adenosylmethionine cycle	involved_in	IBA	PANTHER:PTN000602759\|ZFIN:ZDB-GENE-031219-6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ahcy	Rat	S-methylmethionine cycle	acts_upstream_of_or_within	ISO	RGD:736014	1624291	PMID:12023972	RGD	PMID:12023972

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ahcy	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ahcy	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ahcy	Rat	cytosol	located_in	ISO	RGD:731745\|UniProtKB:P23526-1\|UniProtKB:P23526-2	1624291		RGD	GO_REF:0000052
Ahcy	Rat	cytosol	located_in	ISO	RGD:736014	1624291	PMID:8419320	RGD	PMID:8419320
Ahcy	Rat	cytosol	is_active_in	IBA	MGI:1921590\|MGI:2385184\|MGI:87968\|PANTHER:PTN000602759\|UniProtKB:P23526	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ahcy	Rat	cytosol	located_in	TAS		1600115	Reactome:R-RNO-2408512	Reactome	Reactome:R-RNO-2408512
Ahcy	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-SubCell:SL-0095	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ahcy	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ahcy	Rat	melanosome	located_in	IEA	UniProtKB-SubCell:SL-0161	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ahcy	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ahcy	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ahcy	Rat	adenosylhomocysteinase activity		IDA		730275		RGD
Ahcy	Rat	adenosylhomocysteinase activity	enables	ISO	RGD:736014	1624291	PMID:12023972, PMID:7657650	RGD	PMID:12023972\|PMID:7657650
Ahcy	Rat	adenosylhomocysteinase activity	enables	IBA	MGI:87968\|PANTHER:PTN000602759\|RGD:69260\|SGD:S000000845\|TAIR:locus:2129256\|UniProtKB:P23526\|UniProtKB:P50250\|UniProtKB:P9WGV3	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ahcy	Rat	adenosylhomocysteinase activity	enables	IEA	RHEA:21708	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Ahcy	Rat	adenosylhomocysteinase activity	enables	ISO	RGD:731745	1624291	PMID:10933798	RGD	PMID:10933798
Ahcy	Rat	adenosylhomocysteinase activity	enables	IDA		150521644	PMID:11927587	UniProt
Ahcy	Rat	adenosylselenohomocysteinase activity	enables	TAS		1600115	Reactome:R-RNO-2408512	Reactome	Reactome:R-RNO-2408512
Ahcy	Rat	adenyl nucleotide binding		IDA		1598900		RGD
Ahcy	Rat	copper ion binding	enables	ISO	RGD:736014	1624291	PMID:8419320	RGD	PMID:8419320
Ahcy	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ahcy	Rat	identical protein binding		IDA		1598902		RGD
Ahcy	Rat	identical protein binding	enables	ISO	RGD:736014	1624291	PR:P50247 PMID:8419320	RGD	PMID:8419320
Ahcy	Rat	NAD binding		IDA		1598902		RGD
Ahcy	Rat	NAD binding	enables	ISO	RGD:736014	1624291	PMID:7657650	RGD	PMID:7657650
Ahcy	Rat	protein binding	enables	ISO	RGD:736014	1624291	UniProtKB:P39428 PMID:15102471	RGD	PMID:15102471
Ahcy	Rat	protein binding	enables	ISO	RGD:731745	1624291	UniProtKB:Q6AI12\|UniProtKB:Q92624\|UniProtKB:Q9BV19 PMID:25416956, PMID:25910212, PMID:28514442, PMID:31515488, PMID:32296183, PMID:33961781, PMID:35271311	RGD	PMID:25416956\|PMID:25910212\|PMID:28514442\|PMID:31515488\|PMID:32296183\|PMID:33961781\|PMID:35271311

Molecular Pathway Annotations Click to see Annotation Detail View

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ahcy	Rat	homocysteine metabolic pathway		TAS		730275		RGD
Ahcy	Rat	homocysteine metabolic pathway		ISO	RGD:731745	7242426		RGD
Ahcy	Rat	methionine cycle/metabolic pathway		ISO	RGD:731745	7242425		RGD
Ahcy	Rat	methionine cycle/metabolic pathway		IMP		7242932		RGD
Ahcy	Rat	methionine cycle/metabolic pathway		TAS		730275		RGD

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ahcy	Rat	choline metabolic pathway		ISO	RGD:731745	10402751		SMPDB	SMP:00123
Ahcy	Rat	glycine N-methyltransferase deficiency pathway		ISO	RGD:731745	10402751		SMPDB	SMP:00222
Ahcy	Rat	homocystinuria pathway		ISO	RGD:731745	10402751		SMPDB	SMP:00177
Ahcy	Rat	hypermethioninemia pathway		ISO	RGD:731745	10402751		SMPDB	SMP:00341
Ahcy	Rat	hypermethioninemia pathway		ISO	RGD:731745	10402751		SMPDB	SMP:00221
Ahcy	Rat	methionine cycle/metabolic pathway		ISO	RGD:731745	10402751		SMPDB	SMP:00033
Ahcy	Rat	methylenetetrahydrofolate reductase deficiency pathway		ISO	RGD:731745	10402751		SMPDB	SMP:00340
Ahcy	Rat	remethylation pathway of homocysteine metabolism - cobalamin independent, betaine dependent		ISO	RGD:731745	10402751		SMPDB	SMP:00123
Ahcy	Rat	selenoamino acid metabolic pathway		ISO	RGD:731745	10402751		SMPDB	SMP:00029

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ahcy	Rat	cysteine and methionine metabolic pathway		IEA		6907045		KEGG	rno:00270

BioCyc Pathways

L-methionine degradation I (to L-homocysteine)	S-adenosyl-L-methionine salvage II

Disease Annotations Click to see Annotation Detail View

abdominal aortic aneurysm (ISO)

amino acid metabolic disorder (ISO)

Animal Disease Models (ISO)

Experimental Arthritis (IDA)

genetic disease (ISO)

glutathione synthetase deficiency (ISO)

glutatione synthetase deficiency with 5-oxoprolinuria (ISO)

hyperhomocysteinemia (IDA)

hypermethioninemia (ISO)

hypermethioninemia with deficiency of S-adenosylhomocysteine hydrolase (ISO)

hypertension (ISO)

Hypoxia (ISO)

long QT syndrome (ISO)

lung adenocarcinoma (ISO)

metabolic dysfunction-associated steatotic liver disease (ISO)

Multisystem Autoimmune Disease with Facial Dysmorphism (ISO)

Obesity and Hypopigmentation (ISO)

pyridoxine deficiency anemia (IDA)

Rhabdomyolysis (ISO)

Sunburn (ISO)

Wilson disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrabromodibenzodioxine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO)

2,6-dimethoxyphenol (ISO)

2-hydroxypropanoic acid (ISO)

2-palmitoylglycerol (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

acrylamide (EXP)

actinomycin D (ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

azoxystrobin (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

benzoates (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

buspirone (EXP)

buta-1,3-diene (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

carbon nanotube (ISO)

ceruletide (EXP)

chloropicrin (ISO)

chlorpyrifos (ISO)

choline (EXP,ISO)

cisplatin (ISO)

clofibrate (ISO)

copper atom (EXP)

copper(0) (EXP)

CU-O LINKAGE (ISO)

D-penicillamine (ISO)

diarsenic trioxide (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

flavonoids (EXP)

folic acid (EXP,ISO)

formaldehyde (ISO)

fumonisin B1 (ISO)

furfural (ISO)

glafenine (EXP)

glycine betaine (EXP,ISO)

homocysteine (ISO)

isoprenaline (ISO)

ivermectin (ISO)

L-methionine (EXP,ISO)

leflunomide (EXP)

lipopolysaccharide (ISO)

lovastatin (ISO)

methapyrilene (EXP)

methidathion (ISO)

methotrexate (ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-nitrosodiethylamine (EXP,ISO)

N-nitrosomorpholine (EXP)

nitrofen (EXP)

Nonylphenol (EXP)

Nutlin-3 (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

parathion (ISO)

PCB138 (EXP,ISO)

perfluorododecanoic acid (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (EXP)

picoxystrobin (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propiconazole (ISO)

Propiverine (EXP)

pyrimidifen (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (ISO)

S-adenosyl-L-homocysteine (ISO)

sarin (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

streptozocin (ISO)

T-2 toxin (ISO)

tetrachloromethane (ISO)

tetrahydrocurcumin (ISO)

thimerosal (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trimellitic anhydride (ISO)

Triptolide (ISO)

tungsten (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

warfarin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chronic inflammatory response to antigenic stimulus (IMP)

circadian sleep/wake cycle (IDA)

one-carbon metabolic process (IEA)

response to hypoxia (IEP)

response to nutrient (IDA)

S-adenosylhomocysteine catabolic process (IDA)

S-adenosylmethionine cycle (IBA)

S-methylmethionine cycle (ISO)

Cellular Component

cytoplasm (IEA)

cytosol (IBA,ISO,TAS)

endoplasmic reticulum (IEA)

melanosome (IEA)

nucleus (IEA)

Molecular Function

adenosylhomocysteinase activity (IBA,IDA,IEA,ISO)

adenosylselenohomocysteinase activity (TAS)

adenyl nucleotide binding (IDA)

copper ion binding (ISO)

hydrolase activity (IEA)

identical protein binding (IDA,ISO)

NAD binding (IDA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

choline metabolic pathway (ISO)

cysteine and methionine metabolic pathway (IEA)

glycine N-methyltransferase deficiency pathway (ISO)

homocysteine metabolic pathway (ISO,TAS)

homocystinuria pathway (ISO)

hypermethioninemia pathway (ISO)

methionine cycle/metabolic pathway (IMP,ISO,TAS)

methylenetetrahydrofolate reductase deficiency pathway (ISO)

remethylation pathway of homocysteine metabolism - cobalamin independent, betaine dependent (ISO)

selenoamino acid metabolic pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	S-adenosylhomocysteine hydrolase deficiency in a human: a genetic disorder of methionine metabolism.	Baric I, etal., Proc Natl Acad Sci U S A 2004 Mar 23;101(12):4234-9. Epub 2004 Mar 15.
2.	Overview of homocysteine and folate metabolism. With special references to cardiovascular disease and neural tube defects.	Blom HJ and Smulders Y, J Inherit Metab Dis. 2011 Feb;34(1):75-81. doi: 10.1007/s10545-010-9177-4. Epub 2010 Sep 4.
3.	Regional and subcellular distribution of S-adenosylhomocysteine hydrolase in the adult rat brain.	Broch OJ and Ueland PM, J Neurochem. 1980 Aug;35(2):484-8.
4.	Day-night variations of adenosine and its metabolizing enzymes in the brain cortex of the rat--possible physiological significance for the energetic homeostasis and the sleep-wake cycle.	Chagoya de Sanchez V, etal., Brain Res. 1993 May 28;612(1-2):115-21.
5.	Effect of hyperhomocysteinemia on plasma or tissue adenosine levels and renal function.	Chen YF, etal., Circulation. 2002 Sep 3;106(10):1275-81.
6.	Aminooxy analogues of spermidine as inhibitors of spermine synthase and substrates of hepatic polyamine acetylating activity.	Eloranta TO, etal., J Biochem. 1990 Oct;108(4):593-8.
7.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.	Isolation, cloning and characterization of a low-molecular-mass purine nucleoside- and nucleotide-binding protein.	Gilmour J, etal., Biochem J. 1997 Sep 1;326 ( Pt 2):471-7.
9.	Genetic analysis of 56 polymorphisms in 17 genes involved in methionine metabolism in patients with abdominal aortic aneurysm.	Giusti B, etal., J Med Genet. 2008 Nov;45(11):721-30. doi: 10.1136/jmg.2008.057851. Epub 2008 Jul 17.
10.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
11.	Rat liver S-adenosylhomocysteinase. Spectrophotometric study of coenzyme binding.	Gomi T, etal., Biochim Biophys Acta. 1989 Feb 2;994(2):172-9.
12.	Inhibition of S-adenosylhomocysteine hydrolase by acyclic sugar adenosine analogue D-eritadenine. Crystal structure of S-adenosylhomocysteine hydrolase complexed with D-eritadenine.	Huang Y, etal., J Biol Chem 2002 Mar 1;277(9):7477-82.
13.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
14.	Chronic hypoxia enhances adenosine release in rat PC12 cells by altering adenosine metabolism and membrane transport.	Kobayashi S, etal., J Neurochem. 2000 Feb;74(2):621-32.
15.	S-adenosylmethionine in liver health, injury, and cancer.	Lu SC and Mato JM, Physiol Rev. 2012 Oct;92(4):1515-42. doi: 10.1152/physrev.00047.2011.
16.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
17.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
18.	Effect of vitamin B6 deficiency on the synthesis and accumulation of S-adenosylhomocysteine and S-adenosylmethionine in rat tissues.	Nguyen TT, etal., J Nutr Sci Vitaminol (Tokyo). 2001 Jun;47(3):188-94.
19.	Amino acid sequence of S-adenosyl-L-homocysteine hydrolase from rat liver as derived from the cDNA sequence.	Ogawa H, etal., Proc Natl Acad Sci U S A 1987 Feb;84(3):719-23.
20.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
21.	3-Deazaadenosine mitigates arterial remodeling and hypertension in hyperhomocysteinemic mice.	Ovechkin AV, etal., Am J Physiol Lung Cell Mol Physiol. 2006 Nov;291(5):L905-11. Epub 2006 Jun 30.
22.	Localization of S-adenosylhomocysteine hydrolase and adenosine deaminase immunoreactivities in rat brain.	Patel BT and Tudball N, Brain Res. 1986 Apr 9;370(2):250-64.
23.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
24.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
25.	GOA pipeline	RGD automated data pipeline
26.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
27.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
28.	S-Adenosyl-L-homocysteine hydrolase inhibitor mediates immunosuppressive effects in vivo: suppression of delayed type hypersensitivity ear swelling and peptidoglycan polysaccharide-induced arthritis.	Saso Y, etal., J Pharmacol Exp Ther. 2001 Jan;296(1):106-12.
29.	Catalytic mechanism of S-adenosylhomocysteine hydrolase. Site-directed mutagenesis of Asp-130, Lys-185, Asp-189, and Asn-190.	Takata Y, etal., J Biol Chem. 2002 Jun 21;277(25):22670-6. doi: 10.1074/jbc.M201116200. Epub 2002 Apr 1.
30.	Tetrahydrocurcumin ameliorates homocysteinylated cytochrome-c mediated autophagy in hyperhomocysteinemia mice after cerebral ischemia.	Tyagi N, etal., J Mol Neurosci. 2012 May;47(1):128-38. doi: 10.1007/s12031-011-9695-z. Epub 2012 Jan 3.

Additional References at PubMed

PMID:3759971	PMID:7744082	PMID:8419320	PMID:10387078	PMID:10913437	PMID:12023972	PMID:12477932	PMID:17310100	PMID:19056867	PMID:19805518	PMID:20458337	PMID:22871113
PMID:23376485	PMID:23533145

Genomics

Comparative Map Data

Ahcy
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	164,029,338 - 164,044,562 (-)	NCBI		GRCr8
mRatBN7.2	3	143,569,134 - 143,584,359 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	143,569,094 - 143,584,393 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	147,436,772 - 147,451,996 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	156,054,058 - 156,069,282 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	153,793,593 - 153,808,817 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	150,587,833 - 150,603,057 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	150,587,833 - 150,603,082 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	156,957,240 - 156,972,464 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	145,544,834 - 145,560,058 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	145,450,455 - 145,465,680 (-)	NCBI
Celera	3	142,299,485 - 142,314,709 (-)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

AHCY
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	34,231,981 - 34,311,836 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	34,280,268 - 34,311,802 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	32,868,074 - 32,899,608 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	32,331,737 - 32,354,784 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	32,331,736 - 32,354,784	NCBI
Celera	20	29,617,551 - 29,649,079 (-)	NCBI		Celera
Cytogenetic Map	20	q11.22	ENTREZGENE
HuRef	20	29,649,874 - 29,681,357 (-)	NCBI		HuRef
CHM1_1	20	32,769,165 - 32,800,706 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	35,953,425 - 36,034,942 (-)	NCBI		T2T-CHM13v2.0

Ahcy
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	154,901,230 - 154,916,417 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	154,901,230 - 154,916,417 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	155,059,310 - 155,074,497 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	155,059,310 - 155,074,497 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	154,885,046 - 154,900,233 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	154,750,751 - 154,765,867 (-)	NCBI		MGSCv36	mm8
Celera	2	160,986,232 - 161,001,420 (-)	NCBI		Celera
Cytogenetic Map	2	H1	NCBI
cM Map	2	76.94	NCBI

Ahcy
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	26,992,295 - 27,013,100 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	26,992,295 - 27,013,100 (+)	NCBI	ChiLan1.0	ChiLan1.0

AHCY
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	39,981,145 - 40,031,255 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	39,980,593 - 40,024,358 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	30,603,701 - 30,626,835 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	31,738,007 - 31,760,803 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	31,738,007 - 31,760,803 (-)	Ensembl	panpan1.1		panPan2

AHCY
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	23,410,553 - 23,423,494 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	23,411,140 - 23,419,767 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	23,058,324 - 23,071,803 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	24,101,284 - 24,114,771 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	24,100,998 - 24,114,735 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	23,389,987 - 23,403,460 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	23,484,066 - 23,497,508 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	23,923,430 - 23,937,131 (-)	NCBI		UU_Cfam_GSD_1.0

Ahcy
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	172,415,357 - 172,434,758 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936561	6,314,705 - 6,334,439 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936561	6,314,797 - 6,333,961 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AHCY
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	37,726,084 - 37,744,461 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	37,726,084 - 37,744,378 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	42,693,955 - 42,706,644 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	17	q21	NCBI

AHCY
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	38,579,254 - 38,601,218 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	38,579,024 - 38,601,208 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	88,256,407 - 88,278,319 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ahcy
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624842	5,053,280 - 5,072,679 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624842	5,053,336 - 5,071,902 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ahcy
53 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	104
Count of miRNA genes:	79
Interacting mature miRNAs:	98
Transcripts:	ENSRNOT00000024310
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141074471	169034231	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
61335	Bp20	Blood pressure QTL 20	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141339236	155617360	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141339013	162184794	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	140069424	146976080	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat

Markers in Region

RH141077

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	3	q42	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017201	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC061841	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M15185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U14937	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024310 ⟹ ENSRNOP00000024310

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	143,569,094 - 143,584,393 (-)	Ensembl
Rnor_6.0 Ensembl	3	150,587,833 - 150,603,082 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114905 ⟹ ENSRNOP00000079171

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	143,569,094 - 143,578,409 (-)	Ensembl

RefSeq Acc Id:

NM_017201 ⟹ NP_058897

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	164,029,338 - 164,044,562 (-)	NCBI
mRatBN7.2	3	143,569,134 - 143,584,359 (-)	NCBI
Rnor_6.0	3	150,587,833 - 150,603,057 (-)	NCBI
Rnor_5.0	3	156,957,240 - 156,972,464 (-)	NCBI
RGSC_v3.4	3	145,544,834 - 145,560,058 (-)	RGD
Celera	3	142,299,485 - 142,314,709 (-)	RGD

Sequence:

show sequence

CTCACTCTAGCGGACTTCGCCAGCATGGCTGATAAACTGCCCTACAAAGTCGCGGACATTGGAC
TGGCTGCCTGGGGACGGAAGGCCCTGGACATAGCTGAGAACGAGATGCCAGGTTTGATGCGCAT
GCGGGAGATGTACTCAGCCTCCAAGCCACTGAAGGGCGCTCGCATTGCTGGCTGCCTGCACATG
ACTGTGGAGACTGCTGTCCTCATTGAGACTCTCGTGGCCCTGGGTGCTGAGGTGCGGTGGTCCA
GCTGCAACATCTTCTCCACTCAGGACCATGCAGCGGCTGCCATTGCCAAGGCTGGCATTCCAGT
GTTTGCCTGGAAGGGAGAGACGGATGAAGAGTACCTGTGGTGCATTGAGCAGACGTTGCACTTC
AAGGACGGACCCCTCAACATGATTCTGGATGATGGCGGTGACCTTACTAACCTCATCCACACCA
AACACCCACAGCTTCTGTCAGGCATCCGAGGTATCTCTGAGGAGACCACGACTGGCGTCCACAA
CCTCTACAAGATGATGGCCAATGGGATACTGAAGGTGCCTGCCATCAACGTCAACGATTCTGTC
ACCAAGAGCAAGTTTGACAACCTCTATGGCTGCCGGGAGTCCCTCATAGATGGCATCAAACGGG
CAACAGATGTGATGATTGCGGGCAAGGTGGCAGTGGTAGCAGGCTATGGTGATGTGGGCAAGGG
TTGTGCCCAGGCCCTGCGGGGTTTCGGGGCCCGAGTCATCATCACCGAGATTGACCCCATCAAT
GCACTGCAAGCTGCCATGGAGGGCTACGAGGTAACCACCATGGACGAGGCCTGTAAGGAGGGCA
ACATCTTTGTGACCACCACGGGCTGTGTTGATATCATCCTTGGTCGGCACTTTGAACAGATGAA
GGATGATGCCATTGTCTGTAACATTGGACACTTCGACGTGGAGATTGATGTGAAGTGGCTCAAT
GAGAACGCTGTGGAGAAGGTGAACATCAAGCCCCAGGTGGACCGCTACTTGCTAAAGAATGGGC
ACCGCATCATCTTGCTGGCTGAGGGCCGTCTGGTCAACCTGGGTTGTGCCATGGGCCACCCCAG
CTTCGTGATGAGCAACTCCTTCACAAACCAGGTGATGGCACAGATTGAGCTGTGGACCCACCCA
GACAAATACCCCGTGGGGGTTCACTTCCTGCCTAAGAAGCTGGATGAGGCAGTGGCTGAAGCCC
ACCTGGGCAAGCTGAACGTCAAGCTGACCAAGCTGACTGAGAAGCAGGCTCAGTACCTGGGCAT
GCCCATTAACGGCCCCTTCAAGCCTGATCACTACCGCTACTGAGAGCTGGGACTGCCCTTCACC
TTCCAGCTGCCATCCTTGTTCCAGGCCCTACCTCTCGTTCCCAAGAGCAAATGTCACCAACTTT
GCAGTTACTTCTCCGGTGTTCTGCTCCCTCCCCCGGCCCTCATCCACACTGTGACTGGTCTTTC
TGTCTTTGGCTTCTGCTGTACCCCTCATACTGTTCCCTATGTGGCATAGAGAACAGAGAGGTAC
CTGGGAGGCATCCACAGGGGATCTGAGCTCTTGGAAGGTCTGAGGCTGGATGTTGCTGGTGGTC
ACAAGCCCATGCACCTTACTATCCAAACTCTCGCTTGGTCTTTAGATCCGTGTGCTTGGTTTAC
AGACCAATGGTTTCTCGGCCCAGGACCCAAGAAGGAGCTCTACCATGGGGGAAGGAACCACTGG
AGTTTGAAGGCTCCTGAGAGCTTGGCCTTTTTACTGTTGGGCTGTCTCTTAAACCTCCTAATAC
TGAGTTGGCTACTTTTGGTCCCTATTTCACAAGGGTTAGGACAGATTAACCAAGAAAGGACAAG
TGACAGAGACTGAAAGGGGCTGGAAAAACAAATAGGGAAAGGCCTGTCACCTACGGTATAATTG
ATGGTTCCTATCACAAGCCTGGATCACAAACAGATTAATTTGTTCTATGTTTATATACTGTTTA
GAATGTTAACACAGGAAGGTGGATAAAATACAGTTTCTAGTGCCT

hide sequence

Protein Sequences


Protein RefSeqs	NP_058897	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40705	(Get FASTA)	NCBI Sequence Viewer
	AAA92043	(Get FASTA)	NCBI Sequence Viewer
	AAH61841	(Get FASTA)	NCBI Sequence Viewer
	EDL85938	(Get FASTA)	NCBI Sequence Viewer
	EDL85939	(Get FASTA)	NCBI Sequence Viewer
	EDL85940	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024310
	ENSRNOP00000024310.1
GenBank Protein	P10760	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058897 ⟸ NM_017201

- UniProtKB:

P10760 (UniProtKB/Swiss-Prot), A6KI17 (UniProtKB/TrEMBL), A0A8I5ZM95 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MADKLPYKVADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVETAVLI
ETLVALGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYLWCIEQTLHFKDGPLNMI
LDDGGDLTNLIHTKHPQLLSGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNL
YGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEG
YEVTTMDEACKEGNIFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVN
IKPQVDRYLLKNGHRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVH
FLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY

hide sequence

Ensembl Acc Id:

ENSRNOP00000024310 ⟸ ENSRNOT00000024310

Ensembl Acc Id:

ENSRNOP00000079171 ⟸ ENSRNOT00000114905

Protein Domains

S-adenosyl-L-homocysteine hydrolase NAD binding

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P10760-F1-model_v2	AlphaFold	P10760	1-432	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692579

Promoter ID:

EPDNEW_R3104

Type:

multiple initiation site

Name:

Ahcy_1

Description:

adenosylhomocysteinase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	150,603,095 - 150,603,155	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69260	AgrOrtholog
BioCyc Gene	G2FUF-47153	BioCyc
BioCyc Pathway	METHIONINE-DEG1-PWY [L-methionine degradation I (to L-homocysteine)]	BioCyc
	PWY-5041 [S-adenosyl-L-methionine salvage II]	BioCyc
BioCyc Pathway Image	METHIONINE-DEG1-PWY	BioCyc
	PWY-5041	BioCyc
Ensembl Genes	ENSRNOG00000017777	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000024310	ENTREZGENE
	ENSRNOT00000024310.4	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.1480	UniProtKB/Swiss-Prot
	NAD(P)-binding Rossmann-like Domain	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5599994	IMAGE-MGC_LOAD
InterPro	Adenosylhomocyst_ase-like_sf	UniProtKB/Swiss-Prot
	Adenosylhomocysteinase-like	UniProtKB/Swiss-Prot
	Ado_hCys_hydrolase_NAD-bd	UniProtKB/Swiss-Prot
	NAD(P)-bd_dom_sf	UniProtKB/Swiss-Prot
	S-Ado-L-homoCys_hydrolase_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:29443	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72509	IMAGE-MGC_LOAD
NCBI Gene	29443	ENTREZGENE
PANTHER	ADENOSYLHOMOCYSTEINASE	UniProtKB/Swiss-Prot
	PTHR23420	UniProtKB/Swiss-Prot
Pfam	AdoHcyase	UniProtKB/Swiss-Prot
	AdoHcyase_NAD	UniProtKB/Swiss-Prot
PharmGKB	AHCY	RGD
PhenoGen	Ahcy	PhenoGen
PIRSF	Ad_hcy_hydrolase	UniProtKB/Swiss-Prot
PROSITE	ADOHCYASE_1	UniProtKB/Swiss-Prot
	ADOHCYASE_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000017777	RatGTEx
SMART	AdoHcyase	UniProtKB/Swiss-Prot
	AdoHcyase_NAD	UniProtKB/Swiss-Prot
Superfamily-SCOP	Formate/glycerate dehydrogenase catalytic domain-like	UniProtKB/Swiss-Prot
	SSF51735	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZM95	ENTREZGENE, UniProtKB/TrEMBL
	A6KI15_RAT	UniProtKB/TrEMBL
	A6KI17	ENTREZGENE, UniProtKB/TrEMBL
	P10760	ENTREZGENE
	Q6P743_RAT	UniProtKB/TrEMBL
	SAHH_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-09-17	Ahcy	adenosylhomocysteinase	Ahcy	S-adenosylhomocysteine hydrolase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Ahcy	S-adenosylhomocysteine hydrolase			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_function	a competitive inhibitor of s-adenosyl-l-methionine-dependent methyl transferase reactions	724707
gene_process	may play a key role in the control of methylations via regulation of the intracellular concentration of adenosylhomocysteine	724707

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways