Symbol:
Prps1
Name:
phosphoribosyl pyrophosphate synthetase 1
RGD ID:
62248
MGI Page
MGI
Description:
Enables ribose phosphate diphosphokinase activity. Involved in 5-phosphoribose 1-diphosphate biosynthetic process and pentose-phosphate shunt. Is active in cytosol. Is expressed in central nervous system; heart; inner ear; liver; and retina. Human ortholog(s) of this gene implicated in Arts syndrome; X-linked deafness 1; X-linked recessive disease (multiple); gout; and retinitis pigmentosa. Orthologous to human PRPS1 (phosphoribosyl pyrophosphate synthetase 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2310010D17Rik; C76571; C76678; phosphoribosyl pyrophosphate synthase I; phosphoribosyl pyrophosphate synthetase I; Pr; Prps-1; PRS-I; ribose-phosphate pyrophosphokinase 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRPS1 (phosphoribosyl pyrophosphate synthetase 1)
HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Prps1 (phosphoribosyl pyrophosphate synthetase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prps1 (phosphoribosyl pyrophosphate synthetase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRPS1 (phosphoribosyl pyrophosphate synthetase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRPS1 (phosphoribosyl pyrophosphate synthetase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prps1 (phosphoribosyl pyrophosphate synthetase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRPS1 (phosphoribosyl pyrophosphate synthetase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRPS1 (phosphoribosyl pyrophosphate synthetase 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PRPS2 (phosphoribosyl pyrophosphate synthetase 2)
HGNC
OrthoDB, OrthoMCL
Homo sapiens (human):
PRPS1L1 (phosphoribosyl pyrophosphate synthetase 1 like 1)
HGNC
OrthoDB
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Prps1 (phosphoribosyl pyrophosphate synthetase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PRPS1 (phosphoribosyl pyrophosphate synthetase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Prps1l3 (phosphoribosyl pyrophosphate synthetase 1-like 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prps1b (phosphoribosyl pyrophosphate synthetase 1B)
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
prps1a (phosphoribosyl pyrophosphate synthetase 1A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
R151.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG6767
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PRS2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PRS3
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoInspector|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
PRS4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prps1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Related Pseudogenes:
Gm18890
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 139,357,352 - 139,376,889 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 139,357,362 - 139,376,889 (+) Ensembl GRCm39 Ensembl GRCm38 X 140,456,603 - 140,476,140 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 140,456,613 - 140,476,140 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 136,991,142 - 137,010,679 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 135,802,977 - 135,822,503 (+) NCBI MGSCv36 mm8 Celera X 123,716,011 - 123,735,469 (+) NCBI Celera Cytogenetic Map X F1 NCBI cM Map X 61.35 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Prps1 Mouse Arts syndrome ISO RGD:736625 8554872 ClinVar Annotator: match by term: Arts syndrome | ClinVar Annotator: match by term: MENTAL RETARDATION, more ... ClinVar PMID:1664177|PMID:17701896|PMID:17701900|PMID:19161981|PMID:20301731|PMID:22246954|PMID:24033266|PMID:24528855|PMID:25741868|PMID:26089585|PMID:28492532|PMID:28967191|PMID:31906484|PMID:3278127|PMID:32781272|PMID:6243137|PMID:7593598|PMID:8253776|PMID:8498830 Prps1 Mouse autistic disorder ISO RGD:736625 8554872 ClinVar Annotator: match by term: Autism ClinVar PMID:21681106|PMID:30208311 Prps1 Mouse autosomal hemophilia A ISO RGD:736625 8554872 ClinVar Annotator: match by term: AUTOSOMAL HEMOPHILIA A ClinVar PMID:31690835 Prps1 Mouse Charcot-Marie-Tooth disease type X ISO RGD:736625 8554872 ClinVar Annotator: match by term: Charcot-Marie-Tooth Neuropathy X | ClinVar Annotator: match by term: Charcot-Marie-Tooth, more ... ClinVar PMID:16199547|PMID:17576681|PMID:17701900|PMID:20021999|PMID:20301731|PMID:20301734|PMID:24033266|PMID:24528855|PMID:24961627|PMID:25182139|PMID:25741868|PMID:26467025|PMID:28492532|PMID:28967191|PMID:29986705|PMID:30177296|PMID:31906484|PMID:32528171|PMID:3278127|PMID:32781272|PMID:33493137|PMID:33532242|PMID:8702702|PMID:8968763|PMID:9536098 Prps1 Mouse Charcot-Marie-Tooth disease X-linked recessive 5 ISO RGD:736625 8554872 ClinVar Annotator: match by term: Charcot-Marie-Tooth disease X-linked recessive 5 | ClinVar Annotator: match by more ... ClinVar PMID:17701900|PMID:20301731|PMID:24033266|PMID:24285972|PMID:25182139|PMID:25491489|PMID:25741868|PMID:28492532|PMID:3278127|PMID:32781272|PMID:33493137 Prps1 Mouse factor VIII deficiency ISO RGD:736625 8554872 ClinVar Annotator: match by term: Factor 8 deficiency, congenital ClinVar PMID:31690835 Prps1 Mouse familial hypocalciuric hypercalcemia ISO RGD:736625 8554872 ClinVar Annotator: match by term: Nephrolithiasis/nephrocalcinosis ClinVar PMID:24033266|PMID:25741868|PMID:26467025|PMID:28492532 Prps1 Mouse fundus dystrophy ISO RGD:736625 8554872 ClinVar Annotator: match by term: Retinal dystrophy ClinVar PMID:24961627|PMID:25741868|PMID:28492532|PMID:28967191|PMID:3278127|PMID:32781272 Prps1 Mouse genetic disease ISO RGD:736625 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:1664177|PMID:19161981|PMID:25741868|PMID:26089585|PMID:6243137|PMID:8253776 Prps1 Mouse Hearing Loss ISO RGD:736625 8554872 ClinVar Annotator: match by term: X-linked nonsyndromic hearing loss ClinVar Prps1 Mouse phosphoribosylpyrophosphate synthetase superactivity ISO RGD:736625 8554872 ClinVar Annotator: match by term: Phosphoribosylpyrophosphate synthetase superactivity ClinVar PMID:1664177|PMID:171280|PMID:17701900|PMID:19161981|PMID:20301731|PMID:24033266|PMID:25741868|PMID:26089585|PMID:28492532|PMID:28967191|PMID:6243137|PMID:7593598|PMID:8253776 Prps1 Mouse syndromic X-linked intellectual disability Lubs type ISO RGD:736625 8554872 ClinVar Annotator: match by term: Syndromic X-linked intellectual disability Lubs type ClinVar PMID:25741868 Prps1 Mouse X-linked deafness 1 ISO RGD:736625 8554872 ClinVar Annotator: match by term: DEAFNESS, X-LINKED 2, SENSORINEURAL CONGENITAL | ClinVar Annotator: match by more ... ClinVar PMID:10503584|PMID:15240907|PMID:17701900|PMID:20021999|PMID:20301731|PMID:24033266|PMID:24528855|PMID:25182139|PMID:25741868|PMID:28492532|PMID:30311386|PMID:8968763
Only show annotations with direct experimental evidence (0 objects hidden)
Prps1 Mouse (+)-schisandrin B multiple interactions ISO RGD:61955 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PRPS1 mRNA] CTD PMID:31150632 Prps1 Mouse (S)-nicotine increases splicing ISO RGD:736625 6480464 Nicotine results in increased splicing of PRPS1 mRNA alternative form CTD PMID:23825647 Prps1 Mouse (Z)-3-butylidenephthalide decreases expression ISO RGD:736625 6480464 butylidenephthalide results in decreased expression of PRPS1 protein CTD PMID:23770345 Prps1 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1,2-Dimethylhydrazine results in decreased expression of PRPS1 mRNA CTD PMID:22206623 Prps1 Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of PRPS1 mRNA CTD PMID:17555576 Prps1 Mouse 17beta-estradiol increases expression ISO RGD:736625 6480464 Estradiol results in increased expression of PRPS1 mRNA CTD PMID:19619570 Prps1 Mouse 17beta-estradiol multiple interactions ISO RGD:736625 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of PRPS1 mRNA CTD PMID:19619570 Prps1 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:736625 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of PRPS1 mRNA CTD PMID:19619570 Prps1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:61955 6480464 Tetrachlorodibenzodioxin results in increased expression of PRPS1 mRNA CTD PMID:26232522 Prps1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:736625 6480464 Tetrachlorodibenzodioxin results in increased expression of PRPS1 mRNA CTD PMID:19619570|PMID:22903824 Prps1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PRPS1 mRNA CTD PMID:21570461 Prps1 Mouse 3-methylcholanthrene multiple interactions ISO RGD:736625 6480464 Methylcholanthrene promotes the reaction [AHR protein binds to PRPS1 promoter] CTD PMID:20348232 Prps1 Mouse 3H-1,2-dithiole-3-thione decreases expression ISO RGD:61955 6480464 1,2-dithiol-3-thione results in decreased expression of PRPS1 mRNA CTD PMID:19162173 Prps1 Mouse 4,4'-sulfonyldiphenol increases expression ISO RGD:736625 6480464 bisphenol S results in increased expression of PRPS1 protein CTD PMID:34186270 Prps1 Mouse 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of PRPS1 mRNA CTD PMID:28973697 Prps1 Mouse 5-fluorouracil increases expression ISO RGD:736625 6480464 Fluorouracil results in increased expression of PRPS1 mRNA CTD PMID:16584549 Prps1 Mouse afimoxifene increases expression ISO RGD:736625 6480464 afimoxifene results in increased expression of PRPS1 mRNA CTD PMID:16849584 Prps1 Mouse aflatoxin B1 decreases expression ISO RGD:736625 6480464 Aflatoxin B1 results in decreased expression of PRPS1 mRNA CTD PMID:22100608 Prps1 Mouse all-trans-retinoic acid decreases expression ISO RGD:736625 6480464 Tretinoin results in decreased expression of PRPS1 mRNA CTD PMID:15498508|PMID:21934132|PMID:33167477 Prps1 Mouse ammonium chloride affects expression ISO RGD:61955 6480464 Ammonium Chloride affects the expression of PRPS1 mRNA CTD PMID:16483693 Prps1 Mouse aristolochic acid A increases expression ISO RGD:736625 6480464 aristolochic acid I results in increased expression of PRPS1 protein CTD PMID:33212167 Prps1 Mouse arsane increases methylation ISO RGD:736625 6480464 Arsenic results in increased methylation of PRPS1 promoter CTD PMID:21291286 Prps1 Mouse arsenic atom increases methylation ISO RGD:736625 6480464 Arsenic results in increased methylation of PRPS1 promoter CTD PMID:21291286 Prps1 Mouse arsenous acid increases expression ISO RGD:736625 6480464 Arsenic Trioxide results in increased expression of PRPS1 mRNA CTD PMID:20458559 Prps1 Mouse arsenous acid decreases expression ISO RGD:736625 6480464 Arsenic Trioxide results in decreased expression of PRPS1 protein CTD PMID:25419056 Prps1 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of PRPS1 mRNA CTD PMID:22228805 Prps1 Mouse benzo[a]pyrene increases methylation ISO RGD:736625 6480464 Benzo(a)pyrene results in increased methylation of PRPS1 exon CTD PMID:27901495 Prps1 Mouse benzo[a]pyrene affects methylation ISO RGD:736625 6480464 Benzo(a)pyrene affects the methylation of PRPS1 promoter CTD PMID:27901495 Prps1 Mouse bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:61955 6480464 [Diethylhexyl Phthalate co-treated with Genistein] results in increased expression of PRPS1 mRNA CTD PMID:25031359 Prps1 Mouse bisphenol A increases expression ISO RGD:61955 6480464 bisphenol A results in increased expression of PRPS1 mRNA CTD PMID:25181051 Prps1 Mouse bisphenol A decreases expression ISO RGD:736625 6480464 bisphenol A results in decreased expression of PRPS1 mRNA; bisphenol A results in decreased expression more ... CTD PMID:31121516|PMID:33376534|PMID:34186270|PMID:37567409 Prps1 Mouse bisphenol AF increases expression ISO RGD:736625 6480464 bisphenol AF results in increased expression of PRPS1 protein CTD PMID:34186270 Prps1 Mouse bisphenol AF decreases expression ISO RGD:736625 6480464 bisphenol AF results in decreased expression of PRPS1 mRNA CTD PMID:31121516 Prps1 Mouse Bisphenol B increases expression ISO RGD:736625 6480464 bisphenol B results in increased expression of PRPS1 protein CTD PMID:34186270 Prps1 Mouse butan-1-ol multiple interactions ISO RGD:736625 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Prps1 Mouse butanal increases expression ISO RGD:736625 6480464 butyraldehyde results in increased expression of PRPS1 mRNA CTD PMID:26079696 Prps1 Mouse cadmium atom multiple interactions ISO RGD:736625 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PRPS1 more ... CTD PMID:35301059 Prps1 Mouse cadmium dichloride decreases expression ISO RGD:736625 6480464 Cadmium Chloride results in decreased expression of PRPS1 mRNA CTD PMID:25596134 Prps1 Mouse cadmium dichloride multiple interactions ISO RGD:736625 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PRPS1 more ... CTD PMID:35301059 Prps1 Mouse cannabidiol multiple interactions ISO RGD:736625 6480464 [Cannabidiol co-treated with moringin] results in increased expression of PRPS1 mRNA CTD PMID:30096889 Prps1 Mouse chloroacetaldehyde increases expression ISO RGD:736625 6480464 chloroacetaldehyde results in increased expression of PRPS1 mRNA CTD PMID:25596134 Prps1 Mouse cidofovir anhydrous increases expression ISO RGD:736625 6480464 Cidofovir results in increased expression of PRPS1 mRNA CTD PMID:25596134 Prps1 Mouse clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of PRPS1 mRNA CTD PMID:17585979 Prps1 Mouse copper atom multiple interactions ISO RGD:736625 6480464 [Chelating Agents binds to Copper] which results in decreased expression of PRPS1 mRNA CTD PMID:31162603 Prps1 Mouse copper(0) multiple interactions ISO RGD:736625 6480464 [Chelating Agents binds to Copper] which results in decreased expression of PRPS1 mRNA CTD PMID:31162603 Prps1 Mouse cyclosporin A increases expression ISO RGD:736625 6480464 Cyclosporine results in increased expression of PRPS1 mRNA CTD PMID:20106945|PMID:25596134 Prps1 Mouse DDE increases expression ISO RGD:736625 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of PRPS1 mRNA CTD PMID:38568856 Prps1 Mouse diarsenic trioxide decreases expression ISO RGD:736625 6480464 Arsenic Trioxide results in decreased expression of PRPS1 protein CTD PMID:25419056 Prps1 Mouse diarsenic trioxide increases expression ISO RGD:736625 6480464 Arsenic Trioxide results in increased expression of PRPS1 mRNA CTD PMID:20458559 Prps1 Mouse dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PRPS1 mRNA CTD PMID:21266533 Prps1 Mouse dioxygen decreases expression ISO RGD:736625 6480464 Oxygen deficiency results in decreased expression of PRPS1 mRNA CTD PMID:25596134 Prps1 Mouse dorsomorphin multiple interactions ISO RGD:736625 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Prps1 Mouse doxorubicin decreases expression ISO RGD:736625 6480464 Doxorubicin results in decreased expression of PRPS1 mRNA CTD PMID:29803840 Prps1 Mouse enzyme inhibitor multiple interactions ISO RGD:736625 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Prps1 Mouse ethanol decreases expression ISO RGD:61955 6480464 Ethanol results in decreased expression of PRPS1 protein CTD PMID:19609968 Prps1 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of PRPS1 mRNA CTD PMID:30319688 Prps1 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of PRPS1 mRNA CTD PMID:30319688 Prps1 Mouse finasteride decreases expression ISO RGD:61955 6480464 Finasteride results in decreased expression of PRPS1 protein CTD PMID:27750143 Prps1 Mouse flutamide increases expression ISO RGD:61955 6480464 Flutamide results in increased expression of PRPS1 mRNA CTD PMID:24136188 Prps1 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of PRPS1 mRNA CTD PMID:25629700 Prps1 Mouse formaldehyde decreases expression ISO RGD:736625 6480464 Formaldehyde results in decreased expression of PRPS1 mRNA CTD PMID:23649840 Prps1 Mouse genistein multiple interactions ISO RGD:61955 6480464 [Diethylhexyl Phthalate co-treated with Genistein] results in increased expression of PRPS1 mRNA CTD PMID:25031359 Prps1 Mouse ivermectin decreases expression ISO RGD:736625 6480464 Ivermectin results in decreased expression of PRPS1 protein CTD PMID:32959892 Prps1 Mouse lead diacetate affects expression ISO RGD:61955 6480464 lead acetate affects the expression of PRPS1 mRNA CTD PMID:22641619 Prps1 Mouse methidathion decreases expression EXP 6480464 methidathion results in decreased expression of PRPS1 mRNA CTD PMID:34813904 Prps1 Mouse nefazodone increases expression ISO RGD:61955 6480464 nefazodone results in increased expression of PRPS1 mRNA CTD PMID:24136188 Prps1 Mouse nicotine increases splicing ISO RGD:736625 6480464 Nicotine results in increased splicing of PRPS1 mRNA alternative form CTD PMID:23825647 Prps1 Mouse nimesulide increases expression ISO RGD:61955 6480464 nimesulide results in increased expression of PRPS1 mRNA CTD PMID:24136188 Prps1 Mouse oxaliplatin multiple interactions ISO RGD:61955 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PRPS1 mRNA CTD PMID:25729387 Prps1 Mouse ozone multiple interactions ISO RGD:736625 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of PRPS1 mRNA CTD PMID:35430440 Prps1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of PRPS1 mRNA CTD PMID:17562736 Prps1 Mouse paracetamol decreases expression ISO RGD:736625 6480464 Acetaminophen results in decreased expression of PRPS1 mRNA CTD PMID:26690555 Prps1 Mouse paraquat increases expression ISO RGD:61955 6480464 Paraquat results in increased expression of PRPS1 mRNA CTD PMID:32680482 Prps1 Mouse phenobarbital increases expression ISO RGD:61955 6480464 Phenobarbital results in increased expression of PRPS1 mRNA CTD PMID:19162173 Prps1 Mouse phenylmercury acetate decreases expression ISO RGD:736625 6480464 Phenylmercuric Acetate results in decreased expression of PRPS1 mRNA CTD PMID:26272509 Prps1 Mouse phenylmercury acetate multiple interactions ISO RGD:736625 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Prps1 Mouse pirinixic acid increases expression ISO RGD:61955 6480464 pirinixic acid results in increased expression of PRPS1 mRNA CTD PMID:19162173 Prps1 Mouse piroxicam decreases expression ISO RGD:736625 6480464 Piroxicam results in decreased expression of PRPS1 mRNA CTD PMID:21858171 Prps1 Mouse rimonabant affects expression EXP 6480464 Rimonabant affects the expression of PRPS1 mRNA CTD PMID:19030233 Prps1 Mouse rimonabant multiple interactions EXP 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of PRPS1 mRNA] CTD PMID:19030233 Prps1 Mouse SB 431542 multiple interactions ISO RGD:736625 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of PRPS1 more ... CTD PMID:27188386|PMID:37664457 Prps1 Mouse sodium arsenite increases expression ISO RGD:736625 6480464 sodium arsenite results in increased expression of PRPS1 mRNA CTD PMID:28595984 Prps1 Mouse sodium arsenite affects expression ISO RGD:736625 6480464 sodium arsenite affects the expression of PRPS1 mRNA CTD PMID:34032870 Prps1 Mouse sodium arsenite decreases expression ISO RGD:736625 6480464 sodium arsenite results in decreased expression of PRPS1 mRNA CTD PMID:38568856 Prps1 Mouse sodium arsenite decreases expression ISO RGD:61955 6480464 sodium arsenite results in decreased expression of PRPS1 protein CTD PMID:29459688 Prps1 Mouse sunitinib decreases expression ISO RGD:736625 6480464 Sunitinib results in decreased expression of PRPS1 mRNA CTD PMID:31533062 Prps1 Mouse tamibarotene affects expression ISO RGD:736625 6480464 tamibarotene affects the expression of PRPS1 mRNA CTD PMID:15498508 Prps1 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of PRPS1 mRNA CTD PMID:17555576 Prps1 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PRPS1 mRNA CTD PMID:27339419|PMID:31919559 Prps1 Mouse tetrachloromethane multiple interactions ISO RGD:61955 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PRPS1 mRNA] CTD PMID:31150632 Prps1 Mouse tetrachloromethane increases expression ISO RGD:61955 6480464 Carbon Tetrachloride results in increased expression of PRPS1 mRNA CTD PMID:31150632 Prps1 Mouse thapsigargin decreases expression ISO RGD:736625 6480464 Thapsigargin results in decreased expression of PRPS1 mRNA CTD PMID:22378314 Prps1 Mouse thapsigargin increases expression ISO RGD:61955 6480464 Thapsigargin results in increased expression of PRPS1 protein CTD PMID:35544339 Prps1 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of PRPS1 gene CTD PMID:35295148 Prps1 Mouse topotecan multiple interactions ISO RGD:61955 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PRPS1 mRNA CTD PMID:25729387 Prps1 Mouse trimellitic anhydride increases expression EXP 6480464 trimellitic anhydride results in increased expression of PRPS1 mRNA CTD PMID:19042947 Prps1 Mouse tunicamycin decreases expression ISO RGD:736625 6480464 Tunicamycin results in decreased expression of PRPS1 mRNA CTD PMID:22378314 Prps1 Mouse urethane decreases expression ISO RGD:736625 6480464 Urethane results in decreased expression of PRPS1 mRNA CTD PMID:28818685 Prps1 Mouse valdecoxib increases expression ISO RGD:61955 6480464 valdecoxib results in increased expression of PRPS1 mRNA CTD PMID:24136188 Prps1 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of PRPS1 mRNA CTD PMID:17292431 Prps1 Mouse valproic acid increases expression ISO RGD:736625 6480464 Valproic Acid results in increased expression of PRPS1 mRNA CTD PMID:23179753 Prps1 Mouse valproic acid affects expression ISO RGD:736625 6480464 Valproic Acid affects the expression of PRPS1 mRNA CTD PMID:25979313
Imported Annotations - KEGG (archival)
(+)-schisandrin B (ISO) (S)-nicotine (ISO) (Z)-3-butylidenephthalide (ISO) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3-methylcholanthrene (ISO) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (EXP) 5-fluorouracil (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (ISO) bisphenol AF (ISO) Bisphenol B (ISO) butan-1-ol (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) cannabidiol (ISO) chloroacetaldehyde (ISO) cidofovir anhydrous (ISO) clofibrate (EXP) copper atom (ISO) copper(0) (ISO) cyclosporin A (ISO) DDE (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) ethanol (EXP,ISO) finasteride (ISO) flutamide (ISO) folic acid (EXP) formaldehyde (ISO) genistein (ISO) ivermectin (ISO) lead diacetate (ISO) methidathion (EXP) nefazodone (ISO) nicotine (ISO) nimesulide (ISO) oxaliplatin (ISO) ozone (ISO) paracetamol (EXP,ISO) paraquat (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) piroxicam (ISO) rimonabant (EXP) SB 431542 (ISO) sodium arsenite (ISO) sunitinib (ISO) tamibarotene (ISO) tamoxifen (EXP) tetrachloromethane (EXP,ISO) thapsigargin (ISO) titanium dioxide (EXP) topotecan (ISO) trimellitic anhydride (EXP) tunicamycin (ISO) urethane (ISO) valdecoxib (ISO) valproic acid (EXP,ISO)
1.
Expanding the phenotype of PRPS1 syndromes in females: neuropathy, hearing loss and retinopathy.
Almoguera B, etal., Orphanet J Rare Dis. 2014 Dec 10;9:190. doi: 10.1186/s13023-014-0190-9.
2.
The genetic and functional basis of purine nucleotide feedback-resistant phosphoribosylpyrophosphate synthetase superactivity.
Becker MA, etal., J Clin Invest. 1995 Nov;96(5):2133-41.
3.
Pediatric neurological syndromes and inborn errors of purine metabolism.
Camici M, etal., Neurochem Int. 2010 Feb;56(3):367-78. Epub 2009 Dec 11.
4.
Mutations in PRPS1 causing syndromic or nonsyndromic hearing impairment: intrafamilial phenotypic variation complicates genetic counseling.
Gandia M, etal., Pediatr Res. 2015 Jul;78(1):97-102. doi: 10.1038/pr.2015.56. Epub 2015 Mar 18.
5.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
6.
Large-scale cDNA analysis reveals phased gene expression patterns during preimplantation mouse development.
Ko MS, etal., Development 2000 Apr;127(8):1737-49.
7.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
8.
MGDs mouse GO annotations
MGD data from the GO Consortium
9.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
10.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Prps1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 139,357,352 - 139,376,889 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 139,357,362 - 139,376,889 (+) Ensembl GRCm39 Ensembl GRCm38 X 140,456,603 - 140,476,140 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 140,456,613 - 140,476,140 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 136,991,142 - 137,010,679 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 135,802,977 - 135,822,503 (+) NCBI MGSCv36 mm8 Celera X 123,716,011 - 123,735,469 (+) NCBI Celera Cytogenetic Map X F1 NCBI cM Map X 61.35 NCBI
PRPS1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 107,628,510 - 107,651,026 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 107,628,428 - 107,651,993 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 106,871,740 - 106,894,256 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 106,758,415 - 106,780,912 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 106,677,903 - 106,700,400 NCBI Celera X 107,343,160 - 107,365,584 (+) NCBI Celera Cytogenetic Map X q22.3 NCBI HuRef X 96,496,454 - 96,518,960 (+) NCBI HuRef CHM1_1 X 106,782,575 - 106,805,177 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 106,065,274 - 106,087,791 (+) NCBI T2T-CHM13v2.0
Prps1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 108,920,663 - 108,942,713 (+) NCBI GRCr8 mRatBN7.2 X 104,132,139 - 104,154,191 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 104,132,141 - 104,154,187 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 106,261,498 - 106,283,545 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 109,760,234 - 109,782,281 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 107,316,203 - 107,337,428 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 111,798,233 - 111,820,270 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 111,798,233 - 111,820,266 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 52,779,462 - 52,801,499 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 128,249,843 - 128,271,893 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 128,323,278 - 128,345,324 (+) NCBI Celera 3 43,777,612 - 43,799,661 (-) NCBI Celera Cytogenetic Map X q32 NCBI
Prps1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955490 8,303,775 - 8,330,713 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955490 8,303,775 - 8,330,713 (-) NCBI ChiLan1.0 ChiLan1.0
PRPS1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 107,104,116 - 107,126,928 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 107,107,719 - 107,130,532 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 96,720,988 - 96,743,594 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 107,094,898 - 107,117,117 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 107,094,898 - 107,117,117 (+) Ensembl panpan1.1 panPan2
PRPS1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 81,150,537 - 81,171,521 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 81,150,536 - 81,212,689 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 67,269,356 - 67,290,346 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 82,796,457 - 82,817,447 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 82,796,456 - 82,817,446 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 80,256,666 - 80,277,657 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 81,968,332 - 81,989,524 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 81,759,859 - 81,781,048 (+) NCBI UU_Cfam_GSD_1.0
Prps1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 80,521,497 - 80,543,124 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936499 7,115,780 - 7,136,449 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936499 7,114,838 - 7,136,468 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRPS1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 88,074,965 - 88,101,910 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 88,074,861 - 88,101,925 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 102,515,177 - 102,542,941 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRPS1 (Chlorocebus sabaeus - green monkey)
.
Predicted Target Of
Count of predictions: 503 Count of miRNA genes: 352 Interacting mature miRNAs: 405 Transcripts: ENSMUST00000033809, ENSMUST00000155235 Prediction methods: Microtar, Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
13208552 Wght12_m weight 12 (mouse) X 94043606 149782996 Mouse 1558900 Bw3_m body weight QTL 3 (mouse) Not determined X 133540040 165298595 Mouse 13208556 Lgth14_m body length 14 (mouse) X 94043606 149782996 Mouse 13824980 Ferq1_m genetic fertility QTL 1 (mouse) X 54045360 148782996 Mouse 25314309 Syncl5_m synaptonemal complex length 5 (mouse) X 121909697 152582996 Mouse 13824981 Svwq2_m seminal vesicle weight QTL 2 (mouse) X 128900749 153782996 Mouse 1301209 Cia19_m collagen induced arthritis 19 (mouse) Not determined X 120993165 160213038 Mouse 10412164 Cmv2_m cytomegalovirus resistance 2 (mouse) Not determined X 125685149 159685269 Mouse 1357823 Spha3_m sperm head anomaly 3 (mouse) Not determined X 102055848 162758941 Mouse 1357433 Dbts2_m diabetes 2 (mouse) Not determined X 7226295 150107038 Mouse 1301276 Tswt_m testis weight (mouse) Not determined X 138376411 150789338 Mouse
RH125998
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 X 140,475,893 - 140,476,111 UniSTS GRCm38 MGSCv37 X 137,010,432 - 137,010,650 UniSTS GRCm37 Celera X 123,735,222 - 123,735,440 UniSTS Cytogenetic Map X F1-F2 UniSTS Whitehead/MRC_RH X 1622.44 UniSTS
RH126017
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 X 140,473,802 - 140,475,280 UniSTS GRCm38 MGSCv37 X 137,008,341 - 137,009,819 UniSTS GRCm37 Celera X 123,733,131 - 123,734,609 UniSTS Cytogenetic Map X F1-F2 UniSTS Whitehead/MRC_RH 12 579.93 UniSTS
PPP6C
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 X 140,473,868 - 140,475,259 UniSTS GRCm38 MGSCv37 X 137,008,407 - 137,009,798 UniSTS GRCm37 Celera X 123,733,197 - 123,734,588 UniSTS Cytogenetic Map X F1-F2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000033809 ⟹ ENSMUSP00000033809
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 139,357,362 - 139,376,889 (+) Ensembl GRCm38.p6 Ensembl X 140,456,613 - 140,476,140 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000155235
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 139,357,362 - 139,366,191 (+) Ensembl GRCm38.p6 Ensembl X 140,456,613 - 140,465,442 (+) Ensembl
RefSeq Acc Id:
NM_021463 ⟹ NP_067438
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 139,357,352 - 139,376,889 (+) NCBI GRCm38 X 140,456,603 - 140,476,140 (+) ENTREZGENE MGSCv37 X 136,991,142 - 137,010,679 (+) RGD Celera X 123,716,011 - 123,735,469 (+) RGD cM Map X ENTREZGENE
Sequence:
GCCGCGCGCTGGGCGGGAATGTAAGATGGCGGAGTAGCAACGCGGTACTGTTGGTGTTCAGACTGCCTGCTGACTTCCGTTCCCGTGTTGGCAGCGGCGGCGGCGGCGACCACTGAGCACGTTGAGGT AGTTACCCAAGATGCCGAATATCAAAATCTTCAGCGGGAGCTCCCACCAGGACTTATCCCAGAAAATCGCTGACCGCCTGGGCCTTGAGCTAGGCAAGGTGGTGACTAAGAAATTCAGCAACCAGGAG ACCTGTGTGGAAATTGGCGAAAGCGTTCGTGGAGAAGATGTCTACATTGTTCAAAGTGGGTGTGGTGAGATAAATGACAATCTAATGGAGCTTTTGATCATGATTAATGCTTGTAAGATCGCTTCAGC CAGCCGGGTTACTGCAGTCATCCCATGCTTCCCTTACGCCCGCCAAGATAAGAAGGATAAGAGCCGGGCTCCAATCTCAGCTAAGCTTGTTGCAAATATGCTATCTGTAGCAGGTGCAGATCATATTA TCACCATGGATCTACATGCATCTCAAATTCAGGGTTTCTTTGATATCCCGGTGGACAATTTATATGCAGAGCCAGCTGTCCTAAAGTGGATACGGGAGAATATATCTGAGTGGAGAAACTGTACTATT GTCTCACCTGATGCTGGTGGAGCCAAAAGAGTGACCTCCATTGCAGACCGGCTGAATGTGGATTTTGCTTTGATTCACAAGGAACGGAAGAAGGCCAATGAAGTGGACCGCATGGTACTTGTGGGAGA TGTGAAGGACCGTGTGGCTATACTTGTGGATGACATGGCTGACACTTGCGGTACAATCTGTCACGCCGCTGACAAACTTCTCTCAGCTGGCGCTACCAGAGTTTATGCTATCTTGACGCATGGAATCT TTTCTGGCCCTGCCATTTCTCGAATCAACAATGCATGCTTTGAAGCAGTAGTAGTTACCAATACCATACCTCAGGAGGACAAGATGAAACACTGCTCCAAGATACAGGTGATTGACATCTCTATGATC CTTGCAGAAGCCATCAGGAGAACCCACAATGGAGAATCTGTCTCCTACTTGTTCAGCCATGTTCCTTTATAACATAACTTCTGAAGCATTTTGAAAATAAACCAACCCCACCCCTTGTTTTTCTTGGT ATTGGTGAGTTGAGCAGAAGACCCAGCTTGCTTCAGTATAGCTTTTTCCATCTCACATTAGCTATATTACCATTTGTCCTAAATGGGAGAAAGACAGATTGCTATTAGCTGCTAGGATGTTCAACCTG CATTGTTGTATCCTGGCTTTCTTGTTTATTTTGTGAACCTTGCAGCTTTAAGTTGAGCTCAGCTCTTGAAAGGTGTATAGACTGTTAAGAGAGTATTCCACAAGGTCCTTAGGACGTGATTGGCAAAG CTCATACTCCATTGCATGTGAACGCTTTGGGGTTTTCGTCATTCAGAATAACTAGCAACAAAGCCAGCCCATGTGTAATACATTTTCAGAGGTCTGCAGCAAGAACCCTGAGCATCCTTAAACATAGT TGAGCATCCTGTAAGGCAGGGGCAGGTAGCTCAATGCAGTAATTAGGTTTTGGGAGGAAGAAGCCTGATCCATTGCTATTTAACTCTTCTCTATCTCGCTTGGATTCTCTACACCTATTCCTTTCCAG TTGGCTTTACCTTTAGCTATTGTGACCCTTTCCTGGCCAAATATCTTGGACTCAGTGATCATTGTAACAATATCTTCGGTAATACAGACTTGCTTCTTGCTATGTAACTGCTAACATTCACATTAGGT AACTTGCTGTAGCACGACCTTCCTTAGCCTACTACCTCTGAGGTGGTGGGTTTAGGTGGTGTCGCAGTGCCTTTTGATTAATTTAAGTATTTAATTTTTATCTTCCTTGGATCCGTTTGGCCTCTCAA TTGAACTTACTGTATTGTGTAGAAGAAACTTAATAAAATGTCTGTCATGTGTGCAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_067438 ⟸ NM_021463
- UniProtKB:
Q76MX9 (UniProtKB/Swiss-Prot), Q9D7G0 (UniProtKB/Swiss-Prot), Q3TI27 (UniProtKB/TrEMBL), Q3UPD5 (UniProtKB/TrEMBL)
- Sequence:
MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMD LHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGP AISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL
hide sequence
Ensembl Acc Id:
ENSMUSP00000033809 ⟸ ENSMUST00000033809
RGD ID: 6846126
Promoter ID: MM_KWN:62072
Type: CpG-Island
SO ACC ID: SO:0000170
Source: MPROMDB
Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen
Transcripts: OTTMUST00000045356, OTTMUST00000045357
Position: Mouse Assembly Chr Position (strand) Source MGSCv36 X 136,990,919 - 136,991,419 (+) MPROMDB
RGD ID: 13681504
Promoter ID: EPDNEW_M24901
Type: multiple initiation site
Name: Prps1_1
Description: Mus musculus phosphoribosyl pyrophosphate synthetase 1 , mRNA.
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Mouse Assembly Chr Position (strand) Source GRCm38 X 140,456,625 - 140,456,685 EPDNEW