Symbol:
Timm9
Name:
translocase of inner mitochondrial membrane 9
RGD ID:
621656
Description:
Predicted to enable membrane insertase activity; protein homodimerization activity; and protein-folding chaperone binding activity. Predicted to be involved in protein insertion into mitochondrial inner membrane. Predicted to be located in mitochondrial inner membrane and mitochondrial intermembrane space. Predicted to be part of TIM22 mitochondrial import inner membrane insertion complex and mitochondrial intermembrane space protein transporter complex. Orthologous to human TIMM9 (translocase of inner mitochondrial membrane 9); PARTICIPATES IN beta-barrel pathway of mitochondrial protein import; carrier pathway of mitochondrial protein import; INTERACTS WITH 17beta-estradiol; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
mitochondrial import inner membrane translocase subunit Tim9; Tim9; Tim9a; Timm9a; translocase of inner mitochondrial membrane 9 homolog; translocase of inner mitochondrial membrane 9 homolog (yeast)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TIMM9 (translocase of inner mitochondrial membrane 9) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Timm9 (translocase of inner mitochondrial membrane 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Timm9 (translocase of inner mitochondrial membrane 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TIMM9 (translocase of inner mitochondrial membrane 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TIMM9 (translocase of inner mitochondrial membrane 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Timm9 (translocase of inner mitochondrial membrane 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TIMM9 (translocase of inner mitochondrial membrane 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TIMM9 (translocase of inner mitochondrial membrane 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Timm9 (translocase of inner mitochondrial membrane 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TIMM9 (translocase of inner mitochondrial membrane 9)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Timm9 (translocase of inner mitochondrial membrane 9)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
timm9 (translocase of inner mitochondrial membrane 9 homolog)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Tim9a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TIM9
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
tin-9.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
timm9
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 95,346,065 - 95,358,895 (-) NCBI GRCr8 mRatBN7.2 6 89,610,094 - 89,622,924 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 89,610,094 - 89,622,924 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 89,994,125 - 90,006,953 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 90,293,594 - 90,306,422 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 89,733,091 - 89,745,919 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 93,549,484 - 93,562,314 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 93,549,484 - 93,562,314 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 103,015,072 - 103,027,963 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 93,218,517 - 93,231,326 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 93,221,978 - 93,222,488 (-) NCBI Celera 6 88,094,219 - 88,107,044 (-) NCBI Celera Cytogenetic Map 6 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Timm9 Rat 1,2-dichloroethane decreases expression ISO RGD:1623256 6480464 ethylene dichloride results in decreased expression of TIMM9 mRNA CTD PMID:28960355 Timm9 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of TIMM9 mRNA CTD PMID:32145629 Timm9 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1623256 6480464 Tetrachlorodibenzodioxin affects the expression of TIMM9 mRNA CTD PMID:21570461 Timm9 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of TIMM9 mRNA CTD PMID:21346803 Timm9 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of TIMM9 mRNA CTD PMID:21346803 Timm9 Rat 2-methylcholine affects expression ISO RGD:1352655 6480464 beta-methylcholine affects the expression of TIMM9 mRNA CTD PMID:21179406 Timm9 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1352655 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Timm9 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1623256 6480464 bisphenol S results in increased expression of TIMM9 mRNA CTD PMID:39298647 Timm9 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Timm9 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2,6-dinitrotoluene affects the expression of TIMM9 mRNA CTD PMID:21346803 Timm9 Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1623256 6480464 Fenretinide results in increased expression of TIMM9 mRNA CTD PMID:28973697 Timm9 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of TIMM9 mRNA CTD PMID:31881176 Timm9 Rat all-trans-retinoic acid decreases expression ISO RGD:1352655 6480464 Tretinoin results in decreased expression of TIMM9 mRNA CTD PMID:33167477 Timm9 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TIMM9 mRNA CTD PMID:16483693 Timm9 Rat aristolochic acid A decreases expression ISO RGD:1352655 6480464 aristolochic acid I results in decreased expression of TIMM9 mRNA CTD PMID:33212167 Timm9 Rat beauvericin multiple interactions ISO RGD:1352655 6480464 [beauvericin co-treated with enniatins] results in decreased expression of TIMM9 protein CTD PMID:32407736 Timm9 Rat benzo[a]pyrene increases expression ISO RGD:1623256 6480464 Benzo(a)pyrene results in increased expression of TIMM9 mRNA CTD PMID:22228805 Timm9 Rat benzo[a]pyrene increases methylation ISO RGD:1352655 6480464 Benzo(a)pyrene results in increased methylation of TIMM9 5' UTR CTD PMID:27901495 Timm9 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1352655 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of TIMM9 mRNA CTD PMID:19150397|PMID:20382639 Timm9 Rat beta-lapachone increases expression ISO RGD:1352655 6480464 beta-lapachone results in increased expression of TIMM9 mRNA CTD PMID:38218311 Timm9 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1623256 6480464 Diethylhexyl Phthalate results in decreased expression of TIMM9 mRNA CTD PMID:19850644 Timm9 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:1623256 6480464 PPARA protein inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of TIMM9 mRNA] CTD PMID:19850644 Timm9 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TIMM9 mRNA CTD PMID:25181051|PMID:30816183|PMID:34947998 Timm9 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Timm9 Rat bisphenol A increases expression ISO RGD:1623256 6480464 bisphenol A results in increased expression of TIMM9 mRNA CTD PMID:33221593 Timm9 Rat bisphenol A increases expression ISO RGD:1352655 6480464 bisphenol A results in increased expression of TIMM9 protein CTD PMID:37567409 Timm9 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TIMM9 mRNA CTD PMID:32145629 Timm9 Rat bisphenol A affects expression ISO RGD:1352655 6480464 bisphenol A affects the expression of TIMM9 mRNA CTD PMID:30903817 Timm9 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of TIMM9 gene CTD PMID:28505145 Timm9 Rat bisphenol F multiple interactions ISO RGD:1352655 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Timm9 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Timm9 Rat bisphenol F decreases expression ISO RGD:1623256 6480464 bisphenol F results in decreased expression of TIMM9 mRNA CTD PMID:38685157 Timm9 Rat Brodifacoum decreases expression EXP 6480464 bromfenacoum results in decreased expression of TIMM9 protein CTD PMID:28903499 Timm9 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of TIMM9 mRNA CTD PMID:33453195 Timm9 Rat cadmium dichloride decreases expression ISO RGD:1352655 6480464 Cadmium Chloride results in decreased expression of TIMM9 mRNA CTD PMID:38568856 Timm9 Rat cannabidiol increases expression ISO RGD:1352655 6480464 Cannabidiol results in increased expression of TIMM9 mRNA CTD PMID:27714895 Timm9 Rat carbon nanotube increases expression ISO RGD:1623256 6480464 Nanotubes, Carbon analog results in increased expression of TIMM9 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681|PMID:25620056 Timm9 Rat choline multiple interactions ISO RGD:1623256 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Timm9 Rat chromium(6+) affects expression ISO RGD:1623256 6480464 chromium hexavalent ion affects the expression of TIMM9 mRNA CTD PMID:28472532 Timm9 Rat ciguatoxin CTX1B affects expression ISO RGD:1623256 6480464 Ciguatoxins affects the expression of TIMM9 mRNA CTD PMID:18353800 Timm9 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of TIMM9 mRNA CTD PMID:17602206 Timm9 Rat copper(II) sulfate decreases expression ISO RGD:1352655 6480464 Copper Sulfate results in decreased expression of TIMM9 mRNA CTD PMID:19549813 Timm9 Rat cyclosporin A increases expression ISO RGD:1352655 6480464 Cyclosporine results in increased expression of TIMM9 mRNA CTD PMID:20106945|PMID:25562108|PMID:27989131 Timm9 Rat cyclosporin A increases methylation ISO RGD:1352655 6480464 Cyclosporine results in increased methylation of TIMM9 promoter CTD PMID:27989131 Timm9 Rat DDE increases expression ISO RGD:1352655 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of TIMM9 mRNA CTD PMID:38568856 Timm9 Rat dexamethasone multiple interactions ISO RGD:1352655 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Timm9 Rat disodium selenite increases expression ISO RGD:1352655 6480464 Sodium Selenite results in increased expression of TIMM9 mRNA CTD PMID:18175754 Timm9 Rat doxorubicin decreases expression ISO RGD:1352655 6480464 Doxorubicin results in decreased expression of TIMM9 mRNA CTD PMID:29803840 Timm9 Rat elemental selenium decreases expression ISO RGD:1352655 6480464 Selenium results in decreased expression of TIMM9 mRNA CTD PMID:19244175 Timm9 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of TIMM9 mRNA CTD PMID:29391264 Timm9 Rat enniatin multiple interactions ISO RGD:1352655 6480464 [beauvericin co-treated with enniatins] results in decreased expression of TIMM9 protein CTD PMID:32407736 Timm9 Rat epoxiconazole increases expression ISO RGD:1623256 6480464 epoxiconazole results in increased expression of TIMM9 mRNA CTD PMID:35436446 Timm9 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of TIMM9 mRNA CTD PMID:24136188 Timm9 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of TIMM9 mRNA CTD PMID:24136188 Timm9 Rat folic acid multiple interactions ISO RGD:1623256 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Timm9 Rat genistein increases expression ISO RGD:1623256 6480464 Genistein results in increased expression of TIMM9 mRNA CTD PMID:32186404 Timm9 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of TIMM9 mRNA CTD PMID:21396975 Timm9 Rat indometacin multiple interactions ISO RGD:1352655 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Timm9 Rat ivermectin decreases expression ISO RGD:1352655 6480464 Ivermectin results in decreased expression of TIMM9 protein CTD PMID:32959892 Timm9 Rat L-methionine multiple interactions ISO RGD:1623256 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Timm9 Rat menadione affects expression ISO RGD:1352655 6480464 Vitamin K 3 affects the expression of TIMM9 mRNA CTD PMID:20044591 Timm9 Rat methidathion decreases expression ISO RGD:1623256 6480464 methidathion results in decreased expression of TIMM9 mRNA CTD PMID:34813904 Timm9 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of TIMM9 mRNA CTD PMID:17602206 Timm9 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of TIMM9 mRNA CTD PMID:24136188 Timm9 Rat okadaic acid decreases expression ISO RGD:1352655 6480464 Okadaic Acid results in decreased expression of TIMM9 mRNA CTD PMID:38832940 Timm9 Rat ozone multiple interactions ISO RGD:1623256 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Timm9 Rat paracetamol affects expression ISO RGD:1623256 6480464 Acetaminophen affects the expression of TIMM9 mRNA CTD PMID:17562736 Timm9 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TIMM9 mRNA CTD PMID:32479839 Timm9 Rat paracetamol decreases expression ISO RGD:1352655 6480464 Acetaminophen results in decreased expression of TIMM9 mRNA CTD PMID:25704631 Timm9 Rat paracetamol affects response to substance ISO RGD:1352655 6480464 TIMM9 gene polymorphism affects the susceptibility to Acetaminophen CTD PMID:26104854 Timm9 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of TIMM9 mRNA CTD PMID:32680482 Timm9 Rat perfluorononanoic acid increases expression ISO RGD:1352655 6480464 perfluoro-n-nonanoic acid results in increased expression of TIMM9 mRNA CTD PMID:32588087 Timm9 Rat perfluorooctanoic acid increases expression ISO RGD:1352655 6480464 perfluorooctanoic acid results in increased expression of TIMM9 protein CTD PMID:26879310 Timm9 Rat pirinixic acid multiple interactions ISO RGD:1623256 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Timm9 Rat pirinixic acid increases expression ISO RGD:1623256 6480464 pirinixic acid results in increased expression of TIMM9 mRNA CTD PMID:18301758|PMID:23811191 Timm9 Rat pirinixic acid decreases expression ISO RGD:1623256 6480464 pirinixic acid results in decreased expression of TIMM9 mRNA CTD PMID:18445702 Timm9 Rat potassium dichromate decreases expression ISO RGD:1352655 6480464 Potassium Dichromate results in decreased expression of TIMM9 protein CTD PMID:23718831 Timm9 Rat pregnenolone 16alpha-carbonitrile increases expression ISO RGD:1623256 6480464 Pregnenolone Carbonitrile results in increased expression of TIMM9 mRNA CTD PMID:28903501 Timm9 Rat resveratrol multiple interactions ISO RGD:1352655 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of TIMM9 mRNA CTD PMID:23557933 Timm9 Rat selenium atom decreases expression ISO RGD:1352655 6480464 Selenium results in decreased expression of TIMM9 mRNA CTD PMID:19244175 Timm9 Rat silicon dioxide decreases expression ISO RGD:1623256 6480464 Silicon Dioxide results in decreased expression of TIMM9 mRNA CTD PMID:19073995 Timm9 Rat silver atom affects expression ISO RGD:1623256 6480464 Silver affects the expression of TIMM9 mRNA CTD PMID:27131904 Timm9 Rat silver(0) affects expression ISO RGD:1623256 6480464 Silver affects the expression of TIMM9 mRNA CTD PMID:27131904 Timm9 Rat sodium arsenite decreases expression ISO RGD:1352655 6480464 sodium arsenite results in decreased expression of TIMM9 mRNA CTD PMID:38568856 Timm9 Rat succimer multiple interactions ISO RGD:1623256 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of TIMM9 mRNA; [Succimer co-treated more ... CTD PMID:21641980|PMID:26378955 Timm9 Rat sunitinib increases expression ISO RGD:1352655 6480464 Sunitinib results in increased expression of TIMM9 mRNA CTD PMID:31533062 Timm9 Rat tert-butyl hydroperoxide increases expression ISO RGD:1352655 6480464 tert-Butylhydroperoxide results in increased expression of TIMM9 mRNA CTD PMID:15336504 Timm9 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of TIMM9 mRNA CTD PMID:31150632 Timm9 Rat thapsigargin increases expression ISO RGD:1352655 6480464 Thapsigargin results in increased expression of TIMM9 mRNA CTD PMID:22378314 Timm9 Rat titanium dioxide decreases methylation ISO RGD:1623256 6480464 titanium dioxide results in decreased methylation of TIMM9 gene CTD PMID:35295148 Timm9 Rat tungsten increases expression ISO RGD:1623256 6480464 Tungsten results in increased expression of TIMM9 mRNA CTD PMID:30912803 Timm9 Rat tunicamycin increases expression ISO RGD:1352655 6480464 Tunicamycin results in increased expression of TIMM9 mRNA CTD PMID:22378314|PMID:29453283 Timm9 Rat valproic acid increases expression ISO RGD:1352655 6480464 Valproic Acid results in increased expression of TIMM9 mRNA CTD PMID:29154799 Timm9 Rat valproic acid decreases methylation ISO RGD:1352655 6480464 Valproic Acid results in decreased methylation of TIMM9 gene CTD PMID:29154799
1,2-dichloroethane (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-methylcholine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxyphenyl retinamide (ISO) acetamide (EXP) all-trans-retinoic acid (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) beauvericin (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) Brodifacoum (EXP) cadmium dichloride (EXP,ISO) cannabidiol (ISO) carbon nanotube (ISO) choline (ISO) chromium(6+) (ISO) ciguatoxin CTX1B (ISO) clofibric acid (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) DDE (ISO) dexamethasone (ISO) disodium selenite (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) enniatin (ISO) epoxiconazole (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) genistein (ISO) indole-3-methanol (EXP) indometacin (ISO) ivermectin (ISO) L-methionine (ISO) menadione (ISO) methidathion (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP) okadaic acid (ISO) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP) perfluorononanoic acid (ISO) perfluorooctanoic acid (ISO) pirinixic acid (ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (ISO) resveratrol (ISO) selenium atom (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) succimer (ISO) sunitinib (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP) thapsigargin (ISO) titanium dioxide (ISO) tungsten (ISO) tunicamycin (ISO) valproic acid (ISO)
Timm9 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 95,346,065 - 95,358,895 (-) NCBI GRCr8 mRatBN7.2 6 89,610,094 - 89,622,924 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 89,610,094 - 89,622,924 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 89,994,125 - 90,006,953 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 90,293,594 - 90,306,422 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 89,733,091 - 89,745,919 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 93,549,484 - 93,562,314 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 93,549,484 - 93,562,314 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 103,015,072 - 103,027,963 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 93,218,517 - 93,231,326 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 93,221,978 - 93,222,488 (-) NCBI Celera 6 88,094,219 - 88,107,044 (-) NCBI Celera Cytogenetic Map 6 q24 NCBI
TIMM9 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 58,408,494 - 58,427,531 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 58,408,495 - 58,427,531 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 58,875,212 - 58,894,249 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 57,945,123 - 57,963,985 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 57,945,123 - 57,963,985 NCBI Celera 14 38,925,342 - 38,944,209 (-) NCBI Celera Cytogenetic Map 14 q23.1 NCBI HuRef 14 39,039,988 - 39,058,854 (-) NCBI HuRef CHM1_1 14 58,813,939 - 58,832,779 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 52,615,545 - 52,634,567 (-) NCBI T2T-CHM13v2.0
Timm9 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 71,169,946 - 71,183,476 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 71,169,947 - 71,183,458 (-) Ensembl GRCm39 Ensembl GRCm38 12 71,123,172 - 71,136,708 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 71,123,173 - 71,136,684 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 72,224,159 - 72,237,662 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 72,041,777 - 72,055,280 (-) NCBI MGSCv36 mm8 Celera 12 72,223,204 - 72,236,707 (-) NCBI Celera Cytogenetic Map 12 C2 NCBI cM Map 12 29.39 NCBI
Timm9 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955466 12,115,010 - 12,125,024 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955466 12,115,003 - 12,125,024 (-) NCBI ChiLan1.0 ChiLan1.0
TIMM9 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 59,530,271 - 59,549,211 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 58,746,785 - 58,765,725 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 39,000,431 - 39,019,381 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 57,268,137 - 57,287,134 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 57,268,137 - 57,287,014 (-) Ensembl panpan1.1 panPan2
TIMM9 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 33,755,514 - 33,772,183 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 33,755,960 - 33,757,980 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 21,462,801 - 21,463,070 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 33,516,797 - 33,533,459 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 33,996,953 - 34,013,637 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 33,996,951 - 34,012,223 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 33,609,476 - 33,626,113 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 33,677,599 - 33,694,250 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 34,051,958 - 34,068,609 (-) NCBI UU_Cfam_GSD_1.0
Timm9 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 71,392,479 - 71,405,674 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936495 2,786,019 - 2,799,635 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936495 2,786,019 - 2,799,575 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TIMM9
TIMM9
Timm9
.
Predicted Target Of
Count of predictions: 252 Count of miRNA genes: 171 Interacting mature miRNAs: 193 Transcripts: ENSRNOT00000010871 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 634330 Pia16 Pristane induced arthritis QTL 16 3.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 6 45790088 104200226 Rat 1331789 Rf37 Renal function QTL 37 3.224 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 72202632 115200186 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 70176 Mcsm1 Mammary carcinoma susceptibility modifier QTL 1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 58632962 103632962 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1558641 Cm47 Cardiac mass QTL 47 2.9 0.001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 6 57730540 104085867 Rat 724524 Uae2 Urinary albumin excretion QTL 2 2.7 0.0005 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 73463459 109394713 Rat 737827 Hcar11 Hepatocarcinoma resistance QTL 11 4.4 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 6 82523650 110548006 Rat 1641904 Alcrsp4 Alcohol response QTL 4 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 6 67262953 112262953 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 2293837 Kiddil1 Kidney dilation QTL 1 3.7 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 2293842 Kiddil3 Kidney dilation QTL 3 4.3 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 4889848 Pur25 Proteinuria QTL 25 14 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 56728562 90198260 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 70196 BpQTLcluster7 Blood pressure QTL cluster 7 6.82 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 72202632 117202632 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 1576302 Schws4 Schwannoma susceptibility QTL 4 0.0078 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 83190345 106747639 Rat 1300075 Glom7 Glomerulus QTL 7 5.6 0.0000002 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 6 71201409 116201409 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 12801471 Schws9 Schwannoma susceptibility QTL 9 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 61747639 106747639 Rat 6893332 Cm74 Cardiac mass QTL 74 0.4 0.64 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 57730540 104085867 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
RH141247
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 89,610,241 - 89,610,424 (+) MAPPER mRatBN7.2 Rnor_6.0 6 93,549,632 - 93,549,814 NCBI Rnor6.0 Rnor_5.0 6 103,015,220 - 103,015,402 UniSTS Rnor5.0 RGSC_v3.4 6 93,218,665 - 93,218,847 UniSTS RGSC3.4 Celera 6 88,094,367 - 88,094,549 UniSTS RH 3.4 Map 6 639.2 UniSTS Cytogenetic Map 6 q24 UniSTS
AI100846
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 89,618,252 - 89,618,435 (+) MAPPER mRatBN7.2 Rnor_6.0 6 93,557,643 - 93,557,825 NCBI Rnor6.0 Rnor_5.0 6 103,023,231 - 103,023,413 UniSTS Rnor5.0 RGSC_v3.4 6 93,226,676 - 93,226,858 UniSTS RGSC3.4 Celera 6 88,102,378 - 88,102,560 UniSTS RH 3.4 Map 6 640.3 UniSTS Cytogenetic Map 6 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010871 ⟹ ENSRNOP00000010871
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 89,610,094 - 89,622,924 (-) Ensembl Rnor_6.0 Ensembl 6 93,549,484 - 93,562,314 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000088790 ⟹ ENSRNOP00000071324
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 6 93,549,484 - 93,562,314 (-) Ensembl
RefSeq Acc Id:
NM_001276429 ⟹ NP_001263358
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 95,346,065 - 95,358,895 (-) NCBI mRatBN7.2 6 89,610,094 - 89,622,924 (-) NCBI Rnor_6.0 6 93,549,484 - 93,562,314 (-) NCBI Rnor_5.0 6 103,015,072 - 103,027,963 (-) NCBI Celera 6 88,094,219 - 88,107,044 (-) NCBI
Sequence:
ATCACTGCCCCCACGTGTTCTCCGCTATCTAGCGGCGCGGCGCTCTCTCGGTACTGACCCTCCGAGCTCGGACTCTACCTGCACTGCAGCCCTTCATCCCGGTACCAGTGTCAGATGCGAGATCCCGT
hide sequence
RefSeq Acc Id:
NM_001276430 ⟹ NP_001263359
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 95,346,065 - 95,358,895 (-) NCBI mRatBN7.2 6 89,610,094 - 89,622,924 (-) NCBI Rnor_6.0 6 93,549,484 - 93,562,314 (-) NCBI Rnor_5.0 6 103,015,072 - 103,027,963 (-) NCBI Celera 6 88,094,219 - 88,107,044 (-) NCBI
Sequence:
ATCACTGCCCCCACGTGTTCTCCGCTATCTAGCGGCGCGGCGCTCTCTCGGTACTGACCCTCCG
hide sequence
RefSeq Acc Id:
NM_133604 ⟹ NP_598288
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 95,346,065 - 95,358,895 (-) NCBI mRatBN7.2 6 89,610,094 - 89,622,924 (-) NCBI Rnor_6.0 6 93,549,484 - 93,562,314 (-) NCBI Rnor_5.0 6 103,015,072 - 103,027,963 (-) NCBI Celera 6 88,094,219 - 88,107,044 (-) NCBI
Sequence:
ATCACTGCCCCCACGTGTTCTCCGCTATCTAGCGGCGCGGCGCTCTCTCGGTACTGACCCTCCGAGCTCGGACTCTACCTGCACTGCAGCCCTTCATCCCGGTACCAGTGTCAGATGCGAGATCCCGT
hide sequence
RefSeq Acc Id:
NR_075101
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 95,346,065 - 95,358,895 (-) NCBI mRatBN7.2 6 89,610,094 - 89,622,924 (-) NCBI Rnor_6.0 6 93,549,484 - 93,562,314 (-) NCBI Rnor_5.0 6 103,015,072 - 103,027,963 (-) NCBI Celera 6 88,094,219 - 88,107,044 (-) NCBI
Sequence:
ATCACTGCCCCCACGTGTTCTCCGCTATCTAGCGGCGCGGCGCTCTCTCGGTACTGACCCTCCG
hide sequence
RefSeq Acc Id:
XM_039111743 ⟹ XP_038967671
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 95,346,067 - 95,358,631 (-) NCBI mRatBN7.2 6 89,610,096 - 89,622,660 (-) NCBI
RefSeq Acc Id:
XM_063261516 ⟹ XP_063117586
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 95,346,067 - 95,357,078 (-) NCBI
RefSeq Acc Id:
XM_063261517 ⟹ XP_063117587
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 95,346,067 - 95,358,884 (-) NCBI
RefSeq Acc Id:
NP_001263359 ⟸ NM_001276430
- UniProtKB:
Q9WV97 (UniProtKB/Swiss-Prot), A6HC17 (UniProtKB/TrEMBL)
- Sequence:
MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEEVTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
hide sequence
RefSeq Acc Id:
NP_598288 ⟸ NM_133604
- UniProtKB:
Q9WV97 (UniProtKB/Swiss-Prot), A6HC17 (UniProtKB/TrEMBL)
- Sequence:
MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEEVTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
hide sequence
RefSeq Acc Id:
NP_001263358 ⟸ NM_001276429
- UniProtKB:
Q9WV97 (UniProtKB/Swiss-Prot), A6HC17 (UniProtKB/TrEMBL)
- Sequence:
MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEEVTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
hide sequence
Ensembl Acc Id:
ENSRNOP00000010871 ⟸ ENSRNOT00000010871
Ensembl Acc Id:
ENSRNOP00000071324 ⟸ ENSRNOT00000088790
RefSeq Acc Id:
XP_038967671 ⟸ XM_039111743
- Peptide Label:
isoform X1
- UniProtKB:
Q9WV97 (UniProtKB/Swiss-Prot), A6HC17 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063117587 ⟸ XM_063261517
- Peptide Label:
isoform X1
- UniProtKB:
Q9WV97 (UniProtKB/Swiss-Prot), A6HC17 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063117586 ⟸ XM_063261516
- Peptide Label:
isoform X1
- UniProtKB:
Q9WV97 (UniProtKB/Swiss-Prot), A6HC17 (UniProtKB/TrEMBL)
RGD ID: 13694649 Promoter ID: EPDNEW_R5173 Type: multiple initiation site Name: Timm9_1 Description: translocase of inner mitochondrial membrane 9 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 93,562,302 - 93,562,362 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-08
Timm9
translocase of inner mitochondrial membrane 9
Timm9
translocase of inner mitochondrial membrane 9 homolog (yeast)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-07-08
Timm9
translocase of inner mitochondrial membrane 9 homolog (yeast)
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Timm9
translocase of inner mitochondrial membrane 9 homolog (yeast)
Symbol and Name status set to provisional
70820 PROVISIONAL
