Advanced Search (OLGA)

Gene: Kcnb2 (potassium voltage-gated channel subfamily B member 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Kcnb2 (Ensembl: AC125757.1)

Name:

potassium voltage-gated channel subfamily B member 2

RGD ID:

621349

Description:

Enables delayed rectifier potassium channel activity; protein heterodimerization activity; and transmembrane transporter binding activity. Involved in potassium ion transmembrane transport and protein localization to plasma membrane. Located in dendrite and neuronal cell body membrane. Part of voltage-gated potassium channel complex. Human ortholog(s) of this gene implicated in alcohol dependence. Orthologous to human KCNB2 (potassium voltage-gated channel subfamily B member 2); INTERACTS WITH 17beta-estradiol; 6-propyl-2-thiouracil; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CDRK; Kv2.2; potassium channel, voltage gated Shab-related subfamily B, member 2; potassium voltage gated channel, Shab-related subfamily, member 2; voltage-gated potassium channel subunit Kv2.2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Candidate Gene For:

Vetf3

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	8,340,085 - 8,811,184 (-)	NCBI		GRCr8
mRatBN7.2	5	3,567,012 - 4,028,564 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	3,569,685 - 4,028,599 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	5,686,237 - 6,146,556 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	7,325,121 - 7,785,453 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	7,023,712 - 7,485,422 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	2,975,934 - 3,430,837 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	5	2,965,248 - 3,418,192 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	2,683,952 - 3,154,913 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	2,683,951 - 3,154,908 (-)	NCBI
Celera	5	3,165,386 - 3,621,344 (-)	NCBI		Celera
Cytogenetic Map	5	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnb2	Rat	alcohol dependence		ISO	RGD:732631	405650603	associated with other drug dependencies; DNA:SNPs:CDS:intron (rs2251898)	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnb2	Rat	colorectal cancer		ISO	RGD:732631	8554872	ClinVar Annotator: match by term: Colorectal cancer	ClinVar

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnb2	Rat	17beta-estradiol	multiple interactions	ISO	RGD:732631	6480464	[Estradiol co-treated with TGFB1 protein] results in decreased expression of KCNB2 mRNA	CTD	PMID:30165855
Kcnb2	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[Testosterone co-treated with Estradiol] results in increased expression of KCNB2 mRNA	CTD	PMID:32741896
Kcnb2	Rat	2,4-dinitrobenzenesulfonic acid	multiple interactions	ISO	RGD:1614245	6480464	[2,4-dinitrobenzenesulfonic acid co-treated with GR 159897] results in increased expression of KCNB2 mRNA	CTD	PMID:30116771
Kcnb2	Rat	2,4-dinitrobenzenesulfonic acid	decreases expression	ISO	RGD:1614245	6480464	2,4-dinitrobenzenesulfonic acid results in decreased expression of KCNB2 mRNA	CTD	PMID:30116771
Kcnb2	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	RGD:1614245	6480464	bisphenol S results in decreased methylation of KCNB2 exon	CTD	PMID:33297965
Kcnb2	Rat	4-nonylphenol	multiple interactions	ISO	RGD:732631	6480464	[4-tert-octylphenol co-treated with 4-nonylphenol] results in increased expression of KCNB2 mRNA	CTD	PMID:23626723
Kcnb2	Rat	4-tert-Octylphenol	multiple interactions	ISO	RGD:732631	6480464	[4-tert-octylphenol co-treated with 4-nonylphenol] results in increased expression of KCNB2 mRNA	CTD	PMID:23626723
Kcnb2	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of KCNB2 mRNA	CTD	PMID:24780913
Kcnb2	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of KCNB2 mRNA	CTD	PMID:30047161
Kcnb2	Rat	acrylamide	affects expression	EXP		6480464	Acrylamide affects the expression of KCNB2 mRNA	CTD	PMID:28959563
Kcnb2	Rat	aflatoxin B1	decreases methylation	ISO	RGD:732631	6480464	Aflatoxin B1 results in decreased methylation of KCNB2 gene	CTD	PMID:27153756
Kcnb2	Rat	allethrin	multiple interactions	EXP		6480464	[cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in more ...	CTD	PMID:34896426
Kcnb2	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:732631	6480464	Benzo(a)pyrene affects the methylation of KCNB2 5' UTR	CTD	PMID:27901495
Kcnb2	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:732631	6480464	Benzo(a)pyrene results in increased methylation of KCNB2 exon; Benzo(a)pyrene results in increased methylation of KCNB2 more ...	CTD	PMID:27901495
Kcnb2	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:732631	6480464	[Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of KCNB2 more ...	CTD	PMID:33872906
Kcnb2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of KCNB2 mRNA	CTD	PMID:25181051\|PMID:30816183\|PMID:32528016\|PMID:34947998
Kcnb2	Rat	bisphenol A	decreases methylation	ISO	RGD:732631	6480464	bisphenol A results in decreased methylation of KCNB2 gene	CTD	PMID:31601247
Kcnb2	Rat	bisphenol A	decreases expression	ISO	RGD:1614245	6480464	bisphenol A results in decreased expression of KCNB2 mRNA	CTD	PMID:31250031
Kcnb2	Rat	bisphenol A	multiple interactions	ISO	RGD:1614245	6480464	ESR2 protein affects the reaction [bisphenol A results in decreased expression of KCNB2 mRNA]	CTD	PMID:31250031
Kcnb2	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of KCNB2 gene	CTD	PMID:28505145
Kcnb2	Rat	cyhalothrin	multiple interactions	EXP		6480464	[cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in more ...	CTD	PMID:34896426
Kcnb2	Rat	cypermethrin	multiple interactions	EXP		6480464	[cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in more ...	CTD	PMID:34896426
Kcnb2	Rat	fenvalerate	multiple interactions	EXP		6480464	[cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in more ...	CTD	PMID:34896426
Kcnb2	Rat	lidocaine	decreases expression	EXP		6480464	Lidocaine results in decreased expression of KCNB2 mRNA	CTD	PMID:35283115
Kcnb2	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of KCNB2 gene	CTD	PMID:35440735
Kcnb2	Rat	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:732631	6480464	[Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of KCNB2 more ...	CTD	PMID:33872906
Kcnb2	Rat	p-tert-Amylphenol	multiple interactions	ISO	RGD:732631	6480464	[4-tert-octylphenol co-treated with 4-nonylphenol] results in increased expression of KCNB2 mRNA	CTD	PMID:23626723
Kcnb2	Rat	paraquat	affects expression	EXP		6480464	Paraquat affects the expression of KCNB2 mRNA	CTD	PMID:15206577
Kcnb2	Rat	pyrethrins	decreases expression	EXP		6480464	Pyrethrins results in decreased expression of KCNB2 protein	CTD	PMID:34896426
Kcnb2	Rat	serpentine asbestos	increases methylation	ISO	RGD:732631	6480464	Asbestos, Serpentine results in increased methylation of KCNB2 gene	CTD	PMID:29523930
Kcnb2	Rat	sodium arsenite	affects methylation	ISO	RGD:732631	6480464	sodium arsenite affects the methylation of KCNB2 gene	CTD	PMID:28589171
Kcnb2	Rat	sodium arsenite	increases expression	ISO	RGD:1614245	6480464	sodium arsenite results in increased expression of KCNB2 mRNA	CTD	PMID:37682722
Kcnb2	Rat	sodium arsenite	decreases expression	ISO	RGD:1614245	6480464	sodium arsenite results in decreased expression of KCNB2 mRNA	CTD	PMID:36209798
Kcnb2	Rat	sodium arsenite	decreases expression	ISO	RGD:732631	6480464	sodium arsenite results in decreased expression of KCNB2 mRNA	CTD	PMID:34032870
Kcnb2	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of KCNB2 mRNA	CTD	PMID:30047161
Kcnb2	Rat	tert-butyl hydroperoxide	decreases expression	ISO	RGD:732631	6480464	tert-Butylhydroperoxide results in decreased expression of KCNB2 mRNA	CTD	PMID:15336504
Kcnb2	Rat	testosterone	multiple interactions	EXP		6480464	[Testosterone co-treated with Estradiol] results in increased expression of KCNB2 mRNA	CTD	PMID:32741896
Kcnb2	Rat	thimerosal	increases expression	ISO	RGD:1614245	6480464	Thimerosal results in increased expression of KCNB2 mRNA	CTD	PMID:24675092

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnb2	Rat	action potential	involved_in	IBA	FB:FBgn0003380\|FB:FBgn0262593\|MGI:102663\|MGI:108083\|MGI:1336181\|MGI:96654\|MGI:96668\|PANTHER:PTN000164970\|RGD:2949\|RGD:2950\|RGD:2954\|RGD:68393\|UniProtKB:P22460\|UniProtKB:P51787\|UniProtKB:Q09470\|UniProtKB:Q14721\|UniProtKB:Q9NZV8\|ZFIN:ZDB-GENE-061214-5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnb2	Rat	monoatomic ion transmembrane transport	involved_in	IEA	UniProtKB-KW:KW-0407\|UniProtKB-KW:KW-0851	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnb2	Rat	monoatomic ion transport	involved_in	IEA	UniProtKB-KW:KW-0406	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnb2	Rat	monoatomic ion transport	involved_in	IEA	InterPro:IPR005821	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kcnb2	Rat	potassium ion transmembrane transport	involved_in	IDA		10047337	PMID:20202934	UniProt
Kcnb2	Rat	potassium ion transmembrane transport	involved_in	IBA	MGI:102663\|MGI:108083\|MGI:1336181\|MGI:96654\|MGI:96659\|MGI:96666\|PANTHER:PTN000164970\|RGD:2949\|RGD:2950\|RGD:2951\|RGD:2952\|RGD:2953\|RGD:2954\|RGD:2955\|RGD:62083\|RGD:621349\|RGD:628829\|RGD:68393\|RGD:68394\|RGD:69222\|UniProtKB:O43526\|UniProtKB:P16389\|UniProtKB:P17658\|UniProtKB:P22459\|UniProtKB:P22460\|UniProtKB:P51787\|UniProtKB:Q09470\|UniProtKB:Q14003\|UniProtKB:Q14721\|UniProtKB:Q8I5E6\|UniProtKB:Q9NZV8\|UniProtKB:Q9UK17\|WB:WBGene00001374\|WB:WBGene00014261	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnb2	Rat	potassium ion transmembrane transport	involved_in	IEA	UniProtKB-KW:KW-0631	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnb2	Rat	potassium ion transport	involved_in	IDA		737625	PMID:9305895	UniProt
Kcnb2	Rat	potassium ion transport	involved_in	IEA	UniProtKB-KW:KW-0633	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnb2	Rat	potassium ion transport	involved_in	IEA	InterPro:IPR003968\|InterPro:IPR003973\|InterPro:IPR005826\|InterPro:IPR028325	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kcnb2	Rat	protein homooligomerization	involved_in	IEA	InterPro:IPR003131	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kcnb2	Rat	protein localization to plasma membrane	involved_in	IDA		737625	PMID:9305895	UniProt
Kcnb2	Rat	transmembrane transport	involved_in	IEA	InterPro:IPR005821	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnb2	Rat	cell projection	located_in	IEA	UniProtKB-KW:KW-0966	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnb2	Rat	dendrite	located_in	IDA		10047337	PMID:20202934	UniProt
Kcnb2	Rat	dendrite	is_active_in	IBA	PANTHER:PTN002610264\|RGD:621349	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnb2	Rat	dendrite	located_in	IEA	UniProtKB-SubCell:SL-0283	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Kcnb2	Rat	membrane	is_active_in	IBA	FB:FBgn0003380\|FB:FBgn0033494\|MGI:102663\|MGI:108083\|MGI:1197011\|MGI:1197019\|MGI:1336181\|MGI:1928743\|MGI:96654\|MGI:96659\|MGI:96660\|MGI:96661\|MGI:96662\|MGI:96666\|MGI:96667\|MGI:96668\|MGI:96669\|MGI:96671\|PANTHER:PTN000164970\|RGD:1589169\|RGD:2949\|RGD:2950\|RGD:2951\|RGD:2952\|RGD:2953\|RGD:2954\|RGD:2955\|RGD:62083\|RGD:621349\|RGD:621358\|RGD:621503\|RGD:628829\|RGD:631414\|RGD:631416\|RGD:68393\|RGD:68394\|RGD:69222\|UniProtKB:F7DI95\|UniProtKB:O43526\|UniProtKB:P16389\|UniProtKB:P17658\|UniProtKB:P22001\|UniProtKB:P22459\|UniProtKB:P22460\|UniProtKB:P48547\|UniProtKB:P51787\|UniProtKB:Q09470\|UniProtKB:Q14003\|UniProtKB:Q14721\|UniProtKB:Q6PIU1\|UniProtKB:Q8TAE7\|UniProtKB:Q8TDN1\|UniProtKB:Q96KK3\|UniProtKB:Q9BQ31\|UniProtKB:Q9NZV8\|UniProtKB:Q9UIX4\|UniProtKB:Q9UK17\|WB:WBGene00002242\|WB:WBGene00004793	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnb2	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnb2	Rat	membrane	located_in	IEA	InterPro:IPR005821	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kcnb2	Rat	monoatomic ion channel complex	part_of	IEA	UniProtKB-KW:KW-0851	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnb2	Rat	neuronal cell body		IDA		2303537		RGD
Kcnb2	Rat	neuronal cell body	is_active_in	IBA	PANTHER:PTN002610264\|RGD:621349	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnb2	Rat	neuronal cell body membrane	located_in	IDA		10047337	PMID:20202934	UniProt
Kcnb2	Rat	perikaryon	located_in	IEA	UniProtKB-SubCell:SL-0197	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Kcnb2	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Kcnb2	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnb2	Rat	plasma membrane	located_in	IDA		737625	PMID:9305895	UniProt
Kcnb2	Rat	voltage-gated potassium channel complex	part_of	IDA		737625	PMID:9305895	UniProt
Kcnb2	Rat	voltage-gated potassium channel complex	part_of	IDA		10047337	PMID:20202934	UniProt
Kcnb2	Rat	voltage-gated potassium channel complex	part_of	IBA	FB:FBgn0003380\|MGI:102663\|MGI:108083\|MGI:1197011\|MGI:1197019\|MGI:1336181\|MGI:1928743\|MGI:96654\|MGI:96659\|MGI:96666\|MGI:96671\|PANTHER:PTN001355853\|RGD:2949\|RGD:2950\|RGD:2952\|RGD:2953\|RGD:2954\|RGD:2955\|RGD:62083\|RGD:621349\|RGD:621503\|RGD:628829\|RGD:631414\|RGD:631416\|RGD:68393\|RGD:68394\|RGD:69222\|UniProtKB:O43526\|UniProtKB:P16389\|UniProtKB:P22459\|UniProtKB:P22460\|UniProtKB:P48547\|UniProtKB:P51787\|UniProtKB:Q09470\|UniProtKB:Q14003\|UniProtKB:Q14721\|UniProtKB:Q8TAE7\|UniProtKB:Q8TDN1\|UniProtKB:Q96KK3\|UniProtKB:Q9NZV8\|UniProtKB:Q9UIX4\|UniProtKB:Q9UK17\|WB:WBGene00002242	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnb2	Rat	voltage-gated potassium channel complex	part_of	IEA	InterPro:IPR003968\|InterPro:IPR003973\|InterPro:IPR005826\|InterPro:IPR028325	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnb2	Rat	delayed rectifier potassium channel activity	enables	ISO	RGD:12122044	1624291	PMID:9612272	RGD	PMID:9612272
Kcnb2	Rat	delayed rectifier potassium channel activity	enables	IDA		10047337	PMID:20202934	UniProt
Kcnb2	Rat	delayed rectifier potassium channel activity	enables	IDA		737625	PMID:9305895	UniProt
Kcnb2	Rat	delayed rectifier potassium channel activity	enables	IDA		728916	PMID:1550672	UniProt
Kcnb2	Rat	monoatomic ion channel activity	enables	IEA	InterPro:IPR005821	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kcnb2	Rat	potassium channel activity	enables	IEA	UniProtKB-KW:KW-0631	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnb2	Rat	potassium channel regulator activity	enables	IBA	MGI:1197011\|MGI:1197019\|PANTHER:PTN001693752\|RGD:1309521\|RGD:628832\|RGD:631414\|RGD:631416\|UniProtKB:O73606\|UniProtKB:Q8TAE7\|UniProtKB:Q8TDN1\|UniProtKB:Q96KK3\|UniProtKB:Q9UIX4\|ZFIN:ZDB-GENE-130530-634	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnb2	Rat	protein binding	enables	ISO	RGD:732631	1624291	UniProtKB:O95292\|UniProtKB:Q9P0L0 PMID:33124732	RGD	PMID:33124732
Kcnb2	Rat	protein heterodimerization activity	enables	IDA		10047337	PMID:20202934	UniProt
Kcnb2	Rat	transmembrane transporter binding	enables	IPI	UniProtKB:P15387	10047337	PMID:20202934	UniProt
Kcnb2	Rat	voltage-gated potassium channel activity	enables	IEA	InterPro:IPR003968\|InterPro:IPR003973\|InterPro:IPR005826\|InterPro:IPR028325	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	An association study revealed substantial effects of dominance, epistasis and substance dependence co-morbidity on alcohol dependence symptom count.	Chen G, etal., Addict Biol. 2017 Nov;22(6):1475-1485. doi: 10.1111/adb.12402. Epub 2016 May 5.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Contrasting immunohistochemical localizations in rat brain of two novel K+ channels of the Shab subfamily.	Hwang PM, etal., J Neurosci. 1993 Apr;13(4):1569-76.
5.	A novel K+ channel with unique localizations in mammalian brain: molecular cloning and characterization.	Hwang PM, etal., Neuron 1992 Mar;8(3):473-81.
6.	Formation of heteromeric Kv2 channels in mammalian brain neurons.	Kihira Y, etal., J Biol Chem. 2010 May 14;285(20):15048-55. doi: 10.1074/jbc.M109.074260. Epub 2010 Mar 4.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	New modulatory alpha subunits for mammalian Shab K+ channels.	Salinas M, etal., J Biol Chem 1997 Sep 26;272(39):24371-9.

PMID:17379638	PMID:20853508	PMID:23788641	PMID:24252178	PMID:26538660	PMID:29941597	PMID:30091655

Kcnb2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	8,340,085 - 8,811,184 (-)	NCBI		GRCr8
mRatBN7.2	5	3,567,012 - 4,028,564 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	3,569,685 - 4,028,599 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	5,686,237 - 6,146,556 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	7,325,121 - 7,785,453 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	7,023,712 - 7,485,422 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	2,975,934 - 3,430,837 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	5	2,965,248 - 3,418,192 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	2,683,952 - 3,154,913 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	2,683,951 - 3,154,908 (-)	NCBI
Celera	5	3,165,386 - 3,621,344 (-)	NCBI		Celera
Cytogenetic Map	5	q11	NCBI

KCNB2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	72,537,225 - 72,938,349 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	72,537,225 - 72,938,349 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	73,449,460 - 73,850,584 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	73,612,180 - 74,013,138 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	73,612,179 - 74,013,136	NCBI
Celera	8	69,452,496 - 69,847,725 (+)	NCBI		Celera
Cytogenetic Map	8	q21.11	NCBI
HuRef	8	68,946,299 - 69,341,459 (+)	NCBI		HuRef
CHM1_1	8	73,502,691 - 73,903,408 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	72,972,288 - 73,367,350 (+)	NCBI		T2T-CHM13v2.0

Kcnb2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	15,357,149 - 15,793,975 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	15,357,478 - 15,793,974 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	15,286,925 - 15,723,751 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	15,287,254 - 15,723,750 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	15,302,533 - 15,704,295 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	15,297,666 - 15,696,895 (+)	NCBI		MGSCv36	mm8
MGSCv36	1	15,858,607 - 15,860,301 (+)	NCBI		MGSCv36	mm8
Celera	1	15,251,474 - 15,665,920 (+)	NCBI		Celera
Cytogenetic Map	1	A3	NCBI
cM Map	1	4.5	NCBI

Kcnb2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955444	7,237,011 - 7,646,399 (-)	NCBI	ChiLan1.0	ChiLan1.0

KCNB2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	88,278,471 - 88,685,017 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	63,904,517 - 64,314,700 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	69,069,427 - 69,481,855 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	70,756,092 - 71,123,156 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	70,756,185 - 71,122,897 (+)	Ensembl	panpan1.1		panPan2

KCNB2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	21,248,531 - 21,604,564 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	29	21,248,531 - 21,604,871 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	29	21,505,987 - 21,882,104 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	29	21,342,535 - 21,725,967 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	21,349,860 - 21,713,876 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	29	21,402,617 - 21,785,087 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	29	21,443,369 - 21,808,927 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	21,725,677 - 22,102,596 (+)	NCBI		UU_Cfam_GSD_1.0

Kcnb2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	57,711,390 - 58,087,221 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936648	1,361,422 - 1,734,672 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KCNB2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	62,879,266 - 63,307,794 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	62,877,838 - 63,306,314 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

KCNB2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	68,165,879 - 68,538,285 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666039	72,849,081 - 73,253,865 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Kcnb2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624744	18,240,912 - 18,659,530 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624744	18,240,321 - 18,687,157 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Kcnb2
2413 total Variants

Assembly: RGSC_v3.4

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
5	3122975	3122976	G	A	snv	FHL/EurMcwi (MCW)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	27
Count of miRNA genes:	23
Interacting mature miRNAs:	27
Transcripts:	ENSRNOT00000045460
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312562	Pur18	Proteinuria QTL 18	2.6	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	5	2138965	32656739	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
631551	Vetf1	Vascular elastic tissue fragility QTL 1	5	0.0001	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	5	2282226	5904428	Rat
1300117	Hrtrt8	Heart rate QTL 8	3.49		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	3844018	47869213	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
2313085	Bss59	Bone structure and strength QTL 59	2.9	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	5	3844018	26141981	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat

D5Rat119

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	5	8,627,230 - 8,627,459 (+)	Marker Load Pipeline
mRatBN7.2	5	3,844,018 - 3,844,247 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	3,251,329 - 3,251,557	NCBI	Rnor6.0
Rnor_5.0	5	3,239,567 - 3,239,795	UniSTS	Rnor5.0
RGSC_v3.4	5	2,965,857 - 2,966,086	RGD	RGSC3.4
RGSC_v3.4	5	2,965,858 - 2,966,086	UniSTS	RGSC3.4
RGSC_v3.1	5	2,965,812 - 2,966,107	RGD
Celera	5	3,437,394 - 3,437,622	UniSTS
RH 2.0 Map	5	0.0	RGD
SHRSP x BN Map	5	1.1599	RGD
Cytogenetic Map	5	q11	UniSTS

D5Uwm56

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	5	8,741,163 - 8,741,273 (+)	Marker Load Pipeline
mRatBN7.2	5	3,957,953 - 3,958,063 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	3,362,091 - 3,362,200	NCBI	Rnor6.0
Rnor_5.0	5	3,349,446 - 3,349,555	UniSTS	Rnor5.0
RGSC_v3.4	5	3,084,892 - 3,085,002	RGD	RGSC3.4
RGSC_v3.4	5	3,084,893 - 3,085,002	UniSTS	RGSC3.4
RGSC_v3.1	5	3,084,892 - 3,085,002	RGD
Celera	5	3,551,388 - 3,551,497	UniSTS
Cytogenetic Map	5	q11	UniSTS

RH134796

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	3,802,906 - 3,803,092 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	3,211,798 - 3,211,983	NCBI	Rnor6.0
Rnor_5.0	5	3,200,096 - 3,200,281	UniSTS	Rnor5.0
RGSC_v3.4	5	2,921,417 - 2,921,602	UniSTS	RGSC3.4
Celera	5	3,396,879 - 3,397,064	UniSTS
Cytogenetic Map	5	q11	UniSTS

AU048421

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	4,003,645 - 4,003,852 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	3,407,662 - 3,407,866	NCBI	Rnor6.0
Rnor_5.0	5	3,395,017 - 3,395,221	UniSTS	Rnor5.0
RGSC_v3.4	5	3,130,585 - 3,130,789	UniSTS	RGSC3.4
Celera	5	3,597,038 - 3,597,225	UniSTS
Cytogenetic Map	5	q11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_054000	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593132	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287085	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC125757	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473984	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M77482	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000045460 ⟹ ENSRNOP00000050431

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	3,569,685 - 4,028,599 (-)	Ensembl

RefSeq Acc Id:

NM_054000 ⟹ NP_446452

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	8,352,779 - 8,811,184 (-)	NCBI
mRatBN7.2	5	3,569,550 - 4,027,981 (-)	NCBI
Rnor_6.0	5	2,979,863 - 3,430,837 (-)	NCBI
Rnor_5.0	5	2,965,248 - 3,418,192 (-)	NCBI
RGSC_v3.4	5	2,683,952 - 3,154,913 (-)	RGD
Celera	5	3,165,386 - 3,621,344 (-)	RGD

Sequence:

show sequence

ACTGCGAACCGGAGTGAGGGATGTAAAGAAGGGAGAAGGAAAGCTGCCAGGAGCTCCAGCCAGTCGGGGAGACCCTCCTCTCTGTGGAGGGGAGGGGGATTTCCAGCGACACATCATTGGCGAAAGGG
ACCTTTGCAGGAGAGGAGTCCTCTGAGGGAACAGGGAAGCCCACAGCCCCCTGTGGCACAGGAGCCAGAGCTGCTGCCCGAGCGGAGCTGGGTCCGTGGGAGCTAGCTGATGTGGCAATGCCTGTTCC
AGTGGAATCCTGCTTCAGGTGACCTCCTTTCTAAGGACCCTAGCTCTGTGGCTCTGTCCAGTTCAAAATGGCAGAAAAGGCACCTCCTGGCTTGAACAGAAAAACATCCAGGTCAACACTTTCTCTTC
CTCCAGAACCAGTGGACATTATCCGAAGCAAAACATGCTCTCGGAGAGTTAAGATCAACGTAGGGGGCCTTAACCACGAAGTCCTGTGGAGAACTCTGGACAGGCTACCCAGGACGCGCCTGGGGAAG
CTCCGAGACTGTAACACGCACGAGAGTCTCCTGGAGGTGTGCGATGACTACAACCTTAATGAGAATGAGTATTTCTTCGACCGCCATCCTGGAGCCTTCACATCTATTCTGAACTTCTACCGGACGGG
AAAGCTCCACATGATGGAAGAAATGTGTGCCCTCTCCTTTGGCCAAGAGCTTGATTACTGGGGCATCGATGAGATCTACCTAGAGTCCTGCTGCCAAGCCAGATACCATCAGAAGAAGGAGCAGATGA
ACGAAGAACTTAGAAGGGAGGCAGAGACCATGCGTGAGCGCGAGGGGGAGGAGTTTGATAACACCTGCTGCCCAGAGAAAAGGAAGAAACTTTGGGACTTGCTGGAGAAGCCGAACTCATCCGTGGCG
GCAAAGATCCTGGCCATCGTGTCTATCCTGTTCATCGTCCTTTCCACCATTGCTCTGTCTCTCAACACACTTCCGGAGCTGCAAGAAAACGATGAATTTGGGCAACCCAGTGACAACCGGAAGTTGGC
GCACGTAGAGGCTGTGTGCATTGCTTGGTTTACCATGGAGTACCTTTTACGATTCCTGTCCTCACCAAATAAATGGAAATTCTTTAAAGGCCCACTGAATGTCATTGACCTCCTGGCCATCTTGCCAT
ACTATGTAACCATCTTCCTCACCGAGTCCAACAAAAGTGTGCTGCAGTTCCAGAATGTGAGACGCGTGGTCCAGATCTTTCGAATCATGCGCATCCTCAGGATCCTGAAACTCGCCAGACACTCGACG
GGCCTGCAGTCTCTGGGTTTCACCCTCAGGCGGAGTTACAATGAGTTGGGTTTATTAATACTGTTTCTGGCCATGGGAATAATGATATTTTCCAGTTTGGTGTTTTTCGCTGAGAAAGATGAAGATGC
TACAAAGTTCACCAGTATCCCTGCATCATTTTGGTGGGCTACCATCACCATGACCACTGTGGGCTATGGTGACATTTACCCTAAAACACTGTTAGGGAAAATTGTGGGTGGCCTTTGCTGCATTGCAG
GAGTCCTGGTTATTGCCCTTCCTATCCCCATCATTGTGAACAATTTCTCTGAGTTCTATAAGGAACAAAAACGCCAGGAGAAAGCTATTAAAAGGAGAGAGGCTCTTGAAAGAGCCAAAAGAAATGGA
AGCATCGTTTCTATGAACTTAAAGGATGCCTTTGCTAGAAGTATGGAACTGATCGACGTGGCCGTGGAGAAGGCTGGAGAGTCGGCCAATATCAAGGACTCCGTGGATGATAACCACCTGTCTCCAAG
CCGGTGGAAGTGGGCCAGAAAGGCGCTGTCGGAAACAAGCTCCAACAAGTCTTACGAGAATAAGTACCAGGAGGTTAGCCAAAAAGACTCCCACGAACAGCTGAACAACACTTCTTCCTCCAGCCCAC
AGCATCTGAGCGCCCAGAAGCTGGAGATGCTATACAATGAAATCACCAAGACACAGACTCATTCCCACCCGAACCCAGACTGCCAAGAACAGCCAGAGAGGCCATCTGCCTATGAGGAGGAGATAGAA
ATGGAAGAGGTGGTCTGCCCACAGGAGCAGCTGGCTGTGGCACAGACCGAGGTCATCGTGGACATGAAGAGCACCTCCAGCATTGACAGCTTCACCAGCTGTGCCACTGACTTCACGGAGACTGAGAG
GTCACCCCTGCCACCACCCTCTGCCTCTCACTTGCAGATGAAGTTCCCCACCGACCTCCCAGGAATGGATGAGCACCAAAGAGTCAGGGCACCTCCATTCCTAACACTAAGCAGAGATAAGGGGCCTG
CTGCCAGGGAGGCTGCACTGGATTATGCCCCAATTGACATAACTGTGAACCTCGATGCTGGGGCTTCCCATGGTCCTTTGCAACCTGACAGTGCCAGCGACAGCCCCAAGAGCTCGCTGAAAGGGAGC
AACCCCCTCAAGTCTAGATCCCTAAAAGTGAACTTTCAGGAAAACAGAGGCAGTGCACCCCAGACCCCACCCAGCACAGCCAGGCCACTGCCAGTAACCACAGCTGACTTTCCGCTCACCACCCCCCA
GCACATGAGTACCATTCTTCTAGAAGAAGCCCTCCCCCAGGGACAGAGACCCTTGCCGGGGGCTGATGTTTCAGCACACTGTCAGGGACCATCCAAAGGTCTATCCCCACGAGTTCCCAAGCAAAAAC
TGTTTCCTTTCTCTTCTAGAGAAAGGAGGAGCTTCACTGAAATAGACACTGGAGAAGACGAAGACTTCTTGGACCTCCAAAGGCCAAGACCAGACAAGCAAGCAGATCCCAGCCCCAACTGCTTAGCA
GATAAGCCTGGAGAGGCCAGAGACCCTTTAAGAGAAGAGGGCTGTGTGGGTTCCTCCTCTCCCCAGAACACAGACCACAACTGTAGGCAAGACATTTACCAGGCTGTGGGTGAAGTCAAAAAGGACAG
TAGTCAAGAAGGGTACAAGATGGAGAACCACTTGTTTGCCCCAGAAATTCATTCTAACCCAGGAGACACAGGTTATTGCCCCACTCGTGAGACCAGCATGTGACTAGTTATAAAAGCAATAAAAGAAA
AAGACTCATTTCTTAAAAATGCATTAAAATGCCGTGAACTAAAATATGAGAAACCCCGCCCCCTAATACCAGTGCATAAAATGTTATTTTTGCATGGCATGAACAGCTTAGTTTAAGGATTGTTTAAA
TAAAGAGTTGAGACTGCATTTTGTAACAAA

hide sequence

RefSeq Acc Id:

XM_063287085 ⟹ XP_063143155

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	8,340,085 - 8,787,201 (-)	NCBI


Protein RefSeqs	NP_446452	(Get FASTA)	NCBI Sequence Viewer
	XP_063143155	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40905	(Get FASTA)	NCBI Sequence Viewer
	EDM11519	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000050431
GenBank Protein	Q63099	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446452 ⟸ NM_054000

- UniProtKB:

Q63099 (UniProtKB/Swiss-Prot), F1LVV2 (UniProtKB/TrEMBL), A6JFC3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAEKAPPGLNRKTSRSTLSLPPEPVDIIRSKTCSRRVKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGI
DEIYLESCCQARYHQKKEQMNEELRREAETMREREGEEFDNTCCPEKRKKLWDLLEKPNSSVAAKILAIVSILFIVLSTIALSLNTLPELQENDEFGQPSDNRKLAHVEAVCIAWFTMEYLLRFLSSP
NKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGY
GDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMNLKDAFARSMELIDVAVEKAGESANIKDSVDDNHLSPSRWKWARKALSETSSNKSYENKY
QEVSQKDSHEQLNNTSSSSPQHLSAQKLEMLYNEITKTQTHSHPNPDCQEQPERPSAYEEEIEMEEVVCPQEQLAVAQTEVIVDMKSTSSIDSFTSCATDFTETERSPLPPPSASHLQMKFPTDLPGM
DEHQRVRAPPFLTLSRDKGPAAREAALDYAPIDITVNLDAGASHGPLQPDSASDSPKSSLKGSNPLKSRSLKVNFQENRGSAPQTPPSTARPLPVTTADFPLTTPQHMSTILLEEALPQGQRPLPGAD
VSAHCQGPSKGLSPRVPKQKLFPFSSRERRSFTEIDTGEDEDFLDLQRPRPDKQADPSPNCLADKPGEARDPLREEGCVGSSSPQNTDHNCRQDIYQAVGEVKKDSSQEGYKMENHLFAPEIHSNPGD
TGYCPTRETSM

hide sequence

Ensembl Acc Id:

ENSRNOP00000050431 ⟸ ENSRNOT00000045460

RefSeq Acc Id:	XP_063143155 ⟸ XM_063287085
- Peptide Label:	isoform X1
- UniProtKB:	Q63099 (UniProtKB/Swiss-Prot), A6JFC3 (UniProtKB/TrEMBL), F1LVV2 (UniProtKB/TrEMBL)

Protein Domains

BTB

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LVV2-F1-model_v2	AlphaFold	F1LVV2	1-720	view protein structure
AF-Q63099-F1-model_v2	AlphaFold	Q63099	1-907	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-42292	BioCyc
Ensembl Genes	ENSRNOG00000028991	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000045460	ENTREZGENE
Gene3D-CATH	1.10.287.70	UniProtKB/Swiss-Prot
	1.20.120.350	UniProtKB/Swiss-Prot
	Potassium Channel Kv1.1, Chain A	UniProtKB/Swiss-Prot
InterPro	BTB/POZ_dom	UniProtKB/Swiss-Prot
	Ion_trans_dom	UniProtKB/Swiss-Prot
	K_chnl_volt-dep_Kv	UniProtKB/Swiss-Prot
	K_chnl_volt-dep_Kv2	UniProtKB/Swiss-Prot
	K_chnl_volt-dep_Kv2.2	UniProtKB/Swiss-Prot
	SKP1/BTB/POZ_sf	UniProtKB/Swiss-Prot
	T1-type_BTB	UniProtKB/Swiss-Prot
	VG_K_chnl	UniProtKB/Swiss-Prot
	Volt_channel_dom_sf	UniProtKB/Swiss-Prot
NCBI Gene	117105	ENTREZGENE
PANTHER	POTASSIUM VOLTAGE-GATED CHANNEL SUBFAMILY B MEMBER 2	UniProtKB/Swiss-Prot
	PTHR11537	UniProtKB/Swiss-Prot
Pfam	BTB_2	UniProtKB/Swiss-Prot
	Ion_trans	UniProtKB/Swiss-Prot
	Kv2channel	UniProtKB/Swiss-Prot
PhenoGen	Kcnb2	PhenoGen
PRINTS	KCHANNEL	UniProtKB/Swiss-Prot
	KV22CHANNEL	UniProtKB/Swiss-Prot
	KVCHANNEL	UniProtKB/Swiss-Prot
	SHABCHANNEL	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000028991	RatGTEx
SMART	BTB	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54695	UniProtKB/Swiss-Prot
	Voltage-gated potassium channels	UniProtKB/Swiss-Prot
UniProt	A6JFC3	ENTREZGENE, UniProtKB/TrEMBL
	F1LVV2	ENTREZGENE, UniProtKB/TrEMBL
	KCNB2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	Kcnb2	potassium voltage-gated channel subfamily B member 2	Kcnb2	potassium channel, voltage gated Shab-related subfamily B, member 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-01-26	Kcnb2	potassium channel, voltage gated Shab-related subfamily B, member 2	Kcnb2	potassium voltage gated channel, Shab-related subfamily, member 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Kcnb2	potassium voltage gated channel, Shab-related subfamily, member 2			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Kcnb2	potassium voltage gated channel, Shab-related subfamily, member 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Note Type	Note	Reference
gene_expression	expressed in granule cells of the olfactory bulb and cerebellum and circumvallate papillae of rat tongue	728916

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar