Symbol:
Cd93
Name:
CD93 molecule
RGD ID:
621251
Description:
Predicted to enable complement component C1q complex binding activity and signaling receptor activity. Predicted to be involved in angiogenesis and cell-cell adhesion. Predicted to be located in cell surface; cytoplasmic vesicle; and plasma membrane. Orthologous to human CD93 (CD93 molecule); INTERACTS WITH 1,2,4-trimethylbenzene; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
C1q/MBL/SPA receptor; C1qR(p); C1qr1; C1qRp; CD93 antigen; cell surface antigen AA4; complement component 1 q subcomponent receptor 1; complement component 1, q subcomponent, receptor 1; complement component C1q receptor; Ly68; lymphocyte antigen 68
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CD93 (CD93 molecule) HGNC
HomoloGene, NCBI, Panther
Mus musculus (house mouse):
Cd93 (CD93 antigen) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cd93 (CD93 molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CD93 (CD93 molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CD93 (CD93 molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cd93 (CD93 molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CD93 (CD93 molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CD93 (CD93 molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cd93 (CD93 molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Cd93 (CD93 antigen)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CD93 (CD93 molecule)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cd248b (CD248 molecule, endosialin b)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):
cd93
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 156,345,019 - 156,351,537 (-) NCBI GRCr8 mRatBN7.2 3 135,891,859 - 135,898,378 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 135,891,859 - 135,898,378 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 139,834,863 - 139,841,377 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 148,418,996 - 148,425,510 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 146,117,490 - 146,124,008 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 142,778,798 - 142,783,774 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 142,778,770 - 142,783,774 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 149,189,164 - 149,194,140 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 137,188,528 - 137,193,457 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 137,094,100 - 137,099,030 (-) NCBI Celera 3 134,737,086 - 134,742,072 (-) NCBI Celera Cytogenetic Map 3 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cd93 Rat 1,2,4-trimethylbenzene increases expression EXP 6480464 pseudocumene results in increased expression of CD93 protein CTD PMID:17337753 Cd93 Rat 1,2-dimethylhydrazine multiple interactions ISO Cd93 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of CD93 mRNA CTD PMID:22206623 Cd93 Rat 1,2-dimethylhydrazine increases expression ISO Cd93 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of CD93 mRNA CTD PMID:22206623 Cd93 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of CD93 mRNA CTD PMID:17557909 Cd93 Rat 17beta-estradiol decreases expression ISO Cd93 (Mus musculus) 6480464 Estradiol results in decreased expression of CD93 mRNA CTD PMID:19484750 Cd93 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Cd93 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Cd93 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Cd93 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Cd93 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cd93 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CD93 mRNA CTD PMID:21570461 Cd93 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CD93 mRNA CTD PMID:32109520 Cd93 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO CD93 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of CD93 mRNA CTD PMID:27913140 Cd93 Rat 2-butoxyethanol increases expression ISO Cd93 (Mus musculus) 6480464 n-butoxyethanol results in increased expression of CD93 mRNA CTD PMID:19812364 Cd93 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:32119087 Cd93 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Cd93 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of CD93 mRNA CTD PMID:26251327 Cd93 Rat 4,4'-sulfonyldiphenol increases expression ISO Cd93 (Mus musculus) 6480464 bisphenol S results in increased expression of CD93 mRNA CTD PMID:30951980 and PMID:39298647 Cd93 Rat 4-hydroxyphenyl retinamide increases expression ISO Cd93 (Mus musculus) 6480464 Fenretinide results in increased expression of CD93 mRNA CTD PMID:28973697 Cd93 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of CD93 mRNA CTD PMID:30047161 Cd93 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:19480007 Cd93 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of CD93 mRNA CTD PMID:31881176 Cd93 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of CD93 protein CTD PMID:33236894 Cd93 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of CD93 mRNA CTD PMID:28959563 Cd93 Rat all-trans-retinoic acid increases expression ISO CD93 (Homo sapiens) 6480464 Tretinoin results in increased expression of CD93 mRNA CTD PMID:33167477 Cd93 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of CD93 mRNA CTD PMID:30047161 Cd93 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CD93 mRNA CTD PMID:16483693 Cd93 Rat anthracen-2-amine increases expression EXP 6480464 2-anthramine results in increased expression of CD93 mRNA CTD PMID:23038007 Cd93 Rat benzo[a]pyrene multiple interactions ISO Cd93 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to CD93 promoter] CTD PMID:19654925 Cd93 Rat benzo[a]pyrene affects methylation ISO CD93 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CD93 promoter CTD PMID:27901495 Cd93 Rat benzo[a]pyrene increases expression ISO Cd93 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CD93 mRNA CTD PMID:21569818 and PMID:32417428 Cd93 Rat benzo[b]fluoranthene increases expression ISO Cd93 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of CD93 mRNA CTD PMID:26377693 Cd93 Rat bis(2-chloroethyl) sulfide increases expression ISO CD93 (Homo sapiens) 6480464 Mustard Gas results in increased expression of CD93 protein CTD PMID:11428648 Cd93 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Cd93 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] results in decreased secretion of CD93 protein and [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CD93 mRNA CTD PMID:38954831 and PMID:39150890 Cd93 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of CD93 mRNA CTD PMID:26496021 Cd93 Rat bisphenol A increases expression ISO Cd93 (Mus musculus) 6480464 bisphenol A results in increased expression of CD93 mRNA CTD PMID:30951980 Cd93 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CD93 mRNA CTD PMID:30816183 and PMID:38750585 Cd93 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CD93 mRNA CTD PMID:25181051 Cd93 Rat bisphenol F increases expression ISO Cd93 (Mus musculus) 6480464 bisphenol F results in increased expression of CD93 mRNA CTD PMID:30951980 and PMID:38685157 Cd93 Rat Butylbenzyl phthalate multiple interactions ISO Cd93 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] results in decreased secretion of CD93 protein and [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CD93 mRNA CTD PMID:38954831 and PMID:39150890 Cd93 Rat carbon nanotube increases expression ISO Cd93 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of CD93 mRNA CTD PMID:25620056 Cd93 Rat carbonyl sulfide increases expression EXP 6480464 carbonyl sulfide results in increased expression of CD93 mRNA CTD PMID:19395590 Cd93 Rat chloroprene decreases expression EXP 6480464 Chloroprene results in decreased expression of CD93 mRNA CTD PMID:23125180 Cd93 Rat chlorpyrifos increases expression ISO Cd93 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of CD93 mRNA CTD PMID:34289071 and PMID:37019170 Cd93 Rat clotrimazole increases expression EXP 6480464 Clotrimazole results in increased expression of CD93 mRNA CTD PMID:30047161 Cd93 Rat cobalt dichloride decreases expression ISO CD93 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of CD93 mRNA CTD PMID:19320972 Cd93 Rat cobalt dichloride increases expression ISO CD93 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of CD93 mRNA CTD PMID:23052192 Cd93 Rat cocaine decreases expression EXP 6480464 Cocaine results in decreased expression of CD93 mRNA CTD PMID:17898221 Cd93 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of CD93 mRNA CTD PMID:30556269 Cd93 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of CD93 mRNA CTD PMID:30556269 Cd93 Rat cypermethrin increases expression ISO Cd93 (Mus musculus) 6480464 cypermethrin results in increased expression of CD93 mRNA CTD PMID:29020013 Cd93 Rat dexamethasone increases expression ISO Cd93 (Mus musculus) 6480464 Dexamethasone results in increased expression of CD93 mRNA CTD PMID:21041162 Cd93 Rat Dibutyl phosphate affects expression ISO CD93 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CD93 mRNA CTD PMID:37042841 Cd93 Rat dibutyl phthalate multiple interactions ISO Cd93 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] results in decreased secretion of CD93 protein and [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CD93 mRNA CTD PMID:38954831 and PMID:39150890 Cd93 Rat diethyl phthalate multiple interactions ISO Cd93 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] results in decreased secretion of CD93 protein and [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CD93 mRNA CTD PMID:38954831 and PMID:39150890 Cd93 Rat diisobutyl phthalate multiple interactions ISO Cd93 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] results in decreased secretion of CD93 protein and [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CD93 mRNA CTD PMID:38954831 and PMID:39150890 Cd93 Rat diisononyl phthalate multiple interactions ISO Cd93 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate] results in decreased secretion of CD93 protein and [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CD93 mRNA CTD PMID:38954831 and PMID:39150890 Cd93 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of CD93 mRNA CTD PMID:33729688 Cd93 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of CD93 mRNA CTD PMID:21551480 Cd93 Rat dorsomorphin multiple interactions ISO CD93 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CD93 mRNA CTD PMID:27188386 Cd93 Rat doxorubicin decreases expression ISO CD93 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CD93 mRNA CTD PMID:29803840 Cd93 Rat ethanol multiple interactions ISO Cd93 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of CD93 mRNA CTD PMID:30517762 Cd93 Rat fluorescein 5-isothiocyanate affects binding ISO CD93 (Homo sapiens) 6480464 Fluorescein-5-isothiocyanate binds to CD93 protein CTD PMID:27129696 Cd93 Rat folic acid multiple interactions ISO Cd93 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of CD93 mRNA CTD PMID:22206623 Cd93 Rat hydrogen sulfide increases expression ISO Cd93 (Mus musculus) 6480464 Hydrogen Sulfide results in increased expression of CD93 mRNA CTD PMID:31843631 Cd93 Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of CD93 mRNA CTD PMID:22641619 Cd93 Rat lead diacetate decreases expression ISO Cd93 (Mus musculus) 6480464 lead acetate results in decreased expression of CD93 mRNA CTD PMID:22613225 Cd93 Rat leflunomide increases expression ISO CD93 (Homo sapiens) 6480464 leflunomide results in increased expression of CD93 mRNA CTD PMID:28988120 Cd93 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of CD93 mRNA CTD PMID:30047161 Cd93 Rat methotrexate decreases expression ISO CD93 (Homo sapiens) 6480464 Methotrexate results in decreased expression of CD93 mRNA CTD PMID:17400583 Cd93 Rat N-nitrosodiethylamine increases expression ISO Cd93 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of CD93 mRNA CTD PMID:24535843 Cd93 Rat nickel atom decreases expression ISO CD93 (Homo sapiens) 6480464 Nickel results in decreased expression of CD93 mRNA CTD PMID:23195993 Cd93 Rat nickel atom increases expression ISO CD93 (Homo sapiens) 6480464 Nickel results in increased expression of CD93 mRNA CTD PMID:24768652 Cd93 Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of CD93 mRNA CTD PMID:31397875 Cd93 Rat ozone multiple interactions ISO Cd93 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of CD93 mRNA CTD PMID:34911549 Cd93 Rat paracetamol affects expression ISO Cd93 (Mus musculus) 6480464 Acetaminophen affects the expression of CD93 mRNA CTD PMID:17562736 Cd93 Rat paracetamol decreases expression ISO CD93 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of CD93 mRNA CTD PMID:21420995 Cd93 Rat paracetamol increases expression ISO Cd93 (Mus musculus) 6480464 Acetaminophen results in increased expression of CD93 mRNA CTD PMID:11264010 Cd93 Rat paracetamol multiple interactions ISO CD93 (Homo sapiens) 6480464 [Dietary Carbohydrates co-treated with Acetaminophen] results in increased expression of CD93 mRNA CTD PMID:17093179 Cd93 Rat PCB138 multiple interactions ISO Cd93 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Cd93 Rat phenobarbital affects expression ISO Cd93 (Mus musculus) 6480464 Phenobarbital affects the expression of CD93 mRNA CTD PMID:23091169 Cd93 Rat phenylmercury acetate decreases expression ISO CD93 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of CD93 mRNA CTD PMID:26272509 Cd93 Rat phenylmercury acetate multiple interactions ISO CD93 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CD93 mRNA CTD PMID:27188386 Cd93 Rat pirinixic acid increases expression ISO Cd93 (Mus musculus) 6480464 pirinixic acid results in increased expression of CD93 mRNA CTD PMID:18445702 Cd93 Rat protein kinase inhibitor multiple interactions ISO CD93 (Homo sapiens) 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in decreased expression of CD93 mRNA] CTD PMID:28003376 Cd93 Rat quercetin increases expression ISO CD93 (Homo sapiens) 6480464 Quercetin results in increased expression of CD93 mRNA CTD PMID:21632981 Cd93 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of CD93 mRNA CTD PMID:28374803 Cd93 Rat rotenone increases expression ISO Cd93 (Mus musculus) 6480464 Rotenone results in increased expression of CD93 mRNA CTD PMID:32937126 Cd93 Rat SB 431542 multiple interactions ISO CD93 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CD93 mRNA CTD PMID:27188386 Cd93 Rat silicon dioxide increases expression ISO Cd93 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of CD93 mRNA CTD PMID:23221170 Cd93 Rat sodium arsenate increases expression ISO Cd93 (Mus musculus) 6480464 sodium arsenate results in increased expression of CD93 mRNA CTD PMID:21795629 Cd93 Rat sodium dichromate decreases expression ISO CD93 (Homo sapiens) 6480464 sodium bichromate results in decreased expression of CD93 mRNA CTD PMID:17685462 Cd93 Rat Soman increases expression EXP 6480464 Soman results in increased expression of CD93 mRNA CTD PMID:19281266 Cd93 Rat succimer multiple interactions ISO Cd93 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of CD93 mRNA CTD PMID:21641980 Cd93 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of CD93 mRNA CTD PMID:30047161 Cd93 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of CD93 mRNA CTD PMID:26496021 Cd93 Rat tetrachloromethane multiple interactions ISO Cd93 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of CD93 mRNA CTD PMID:30517762 Cd93 Rat tetrachloromethane increases expression ISO Cd93 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CD93 mRNA CTD PMID:31919559 Cd93 Rat titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of CD93 mRNA CTD PMID:30012374 Cd93 Rat toluene increases expression EXP 6480464 Toluene results in increased expression of CD93 mRNA CTD PMID:22967744 Cd93 Rat triclosan decreases expression ISO CD93 (Homo sapiens) 6480464 Triclosan results in decreased expression of CD93 mRNA CTD PMID:30510588 Cd93 Rat triclosan increases methylation ISO CD93 (Homo sapiens) 6480464 Triclosan results in increased methylation of CD93 gene CTD PMID:34523531 Cd93 Rat triphenyl phosphate affects expression ISO CD93 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CD93 mRNA CTD PMID:37042841 Cd93 Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of CD93 mRNA CTD PMID:30589522 Cd93 Rat triptonide increases expression ISO Cd93 (Mus musculus) 6480464 triptonide results in increased expression of CD93 mRNA CTD PMID:33045310 Cd93 Rat troglitazone decreases expression ISO Cd93 (Mus musculus) 6480464 troglitazone results in decreased expression of CD93 mRNA CTD PMID:28973697 Cd93 Rat tungsten decreases expression ISO Cd93 (Mus musculus) 6480464 Tungsten results in decreased expression of CD93 mRNA CTD PMID:30912803 Cd93 Rat undecane increases expression EXP 6480464 undecane results in increased expression of CD93 protein CTD PMID:17337753 Cd93 Rat valproic acid increases methylation ISO CD93 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CD93 gene CTD PMID:29154799 Cd93 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of CD93 mRNA CTD PMID:29427782 Cd93 Rat valproic acid affects expression ISO CD93 (Homo sapiens) 6480464 Valproic Acid affects the expression of CD93 mRNA CTD PMID:25979313 Cd93 Rat valproic acid increases expression ISO Cd93 (Mus musculus) 6480464 Valproic Acid results in increased expression of CD93 mRNA CTD PMID:24896083 Cd93 Rat valproic acid decreases expression ISO CD93 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of CD93 mRNA CTD PMID:27188386 and PMID:28001369 Cd93 Rat vorinostat decreases expression ISO CD93 (Homo sapiens) 6480464 vorinostat results in decreased expression of CD93 mRNA CTD PMID:27188386
1,2,4-trimethylbenzene (EXP) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-butoxyethanol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) acetamide (EXP) aconitine (EXP) acrylamide (EXP) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) anthracen-2-amine (EXP) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) Butylbenzyl phthalate (ISO) carbon nanotube (ISO) carbonyl sulfide (EXP) chloroprene (EXP) chlorpyrifos (ISO) clotrimazole (EXP) cobalt dichloride (ISO) cocaine (EXP) copper atom (EXP) copper(0) (EXP) cypermethrin (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (EXP) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) ethanol (ISO) fluorescein 5-isothiocyanate (ISO) folic acid (ISO) hydrogen sulfide (ISO) lead diacetate (EXP,ISO) leflunomide (ISO) methimazole (EXP) methotrexate (ISO) N-nitrosodiethylamine (ISO) nickel atom (ISO) ozone (EXP,ISO) paracetamol (ISO) PCB138 (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) protein kinase inhibitor (ISO) quercetin (ISO) rotenone (EXP,ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium dichromate (ISO) Soman (EXP) succimer (ISO) sulfadimethoxine (EXP) testosterone (EXP) tetrachloromethane (ISO) titanium dioxide (EXP) toluene (EXP) triclosan (ISO) triphenyl phosphate (EXP,ISO) triptonide (ISO) troglitazone (ISO) tungsten (ISO) undecane (EXP) valproic acid (EXP,ISO) vorinostat (ISO)
1.
Molecular and cellular properties of the rat AA4 antigen, a C-type lectin-like receptor with structural homology to thrombomodulin.
Dean YD, etal., J Biol Chem 2000 Nov 3;275(44):34382-92.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Characterization and molecular cloning of rat C1qRp, a receptor on NK cells.
Lovik G, etal., Eur J Immunol 2000 Dec;30(12):3355-62.
4.
Human C1qRp is identical with CD93 and the mNI-11 antigen but does not bind C1q.
McGreal EP, etal., J Immunol. 2002 May 15;168(10):5222-32.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Nine Genes Mediate the Therapeutic Effects of Iodine-131 Radiotherapy in Thyroid Carcinoma Patients.
Shuwen H, etal., Dis Markers. 2020 Jun 16;2020:9369341. doi: 10.1155/2020/9369341. eCollection 2020.
Cd93 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 156,345,019 - 156,351,537 (-) NCBI GRCr8 mRatBN7.2 3 135,891,859 - 135,898,378 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 135,891,859 - 135,898,378 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 139,834,863 - 139,841,377 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 148,418,996 - 148,425,510 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 146,117,490 - 146,124,008 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 142,778,798 - 142,783,774 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 142,778,770 - 142,783,774 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 149,189,164 - 149,194,140 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 137,188,528 - 137,193,457 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 137,094,100 - 137,099,030 (-) NCBI Celera 3 134,737,086 - 134,742,072 (-) NCBI Celera Cytogenetic Map 3 q41 NCBI
CD93 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 23,079,360 - 23,086,324 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 23,065,139 - 23,086,324 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 23,059,997 - 23,066,961 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 23,007,993 - 23,014,977 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 23,007,994 - 23,014,977 NCBI Celera 20 23,133,371 - 23,140,349 (-) NCBI Celera Cytogenetic Map 20 p11.21 NCBI HuRef 20 23,021,512 - 23,028,490 (-) NCBI HuRef CHM1_1 20 23,060,691 - 23,067,675 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 23,120,610 - 23,145,801 (-) NCBI T2T-CHM13v2.0
Cd93 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 148,278,571 - 148,285,455 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 148,278,560 - 148,285,483 (-) Ensembl GRCm39 Ensembl GRCm38 2 148,436,651 - 148,443,535 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 148,436,640 - 148,443,563 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 148,262,387 - 148,269,271 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 148,128,092 - 148,134,976 (-) NCBI MGSCv36 mm8 Celera 2 149,711,496 - 149,718,416 (-) NCBI Celera Cytogenetic Map 2 G3 NCBI cM Map 2 73.48 NCBI
Cd93 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 30,252,580 - 30,255,313 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 30,244,231 - 30,255,184 (-) NCBI ChiLan1.0 ChiLan1.0
CD93 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 23,952,735 - 23,964,893 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 23,949,569 - 23,961,733 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 23,022,834 - 23,033,440 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 23,375,310 - 23,384,789 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 23,377,777 - 23,384,789 (-) Ensembl panpan1.1 panPan2
CD93 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 559,570 - 565,909 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 560,025 - 563,211 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 577,238 - 591,243 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 948,872 - 962,890 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 956,336 - 962,371 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 547,813 - 561,814 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 657,002 - 663,862 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 931,201 - 945,209 (+) NCBI UU_Cfam_GSD_1.0
Cd93 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 149,105,642 - 149,110,420 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936620 2,526,158 - 2,533,558 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936620 2,526,179 - 2,531,603 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CD93 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 30,233,933 - 30,239,692 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 30,233,275 - 30,240,041 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 34,381,631 - 34,387,846 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CD93 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 52,074,823 - 52,082,768 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 52,074,730 - 52,082,029 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666078 6,886,388 - 6,893,304 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cd93
.
Predicted Target Of
Count of predictions: 405 Count of miRNA genes: 221 Interacting mature miRNAs: 265 Transcripts: ENSRNOT00000034256 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1300173 Rf11 Renal function QTL 11 3.38 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 121056165 145956249 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 631673 Iddm13 Insulin dependent diabetes mellitus QTL 13 1.3 0.663 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 3 130193298 161695983 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
RH137518
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 135,894,126 - 135,894,268 (+) MAPPER mRatBN7.2 Rnor_6.0 3 142,779,533 - 142,779,674 NCBI Rnor6.0 Rnor_5.0 3 149,189,899 - 149,190,040 UniSTS Rnor5.0 RGSC_v3.4 3 137,189,263 - 137,189,404 UniSTS RGSC3.4 Celera 3 134,737,821 - 134,737,962 UniSTS Cytogenetic Map 3 q41 UniSTS
Ly68
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 135,897,842 - 135,898,180 (+) MAPPER mRatBN7.2 Rnor_6.0 3 142,783,239 - 142,783,576 NCBI Rnor6.0 Rnor_5.0 3 149,193,605 - 149,193,942 UniSTS Rnor5.0 RGSC_v3.4 3 137,192,922 - 137,193,259 UniSTS RGSC3.4 Celera 3 134,741,537 - 134,741,874 UniSTS Cytogenetic Map 3 q41 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000034256
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 3 142,781,424 - 142,783,593 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000076493
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 135,891,859 - 135,898,378 (-) Ensembl Rnor_6.0 Ensembl 3 142,778,770 - 142,783,774 (-) Ensembl
RefSeq Acc Id:
NM_053383 ⟹ NP_445835
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 156,345,019 - 156,351,537 (-) NCBI mRatBN7.2 3 135,891,859 - 135,898,378 (-) NCBI Rnor_6.0 3 142,778,798 - 142,783,774 (-) NCBI Rnor_5.0 3 149,189,164 - 149,194,140 (-) NCBI RGSC_v3.4 3 137,188,528 - 137,193,457 (-) RGD Celera 3 134,737,086 - 134,742,072 (-) RGD
Sequence:
AATTCCGTTGCTGTCGACGTGAAAAGCCTCGAGTCTTTGTAACCTTCTGTATGCCAGAGCTGTGGTAGTGTGACAGCGGCAGTGCAGCCCTCAGCTCCTTTCAGAGCACAGTCTGGTGCCAAGCTCCA
hide sequence
RefSeq Acc Id:
NP_445835 ⟸ NM_053383
- Peptide Label:
precursor
- UniProtKB:
Q9ET61 (UniProtKB/Swiss-Prot), Q9JIZ6 (UniProtKB/Swiss-Prot), A6K7C0 (UniProtKB/TrEMBL)
- Sequence:
MVTSTGLLLLLGLLGQLWAGAAADSEAVVCEGTACYTAHWGKLSAAEAQHRCNENGGNLATVKSEEEARHVQEALAQLLKTKAPSETKIGKFWIGLQREKGKCTYHDLPMKGFSWVGGGEDTTYSNWY
hide sequence
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-26
Cd93
CD93 molecule
Cd93
CD93 antigen
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-05-15
Cd93
CD93 antigen
C1qr1
complement component 1, q subcomponent, receptor 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
C1qr1
complement component 1, q subcomponent, receptor 1
lymphocyte antigen 68
Name updated
1299863 APPROVED
2004-09-10
C1qr1
lymphocyte antigen 68
Ly68
Symbol and Name updated
1299863 APPROVED
2002-08-07
Ly68
lymphocyte antigen 68
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
present on endothelial cells, platelets, undifferentiated monocytes (ED1+ cells), and circulating NK cells
633262
