Symbol:
Sorbs2
Name:
sorbin and SH3 domain containing 2
RGD ID:
620061
Description:
Predicted to enable identical protein binding activity and protein domain specific binding activity. Involved in cell growth involved in cardiac muscle cell development. Located in dendrite and neuronal cell body. Orthologous to human SORBS2 (sorbin and SH3 domain containing 2); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
arg-binding protein 2; arg/Abl-interacting protein 2; Arg/Abl-interacting protein ArgBP2; Argbp2; nArgBP2; neural ArgBP2; sorbin and SH3 domain-containing protein 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 53,167,795 - 53,481,300 (-) NCBI GRCr8 mRatBN7.2 16 46,435,220 - 46,748,743 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 46,435,237 - 46,626,514 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 51,837,443 - 52,028,439 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 55,206,227 - 55,397,004 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 50,476,834 - 50,667,832 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 49,626,205 - 49,820,223 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 49,626,205 - 49,820,235 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 49,355,585 - 49,545,430 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 49,722,539 - 49,917,550 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 49,722,613 - 49,917,626 (-) NCBI Celera 16 44,432,235 - 44,623,524 (-) NCBI Celera Cytogenetic Map 16 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sorbs2 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1550523 6480464 1,2-Dimethylhydrazine results in decreased expression of SORBS2 mRNA CTD PMID:22206623 Sorbs2 Rat 17alpha-ethynylestradiol decreases expression ISO RGD:732975 6480464 Ethinyl Estradiol results in decreased expression of SORBS2 mRNA CTD PMID:18936297 Sorbs2 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of SORBS2 mRNA CTD PMID:20170705|PMID:26865667 Sorbs2 Rat 17alpha-ethynylestradiol affects expression ISO RGD:732975 6480464 Ethinyl Estradiol affects the expression of SORBS2 mRNA CTD PMID:20170705|PMID:26865667 Sorbs2 Rat 17beta-estradiol decreases expression ISO RGD:732975 6480464 Estradiol results in decreased expression of SORBS2 mRNA CTD PMID:20106945 Sorbs2 Rat 17beta-estradiol increases expression ISO RGD:1550523 6480464 Estradiol results in increased expression of SORBS2 mRNA CTD PMID:39298647 Sorbs2 Rat 17beta-estradiol multiple interactions ISO RGD:732975 6480464 [Progesterone co-treated with Estradiol] results in increased expression of SORBS2 mRNA CTD PMID:17404688 Sorbs2 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:732975 6480464 2,2',4,4'-tetrabromodiphenyl ether analog results in increased expression of SORBS2 mRNA CTD PMID:19095052 Sorbs2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1550523 6480464 Tetrachlorodibenzodioxin affects the expression of SORBS2 mRNA CTD PMID:21570461 Sorbs2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SORBS2 mRNA CTD PMID:34747641 Sorbs2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1550523 6480464 Tetrachlorodibenzodioxin results in decreased expression of SORBS2 mRNA CTD PMID:19933214|PMID:26290441 Sorbs2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SORBS2 mRNA CTD PMID:20959002 Sorbs2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:1550523 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of SORBS2 mRNA CTD PMID:38648751 Sorbs2 Rat 2-butoxyethanol decreases expression ISO RGD:1550523 6480464 n-butoxyethanol results in decreased expression of SORBS2 mRNA CTD PMID:19812364 Sorbs2 Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:1550523 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of SORBS2 mRNA CTD PMID:26251327 Sorbs2 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1,2-dithiol-3-thione results in decreased expression of SORBS2 mRNA CTD PMID:19162173 Sorbs2 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1550523 6480464 bisphenol S results in increased expression of SORBS2 mRNA CTD PMID:39298647 Sorbs2 Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1550523 6480464 Fenretinide results in increased expression of SORBS2 mRNA CTD PMID:28973697 Sorbs2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SORBS2 mRNA CTD PMID:24780913 Sorbs2 Rat 7,12-dimethyltetraphene decreases expression ISO RGD:1550523 6480464 9,10-Dimethyl-1,2-benzanthracene metabolite results in decreased expression of SORBS2 mRNA CTD PMID:32553695 Sorbs2 Rat acrolein multiple interactions ISO RGD:732975 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ... CTD PMID:32699268 Sorbs2 Rat acrylamide affects expression EXP 6480464 Acrylamide affects the expression of SORBS2 mRNA CTD PMID:28959563 Sorbs2 Rat aflatoxin B1 affects expression ISO RGD:732975 6480464 Aflatoxin B1 affects the expression of SORBS2 protein CTD PMID:20106945 Sorbs2 Rat aflatoxin B1 increases methylation ISO RGD:732975 6480464 Aflatoxin B1 results in increased methylation of SORBS2 intron CTD PMID:30157460 Sorbs2 Rat aflatoxin B1 decreases methylation ISO RGD:732975 6480464 Aflatoxin B1 results in decreased methylation of SORBS2 exon; Aflatoxin B1 results in decreased methylation more ... CTD PMID:27153756|PMID:30157460 Sorbs2 Rat aflatoxin B1 decreases expression ISO RGD:732975 6480464 Aflatoxin B1 results in decreased expression of SORBS2 mRNA CTD PMID:21632981|PMID:21641981|PMID:22100608|PMID:27153756 Sorbs2 Rat aflatoxin B1 decreases expression ISO RGD:1550523 6480464 Aflatoxin B1 results in decreased expression of SORBS2 mRNA CTD PMID:19770486 Sorbs2 Rat aflatoxin M1 decreases expression ISO RGD:732975 6480464 Aflatoxin M1 results in decreased expression of SORBS2 mRNA CTD PMID:30928695 Sorbs2 Rat all-trans-retinoic acid decreases expression ISO RGD:732975 6480464 Tretinoin results in decreased expression of SORBS2 mRNA CTD PMID:21934132|PMID:23724009 Sorbs2 Rat alpha-pinene multiple interactions ISO RGD:732975 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ... CTD PMID:32699268 Sorbs2 Rat asbestos affects expression ISO RGD:732975 6480464 Asbestos affects the expression of SORBS2 mRNA CTD PMID:17297452 Sorbs2 Rat azathioprine decreases expression ISO RGD:732975 6480464 Azathioprine results in decreased expression of SORBS2 mRNA CTD PMID:22623647 Sorbs2 Rat benzene-1,2,4-triol decreases expression ISO RGD:732975 6480464 hydroxyhydroquinone results in decreased expression of SORBS2 mRNA CTD PMID:39245080 Sorbs2 Rat benzo[a]pyrene increases mutagenesis ISO RGD:732975 6480464 Benzo(a)pyrene results in increased mutagenesis of SORBS2 gene CTD PMID:25435355 Sorbs2 Rat benzo[a]pyrene affects methylation ISO RGD:732975 6480464 Benzo(a)pyrene affects the methylation of SORBS2 5' UTR; Benzo(a)pyrene affects the methylation of SORBS2 intron; more ... CTD PMID:27901495|PMID:30157460 Sorbs2 Rat benzo[a]pyrene decreases expression ISO RGD:732975 6480464 Benzo(a)pyrene results in decreased expression of SORBS2 mRNA CTD PMID:20106945|PMID:21632981|PMID:22316170|PMID:26238291|PMID:32234424 Sorbs2 Rat benzo[a]pyrene decreases expression ISO RGD:1550523 6480464 Benzo(a)pyrene metabolite results in decreased expression of SORBS2 mRNA; Benzo(a)pyrene results in decreased expression of more ... CTD PMID:19770486|PMID:20713471|PMID:21715664|PMID:32553695 Sorbs2 Rat benzo[e]pyrene increases methylation ISO RGD:732975 6480464 benzo(e)pyrene results in increased methylation of SORBS2 intron CTD PMID:30157460 Sorbs2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:732975 6480464 Diethylhexyl Phthalate results in decreased expression of SORBS2 mRNA CTD PMID:31163220 Sorbs2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1550523 6480464 Diethylhexyl Phthalate results in decreased expression of SORBS2 mRNA CTD PMID:33754040 Sorbs2 Rat bisphenol A affects expression ISO RGD:732975 6480464 bisphenol A affects the expression of SORBS2 mRNA CTD PMID:20170705|PMID:30903817 Sorbs2 Rat bisphenol A increases expression ISO RGD:732975 6480464 bisphenol A results in increased expression of SORBS2 protein CTD PMID:37567409 Sorbs2 Rat bisphenol A decreases expression ISO RGD:1550523 6480464 bisphenol A results in decreased expression of SORBS2 mRNA CTD PMID:38074096 Sorbs2 Rat bisphenol A decreases methylation ISO RGD:732975 6480464 bisphenol A results in decreased methylation of SORBS2 gene CTD PMID:31601247 Sorbs2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SORBS2 mRNA CTD PMID:32145629 Sorbs2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SORBS2 mRNA CTD PMID:25181051 Sorbs2 Rat buta-1,3-diene decreases expression ISO RGD:1550523 6480464 1,3-butadiene results in decreased expression of SORBS2 mRNA CTD PMID:29038090 Sorbs2 Rat cadmium atom multiple interactions ISO RGD:732975 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SORBS2 more ... CTD PMID:35301059 Sorbs2 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of SORBS2 promoter CTD PMID:22457795 Sorbs2 Rat cadmium dichloride multiple interactions ISO RGD:732975 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SORBS2 more ... CTD PMID:35301059 Sorbs2 Rat cadmium dichloride decreases expression ISO RGD:732975 6480464 Cadmium Chloride results in decreased expression of SORBS2 mRNA CTD PMID:38568856 Sorbs2 Rat caffeine affects phosphorylation ISO RGD:732975 6480464 Caffeine affects the phosphorylation of SORBS2 protein CTD PMID:35688186 Sorbs2 Rat cantharidin decreases expression ISO RGD:1550523 6480464 Cantharidin results in decreased expression of SORBS2 mRNA CTD PMID:36907384 Sorbs2 Rat carmustine decreases expression ISO RGD:732975 6480464 Carmustine results in decreased expression of SORBS2 mRNA CTD PMID:15980968 Sorbs2 Rat CGP 52608 multiple interactions ISO RGD:732975 6480464 CGP 52608 promotes the reaction [RORA protein binds to SORBS2 gene] CTD PMID:28238834 Sorbs2 Rat ciguatoxin CTX1B affects expression ISO RGD:1550523 6480464 Ciguatoxins affects the expression of SORBS2 mRNA CTD PMID:18353800 Sorbs2 Rat cisplatin increases expression ISO RGD:1550523 6480464 Cisplatin results in increased expression of SORBS2 mRNA CTD PMID:21151649 Sorbs2 Rat cobalt dichloride decreases expression ISO RGD:732975 6480464 cobaltous chloride results in decreased expression of SORBS2 mRNA CTD PMID:19320972 Sorbs2 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of SORBS2 mRNA CTD PMID:24386269 Sorbs2 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of SORBS2 mRNA CTD PMID:30556269 Sorbs2 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of SORBS2 mRNA CTD PMID:30556269 Sorbs2 Rat copper(II) chloride decreases expression ISO RGD:732975 6480464 cupric chloride results in decreased expression of SORBS2 mRNA CTD PMID:38568856 Sorbs2 Rat copper(II) sulfate decreases expression ISO RGD:732975 6480464 Copper Sulfate results in decreased expression of SORBS2 mRNA CTD PMID:19549813 Sorbs2 Rat corticosterone increases expression EXP 6480464 Corticosterone results in increased expression of SORBS2 mRNA CTD PMID:15755911 Sorbs2 Rat coumarin affects phosphorylation ISO RGD:732975 6480464 coumarin affects the phosphorylation of SORBS2 protein CTD PMID:35688186 Sorbs2 Rat cyclosporin A decreases expression ISO RGD:732975 6480464 Cyclosporine results in decreased expression of SORBS2 mRNA CTD PMID:20106945|PMID:25562108 Sorbs2 Rat cytarabine increases expression ISO RGD:732975 6480464 Cytarabine results in increased expression of SORBS2 mRNA CTD PMID:21198554 Sorbs2 Rat deoxynivalenol decreases phosphorylation ISO RGD:1550523 6480464 deoxynivalenol results in decreased phosphorylation of SORBS2 protein CTD PMID:23811945 Sorbs2 Rat dibutyl phthalate increases expression ISO RGD:1550523 6480464 Dibutyl Phthalate results in increased expression of SORBS2 mRNA CTD PMID:21266533 Sorbs2 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of SORBS2 mRNA CTD PMID:21266533 Sorbs2 Rat dioxygen increases expression ISO RGD:732975 6480464 Oxygen deficiency results in increased expression of SORBS2 mRNA CTD PMID:26516004 Sorbs2 Rat dorsomorphin multiple interactions ISO RGD:732975 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Sorbs2 Rat doxorubicin decreases expression ISO RGD:732975 6480464 Doxorubicin results in decreased expression of SORBS2 mRNA CTD PMID:29803840 Sorbs2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of SORBS2 mRNA CTD PMID:29391264 Sorbs2 Rat ethanol affects splicing ISO RGD:1550523 6480464 Ethanol affects the splicing of SORBS2 mRNA CTD PMID:30319688 Sorbs2 Rat etoposide affects response to substance ISO RGD:732975 6480464 SORBS2 protein affects the susceptibility to Etoposide CTD PMID:16217747 Sorbs2 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of SORBS2 mRNA CTD PMID:24793618 Sorbs2 Rat FR900359 affects phosphorylation ISO RGD:732975 6480464 FR900359 affects the phosphorylation of SORBS2 protein CTD PMID:37730182 Sorbs2 Rat genistein affects expression ISO RGD:732975 6480464 Genistein affects the expression of SORBS2 mRNA CTD PMID:26865667 Sorbs2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of SORBS2 mRNA CTD PMID:33387578 Sorbs2 Rat lead(0) affects expression ISO RGD:732975 6480464 Lead affects the expression of SORBS2 mRNA CTD PMID:28903495 Sorbs2 Rat Licochalcone B decreases expression ISO RGD:732975 6480464 licochalcone B results in decreased expression of SORBS2 mRNA CTD PMID:33647349 Sorbs2 Rat methapyrilene increases methylation ISO RGD:732975 6480464 Methapyrilene results in increased methylation of SORBS2 intron CTD PMID:30157460 Sorbs2 Rat methylmercury chloride increases expression ISO RGD:732975 6480464 methylmercuric chloride results in increased expression of SORBS2 mRNA CTD PMID:23179753|PMID:28001369 Sorbs2 Rat mono(2-ethylhexyl) phthalate decreases expression ISO RGD:1550523 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of SORBS2 mRNA CTD PMID:22401849 Sorbs2 Rat nickel atom decreases expression ISO RGD:732975 6480464 Nickel results in decreased expression of SORBS2 mRNA CTD PMID:24768652|PMID:25583101 Sorbs2 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of SORBS2 mRNA CTD PMID:24136188 Sorbs2 Rat okadaic acid decreases expression ISO RGD:732975 6480464 Okadaic Acid results in decreased expression of SORBS2 mRNA CTD PMID:38832940 Sorbs2 Rat ozone multiple interactions ISO RGD:732975 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ... CTD PMID:32699268 Sorbs2 Rat paracetamol decreases expression ISO RGD:732975 6480464 Acetaminophen results in decreased expression of SORBS2 mRNA CTD PMID:21420995|PMID:22230336|PMID:29067470 Sorbs2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SORBS2 mRNA CTD PMID:33387578 Sorbs2 Rat perfluorohexanesulfonic acid increases expression ISO RGD:1550523 6480464 perfluorohexanesulfonic acid results in increased expression of SORBS2 mRNA CTD PMID:37995155 Sorbs2 Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of SORBS2 mRNA CTD PMID:19162173 Sorbs2 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of SORBS2 mRNA CTD PMID:19162173 Sorbs2 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of SORBS2 mRNA CTD PMID:19162173 Sorbs2 Rat phenobarbital affects expression ISO RGD:1550523 6480464 Phenobarbital affects the expression of SORBS2 mRNA CTD PMID:23091169 Sorbs2 Rat phenylmercury acetate increases expression ISO RGD:732975 6480464 Phenylmercuric Acetate results in increased expression of SORBS2 mRNA CTD PMID:26272509 Sorbs2 Rat phenylmercury acetate multiple interactions ISO RGD:732975 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Sorbs2 Rat progesterone increases expression ISO RGD:732975 6480464 Progesterone results in increased expression of SORBS2 mRNA CTD PMID:17404688 Sorbs2 Rat progesterone decreases expression ISO RGD:732975 6480464 Progesterone results in decreased expression of SORBS2 mRNA CTD PMID:21540246 Sorbs2 Rat progesterone multiple interactions ISO RGD:732975 6480464 [Progesterone co-treated with Estradiol] results in increased expression of SORBS2 mRNA CTD PMID:17404688 Sorbs2 Rat quercetin decreases expression ISO RGD:732975 6480464 Quercetin results in decreased expression of SORBS2 mRNA CTD PMID:21632981 Sorbs2 Rat rimonabant affects expression ISO RGD:1550523 6480464 Rimonabant affects the expression of SORBS2 mRNA CTD PMID:19030233 Sorbs2 Rat SB 431542 multiple interactions ISO RGD:732975 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Sorbs2 Rat silicon dioxide decreases expression ISO RGD:732975 6480464 Silicon Dioxide analog results in decreased expression of SORBS2 mRNA CTD PMID:25895662 Sorbs2 Rat silver atom decreases expression ISO RGD:1550523 6480464 Silver results in decreased expression of SORBS2 mRNA CTD PMID:27131904 Sorbs2 Rat silver(0) decreases expression ISO RGD:1550523 6480464 Silver results in decreased expression of SORBS2 mRNA CTD PMID:27131904 Sorbs2 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of SORBS2 protein CTD PMID:29459688 Sorbs2 Rat sodium arsenite decreases expression ISO RGD:1550523 6480464 sodium arsenite results in decreased expression of SORBS2 mRNA CTD PMID:37682722 Sorbs2 Rat sodium arsenite increases methylation ISO RGD:732975 6480464 sodium arsenite results in increased methylation of SORBS2 intron CTD PMID:32844245 Sorbs2 Rat sodium arsenite decreases expression ISO RGD:732975 6480464 sodium arsenite results in decreased expression of SORBS2 mRNA CTD PMID:29301061|PMID:32844245 Sorbs2 Rat succimer multiple interactions ISO RGD:1550523 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of SORBS2 mRNA CTD PMID:26378955 Sorbs2 Rat sulforaphane increases expression ISO RGD:1550523 6480464 sulforaphane results in increased expression of SORBS2 mRNA CTD PMID:30529165 Sorbs2 Rat sulforaphane decreases expression ISO RGD:732975 6480464 sulforaphane results in decreased expression of SORBS2 mRNA CTD PMID:31838189 Sorbs2 Rat sunitinib decreases expression ISO RGD:732975 6480464 Sunitinib results in decreased expression of SORBS2 mRNA CTD PMID:31533062 Sorbs2 Rat testosterone decreases expression ISO RGD:732975 6480464 Testosterone results in decreased expression of SORBS2 mRNA CTD PMID:33359661 Sorbs2 Rat tetrachloromethane affects expression ISO RGD:1550523 6480464 Carbon Tetrachloride affects the expression of SORBS2 mRNA CTD PMID:17484886|PMID:31919559 Sorbs2 Rat thimerosal increases expression ISO RGD:732975 6480464 Thimerosal results in increased expression of SORBS2 mRNA CTD PMID:27188386 Sorbs2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SORBS2 mRNA CTD PMID:34492290 Sorbs2 Rat thiram decreases expression ISO RGD:732975 6480464 Thiram results in decreased expression of SORBS2 mRNA CTD PMID:38568856 Sorbs2 Rat titanium dioxide decreases expression ISO RGD:1550523 6480464 titanium dioxide results in decreased expression of SORBS2 mRNA CTD PMID:23557971 Sorbs2 Rat trichloroethene decreases methylation EXP 6480464 Trichloroethylene results in decreased methylation of SORBS2 gene CTD PMID:27618143 Sorbs2 Rat trichostatin A decreases expression ISO RGD:732975 6480464 trichostatin A results in decreased expression of SORBS2 mRNA CTD PMID:24935251 Sorbs2 Rat trichostatin A increases expression ISO RGD:732975 6480464 trichostatin A results in increased expression of SORBS2 mRNA CTD PMID:24935251|PMID:26705709 Sorbs2 Rat triclosan decreases expression ISO RGD:732975 6480464 Triclosan results in decreased expression of SORBS2 mRNA CTD PMID:30510588 Sorbs2 Rat triptonide decreases expression ISO RGD:1550523 6480464 triptonide results in decreased expression of SORBS2 mRNA CTD PMID:33045310 Sorbs2 Rat undecane increases expression EXP 6480464 undecane results in increased expression of SORBS2 protein CTD PMID:17337753 Sorbs2 Rat urethane decreases expression ISO RGD:732975 6480464 Urethane results in decreased expression of SORBS2 mRNA CTD PMID:28818685 Sorbs2 Rat valproic acid decreases methylation ISO RGD:732975 6480464 Valproic Acid results in decreased methylation of SORBS2 gene CTD PMID:29154799 Sorbs2 Rat valproic acid affects expression ISO RGD:732975 6480464 Valproic Acid affects the expression of SORBS2 mRNA CTD PMID:26272509 Sorbs2 Rat valproic acid increases methylation ISO RGD:732975 6480464 Valproic Acid results in increased methylation of SORBS2 gene CTD PMID:29501571 Sorbs2 Rat valproic acid increases expression ISO RGD:732975 6480464 Valproic Acid results in increased expression of SORBS2 mRNA CTD PMID:23179753|PMID:24383497 Sorbs2 Rat valproic acid decreases expression ISO RGD:732975 6480464 Valproic Acid results in decreased expression of SORBS2 mRNA; Valproic Acid results in decreased expression more ... CTD PMID:24935251|PMID:29154799|PMID:29501571 Sorbs2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of SORBS2 mRNA CTD PMID:23034163
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Sorbs2 Rat identical protein binding enables ISO RGD:732975,UniProtKB:O94875-10 1624291 UniProtKB:O94875-10 PMID:32296183 RGD PMID:32296183 Sorbs2 Rat protein binding enables ISO RGD:732975,UniProtKB:O94875-10 1624291 UniProtKB:A5D8V6|UniProtKB:O00401|UniProtKB:O14512|UniProtKB:O15372|UniProtKB:O43281-2|UniProtKB:O43707|UniProtKB:Q08379|UniProtKB:Q13191|UniProtKB:Q8IZP0-5|UniProtKB:Q8N5M1|UniProtKB:Q96N21|UniProtKB:Q9Y2H0-1 PMID:25910212, PMID:32296183 RGD PMID:25910212|PMID:32296183 Sorbs2 Rat protein binding enables ISO RGD:1550523 1624291 PR:P47941 PMID:26527617 RGD PMID:26527617 Sorbs2 Rat protein binding enables ISO RGD:732975 1624291 UniProtKB:A5D8V6|UniProtKB:O43281|UniProtKB:O43639|UniProtKB:P31947|UniProtKB:P42768|UniProtKB:P62258|UniProtKB:P63104|UniProtKB:Q13177|UniProtKB:Q8N5M1|UniProtKB:Q8WX93|UniProtKB:Q9H788-2|UniProtKB:Q9WMX2-PRO_0000037551|UniProtKB:V9HW98 PMID:15161933, PMID:15778465, PMID:16125169, PMID:16189514, PMID:16374509, PMID:18985028, PMID:21988832, PMID:25416956, PMID:36931259 RGD PMID:15161933|PMID:15778465|PMID:16125169|PMID:16189514|PMID:16374509|PMID:18985028|PMID:21988832|PMID:25416956|PMID:36931259 Sorbs2 Rat protein domain specific binding enables ISO RGD:1550523 1624291 PR:P10126 PMID:21689717 RGD PMID:21689717
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-butoxyethanol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) acrolein (ISO) acrylamide (EXP) aflatoxin B1 (ISO) aflatoxin M1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) asbestos (ISO) azathioprine (ISO) benzene-1,2,4-triol (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) cantharidin (ISO) carmustine (ISO) CGP 52608 (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) cobalt dichloride (EXP,ISO) copper atom (EXP) copper(0) (EXP) copper(II) chloride (ISO) copper(II) sulfate (ISO) corticosterone (EXP) coumarin (ISO) cyclosporin A (ISO) cytarabine (ISO) deoxynivalenol (ISO) dibutyl phthalate (EXP,ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) etoposide (ISO) flutamide (EXP) FR900359 (ISO) genistein (ISO) gentamycin (EXP) lead(0) (ISO) Licochalcone B (ISO) methapyrilene (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) nickel atom (ISO) nimesulide (EXP) okadaic acid (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (EXP) phenobarbital (EXP,ISO) phenylmercury acetate (ISO) progesterone (ISO) quercetin (ISO) rimonabant (ISO) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (EXP,ISO) succimer (ISO) sulforaphane (ISO) sunitinib (ISO) testosterone (ISO) tetrachloromethane (ISO) thimerosal (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) triptonide (ISO) undecane (EXP) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
1.
Cardiac fibroblast-derived microRNA passenger strand-enriched exosomes mediate cardiomyocyte hypertrophy.
Bang C, etal., J Clin Invest. 2014 May;124(5):2136-46. doi: 10.1172/JCI70577. Epub 2014 Apr 17.
2.
The Abl/Arg substrate ArgBP2/nArgBP2 coordinates the function of multiple regulatory mechanisms converging on the actin cytoskeleton.
Cestra G, etal., Proc Natl Acad Sci U S A. 2005 Feb 1;102(5):1731-6. Epub 2005 Jan 19.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
nArgBP2, a novel neural member of ponsin/ArgBP2/vinexin family that interacts with synapse-associated protein 90/postsynaptic density-95-associated protein (SAPAP).
Kawabe H, etal., J Biol Chem 1999 Oct 22;274(43):30914-8.
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
CAP (Cbl associated protein) regulates receptor-mediated endocytosis.
Tosoni D and Cestra G, FEBS Lett. 2009 Jan 22;583(2):293-300. doi: 10.1016/j.febslet.2008.12.047. Epub 2008 Dec 29.
Sorbs2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 53,167,795 - 53,481,300 (-) NCBI GRCr8 mRatBN7.2 16 46,435,220 - 46,748,743 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 46,435,237 - 46,626,514 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 51,837,443 - 52,028,439 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 55,206,227 - 55,397,004 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 50,476,834 - 50,667,832 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 49,626,205 - 49,820,223 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 49,626,205 - 49,820,235 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 49,355,585 - 49,545,430 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 49,722,539 - 49,917,550 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 49,722,613 - 49,917,626 (-) NCBI Celera 16 44,432,235 - 44,623,524 (-) NCBI Celera Cytogenetic Map 16 q11 NCBI
SORBS2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 185,585,523 - 185,956,372 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 185,585,444 - 185,956,652 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 186,506,677 - 186,877,526 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 186,743,592 - 187,114,516 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 186,883,307 - 187,252,671 NCBI Celera 4 183,831,196 - 184,201,888 (-) NCBI Celera Cytogenetic Map 4 q35.1 NCBI HuRef 4 182,259,256 - 182,629,702 (-) NCBI HuRef CHM1_1 4 186,483,030 - 186,854,309 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 188,926,307 - 189,297,353 (-) NCBI T2T-CHM13v2.0
Sorbs2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 45,960,470 - 46,280,943 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 45,960,825 - 46,280,943 (+) Ensembl GRCm39 Ensembl GRCm38 8 45,507,788 - 45,827,906 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 45,507,788 - 45,827,906 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 46,593,149 - 46,913,258 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 47,006,441 - 47,326,723 (+) NCBI MGSCv36 mm8 Celera 8 48,191,097 - 48,511,228 (+) NCBI Celera Cytogenetic Map 8 B1.1 NCBI cM Map 8 25.44 NCBI
Sorbs2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 23,371,143 - 23,503,654 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 23,295,887 - 23,503,654 (+) NCBI ChiLan1.0 ChiLan1.0
SORBS2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 183,323,194 - 183,696,934 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 183,671,541 - 184,046,607 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 177,751,089 - 178,125,937 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 189,965,729 - 190,335,930 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 189,965,729 - 190,070,543 (-) Ensembl panpan1.1 panPan2
SORBS2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 44,847,384 - 45,063,218 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 44,717,052 - 45,061,337 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 16 45,333,197 - 45,548,530 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 47,061,067 - 47,276,497 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 46,931,094 - 47,276,497 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 45,029,526 - 45,244,827 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 45,641,875 - 45,857,362 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 45,773,830 - 45,988,803 (+) NCBI UU_Cfam_GSD_1.0
Sorbs2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404943 34,312,658 - 34,634,656 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936554 3,593,512 - 3,797,555 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936554 3,593,607 - 3,797,324 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SORBS2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 46,585,602 - 46,795,038 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 46,585,599 - 46,910,679 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 53,377,736 - 53,516,595 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SORBS2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 131,522,390 - 131,895,835 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 131,521,298 - 131,749,949 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 111,789,062 - 112,214,360 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sorbs2
.
Predicted Target Of
Count of predictions: 358 Count of miRNA genes: 235 Interacting mature miRNAs: 271 Transcripts: ENSRNOT00000029628, ENSRNOT00000068069 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2300163 Bmd64 Bone mineral density QTL 64 5.3 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 16 37752156 82752156 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70215 Niddm29 Non-insulin dependent diabetes mellitus QTL 29 3.54 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 16 19004435 75226532 Rat 1578768 Stresp22 Stress response QTL 22 2.8 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 16 35288870 80288870 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 2302057 Pia29 Pristane induced arthritis QTL 29 3.6 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 16 21735975 66735975 Rat 7205510 Activ5 Activity QTL 5 3.78 0.00028 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 42396345 84729064 Rat 737819 Hcas4 Hepatocarcinoma susceptibility QTL 4 4.43 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 16 4227609 46975965 Rat 631833 Sach2 Saccharin preference QTL 2 4 0.01 consumption behavior trait (VT:0002069) calculated saccharin drink intake rate (CMO:0001613) 16 43024842 50166018 Rat 8694453 Bw172 Body weight QTL 172 8.33 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 16 24325513 69325513 Rat 1298529 Arunc1 Aerobic running capacity QTL 1 4 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 31951520 60148445 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 6903294 Stl30 Serum triglyceride level QTL 30 2.6 0.0013 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 16 25152793 70152793 Rat 2293690 Bss45 Bone structure and strength QTL 45 5.13 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 16 37752156 82752156 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
AW532810
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 46,596,775 - 46,596,931 (+) MAPPER mRatBN7.2 Rnor_6.0 16 49,794,030 - 49,794,186 NCBI Rnor6.0 Rnor_6.0 16 49,788,653 - 49,788,807 NCBI Rnor6.0 Celera 16 44,593,745 - 44,593,900 UniSTS RH 3.4 Map 16 457.0 UniSTS Cytogenetic Map 16 q11 UniSTS
BE109620
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 46,471,079 - 46,471,234 (+) MAPPER mRatBN7.2 Rnor_6.0 16 49,662,015 - 49,662,169 NCBI Rnor6.0 Rnor_5.0 16 49,391,395 - 49,391,549 UniSTS Rnor5.0 RGSC_v3.4 16 49,758,349 - 49,758,503 UniSTS RGSC3.4 Celera 16 44,468,049 - 44,468,203 UniSTS RH 3.4 Map 16 456.9 UniSTS Cytogenetic Map 16 q11 UniSTS
AW434052
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 46,435,276 - 46,435,467 (+) MAPPER mRatBN7.2 Rnor_6.0 16 49,626,213 - 49,626,403 NCBI Rnor6.0 Rnor_5.0 16 49,355,593 - 49,355,783 UniSTS Rnor5.0 RGSC_v3.4 16 49,722,547 - 49,722,737 UniSTS RGSC3.4 Celera 16 44,432,243 - 44,432,433 UniSTS RH 3.4 Map 16 457.0 UniSTS Cytogenetic Map 16 q11 UniSTS
BE114613
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 46,546,851 - 46,547,024 (+) MAPPER mRatBN7.2 Rnor_6.0 16 49,737,769 - 49,737,941 NCBI Rnor6.0 Rnor_5.0 16 49,466,481 - 49,466,653 UniSTS Rnor5.0 RGSC_v3.4 16 49,834,146 - 49,834,318 UniSTS RGSC3.4 Celera 16 44,543,702 - 44,543,874 UniSTS RH 3.4 Map 16 457.3 UniSTS Cytogenetic Map 16 q11 UniSTS
D8Mit297
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 46,596,211 - 46,596,325 (+) MAPPER mRatBN7.2 Rnor_6.0 16 49,788,421 - 49,788,534 NCBI Rnor6.0 Rnor_5.0 16 49,515,948 - 49,516,061 UniSTS Rnor5.0 Cytogenetic Map 16 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000029628 ⟹ ENSRNOP00000029182
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 46,435,269 - 46,626,450 (-) Ensembl Rnor_6.0 Ensembl 16 49,626,205 - 49,820,235 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096919 ⟹ ENSRNOP00000090759
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 46,435,237 - 46,626,514 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111098 ⟹ ENSRNOP00000078055
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 46,435,269 - 46,514,234 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111730 ⟹ ENSRNOP00000094779
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 46,435,457 - 46,626,021 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000113085 ⟹ ENSRNOP00000091476
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 46,435,237 - 46,626,514 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115009 ⟹ ENSRNOP00000089017
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 46,435,237 - 46,626,514 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115122 ⟹ ENSRNOP00000080598
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 46,435,237 - 46,626,514 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116775 ⟹ ENSRNOP00000083015
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 46,435,237 - 46,567,298 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118135 ⟹ ENSRNOP00000077815
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 46,442,367 - 46,626,514 (-) Ensembl
RefSeq Acc Id:
NM_053770 ⟹ NP_446222
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,827 - 53,358,983 (-) NCBI mRatBN7.2 16 46,435,269 - 46,626,447 (-) NCBI Rnor_6.0 16 49,626,205 - 49,820,223 (-) NCBI Rnor_5.0 16 49,355,585 - 49,545,430 (-) NCBI RGSC_v3.4 16 49,722,539 - 49,917,550 (-) RGD Celera 16 44,432,235 - 44,623,524 (-) RGD
Sequence:
GAATTCGGCACGAGGAAAAATCTTTGGAGAGAAGAGAGCCACAGTGAGCACGCTAGTGCACAATTATTGCAGCCACGTGTGCCCGCAAGCTGGCCCTGCGACAAGCTGTTGAGTGCTGTTGCAATTAG
hide sequence
RefSeq Acc Id:
XM_039094137 ⟹ XP_038950065
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,481,300 (-) NCBI mRatBN7.2 16 46,435,220 - 46,559,755 (-) NCBI
RefSeq Acc Id:
XM_039094138 ⟹ XP_038950066
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI mRatBN7.2 16 46,435,220 - 46,559,758 (-) NCBI
RefSeq Acc Id:
XM_063274989 ⟹ XP_063131059
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063274991 ⟹ XP_063131061
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063274992 ⟹ XP_063131062
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063274993 ⟹ XP_063131063
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063274994 ⟹ XP_063131064
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063274995 ⟹ XP_063131065
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063274996 ⟹ XP_063131066
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063274997 ⟹ XP_063131067
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063274998 ⟹ XP_063131068
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063274999 ⟹ XP_063131069
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275000 ⟹ XP_063131070
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275002 ⟹ XP_063131072
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,481,279 (-) NCBI
RefSeq Acc Id:
XM_063275003 ⟹ XP_063131073
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275004 ⟹ XP_063131074
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275005 ⟹ XP_063131075
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275006 ⟹ XP_063131076
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275007 ⟹ XP_063131077
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275008 ⟹ XP_063131078
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275009 ⟹ XP_063131079
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275010 ⟹ XP_063131080
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275011 ⟹ XP_063131081
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275012 ⟹ XP_063131082
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275013 ⟹ XP_063131083
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275014 ⟹ XP_063131084
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275015 ⟹ XP_063131085
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275016 ⟹ XP_063131086
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275017 ⟹ XP_063131087
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275018 ⟹ XP_063131088
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275019 ⟹ XP_063131089
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275020 ⟹ XP_063131090
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275021 ⟹ XP_063131091
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275022 ⟹ XP_063131092
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275023 ⟹ XP_063131093
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275024 ⟹ XP_063131094
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275025 ⟹ XP_063131095
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275026 ⟹ XP_063131096
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275027 ⟹ XP_063131097
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275028 ⟹ XP_063131098
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275029 ⟹ XP_063131099
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275030 ⟹ XP_063131100
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275031 ⟹ XP_063131101
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275032 ⟹ XP_063131102
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275033 ⟹ XP_063131103
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275034 ⟹ XP_063131104
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275035 ⟹ XP_063131105
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275036 ⟹ XP_063131106
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
XM_063275037 ⟹ XP_063131107
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,167,795 - 53,359,893 (-) NCBI
RefSeq Acc Id:
NP_446222 ⟸ NM_053770
- UniProtKB:
Q923T8 (UniProtKB/Swiss-Prot), O35413 (UniProtKB/Swiss-Prot)
- Sequence:
MNTDSGGCARKRAAMSVTLTSVKRVQSSPNLLAAGRESHSPDSAWRSYNGRNPETLNGDATYSSLAAKGFRSVRPNLQDKKSPTQSHITINGNSGGAVSPVSYYQRPFSPSAYSLPASLNSSIIMPHG
hide sequence
Ensembl Acc Id:
ENSRNOP00000029182 ⟸ ENSRNOT00000029628
RefSeq Acc Id:
XP_038950066 ⟸ XM_039094138
- Peptide Label:
isoform X16
- UniProtKB:
Q923T8 (UniProtKB/Swiss-Prot), O35413 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038950065 ⟸ XM_039094137
- Peptide Label:
isoform X15
- UniProtKB:
Q923T8 (UniProtKB/Swiss-Prot), O35413 (UniProtKB/Swiss-Prot), A6JPR1 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000091476 ⟸ ENSRNOT00000113085
Ensembl Acc Id:
ENSRNOP00000080598 ⟸ ENSRNOT00000115122
Ensembl Acc Id:
ENSRNOP00000094779 ⟸ ENSRNOT00000111730
Ensembl Acc Id:
ENSRNOP00000089017 ⟸ ENSRNOT00000115009
Ensembl Acc Id:
ENSRNOP00000078055 ⟸ ENSRNOT00000111098
Ensembl Acc Id:
ENSRNOP00000077815 ⟸ ENSRNOT00000118135
Ensembl Acc Id:
ENSRNOP00000083015 ⟸ ENSRNOT00000116775
Ensembl Acc Id:
ENSRNOP00000090759 ⟸ ENSRNOT00000096919
RefSeq Acc Id:
XP_063131072 ⟸ XM_063275002
- Peptide Label:
isoform X12
- UniProtKB:
Q923T8 (UniProtKB/Swiss-Prot), O35413 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063131106 ⟸ XM_063275036
- Peptide Label:
isoform X46
- UniProtKB:
A0A8I5ZQ23 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131104 ⟸ XM_063275034
- Peptide Label:
isoform X44
- UniProtKB:
A0A8I5ZV05 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131101 ⟸ XM_063275031
- Peptide Label:
isoform X41
- UniProtKB:
A6JPQ9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131102 ⟸ XM_063275032
- Peptide Label:
isoform X42
- UniProtKB:
A6JPR0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131099 ⟸ XM_063275029
- Peptide Label:
isoform X40
- UniProtKB:
A6JPR0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131098 ⟸ XM_063275028
- Peptide Label:
isoform X39
- UniProtKB:
A6JPR0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131089 ⟸ XM_063275019
- Peptide Label:
isoform X31
- UniProtKB:
A0A8I5ZQ23 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131097 ⟸ XM_063275027
- Peptide Label:
isoform X38
- UniProtKB:
A6JPR0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131095 ⟸ XM_063275025
- Peptide Label:
isoform X37
- UniProtKB:
A6JPR0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131094 ⟸ XM_063275024
- Peptide Label:
isoform X36
- UniProtKB:
A6JPR0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131075 ⟸ XM_063275005
- Peptide Label:
isoform X17
- UniProtKB:
Q923T8 (UniProtKB/Swiss-Prot), O35413 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063131088 ⟸ XM_063275018
- Peptide Label:
isoform X30
- UniProtKB:
A6JPR0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131087 ⟸ XM_063275017
- Peptide Label:
isoform X29
- UniProtKB:
A6JPR0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131080 ⟸ XM_063275010
- Peptide Label:
isoform X22
- UniProtKB:
A0A8I6AA99 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131079 ⟸ XM_063275009
- Peptide Label:
isoform X21
- UniProtKB:
A0A8I6AA99 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131093 ⟸ XM_063275023
- Peptide Label:
isoform X35
- UniProtKB:
A6JPR0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131092 ⟸ XM_063275022
- Peptide Label:
isoform X34
- UniProtKB:
A6JPR0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131074 ⟸ XM_063275004
- Peptide Label:
isoform X14
- UniProtKB:
Q923T8 (UniProtKB/Swiss-Prot), O35413 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063131086 ⟸ XM_063275016
- Peptide Label:
isoform X28
- UniProtKB:
A0A8I5ZQ23 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131091 ⟸ XM_063275021
- Peptide Label:
isoform X33
- UniProtKB:
A6JPR0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131073 ⟸ XM_063275003
- Peptide Label:
isoform X13
- UniProtKB:
Q923T8 (UniProtKB/Swiss-Prot), O35413 (UniProtKB/Swiss-Prot), F1LPM3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131070 ⟸ XM_063275000
- Peptide Label:
isoform X11
- UniProtKB:
Q923T8 (UniProtKB/Swiss-Prot), O35413 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063131085 ⟸ XM_063275015
- Peptide Label:
isoform X27
- UniProtKB:
A6JPR0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131084 ⟸ XM_063275014
- Peptide Label:
isoform X26
- UniProtKB:
A6JPR0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131068 ⟸ XM_063274998
- Peptide Label:
isoform X9
- UniProtKB:
Q923T8 (UniProtKB/Swiss-Prot), O35413 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063131067 ⟸ XM_063274997
- Peptide Label:
isoform X8
- UniProtKB:
Q923T8 (UniProtKB/Swiss-Prot), O35413 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063131083 ⟸ XM_063275013
- Peptide Label:
isoform X25
- UniProtKB:
A0A8I6AFA3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131082 ⟸ XM_063275012
- Peptide Label:
isoform X24
- UniProtKB:
A0A8I6AFA3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131066 ⟸ XM_063274996
- Peptide Label:
isoform X7
- UniProtKB:
Q923T8 (UniProtKB/Swiss-Prot), O35413 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063131081 ⟸ XM_063275011
- Peptide Label:
isoform X23
- UniProtKB:
A0A8I6AA99 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131078 ⟸ XM_063275008
- Peptide Label:
isoform X20
- UniProtKB:
A0A8I6AA99 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131077 ⟸ XM_063275007
- Peptide Label:
isoform X19
- UniProtKB:
A0A8I6AA99 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131076 ⟸ XM_063275006
- Peptide Label:
isoform X18
- UniProtKB:
A0A8I6AA99 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131064 ⟸ XM_063274994
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063131061 ⟸ XM_063274991
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063131065 ⟸ XM_063274995
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063131063 ⟸ XM_063274993
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063131062 ⟸ XM_063274992
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063131059 ⟸ XM_063274989
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063131107 ⟸ XM_063275037
- Peptide Label:
isoform X46
- UniProtKB:
A0A8I5ZQ23 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131105 ⟸ XM_063275035
- Peptide Label:
isoform X45
- UniProtKB:
A0A8I5ZQ23 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131103 ⟸ XM_063275033
- Peptide Label:
isoform X43
- UniProtKB:
A0A8I5ZV05 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131090 ⟸ XM_063275020
- Peptide Label:
isoform X32
- UniProtKB:
A0A8I5ZQ23 (UniProtKB/TrEMBL), A0A8I6ABV1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131100 ⟸ XM_063275030
- Peptide Label:
isoform X40
- UniProtKB:
A6JPR0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131096 ⟸ XM_063275026
- Peptide Label:
isoform X37
- UniProtKB:
A6JPR0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063131069 ⟸ XM_063274999
- Peptide Label:
isoform X10
- UniProtKB:
Q923T8 (UniProtKB/Swiss-Prot), O35413 (UniProtKB/Swiss-Prot)
RGD ID: 13700106 Promoter ID: EPDNEW_R10630 Type: multiple initiation site Name: Sorbs2_1 Description: sorbin and SH3 domain containing 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 49,819,808 - 49,819,868 EPDNEW
BioCyc Gene G2FUF-11322 BioCyc
Ensembl Genes ENSRNOG00000013391 Ensembl, ENTREZGENE
Ensembl Transcript ENSRNOT00000029628 ENTREZGENE
ENSRNOT00000096919 ENTREZGENE
ENSRNOT00000111730 ENTREZGENE
ENSRNOT00000113085 ENTREZGENE
ENSRNOT00000115009 ENTREZGENE
ENSRNOT00000118135 ENTREZGENE
ENSRNOT00000120664 ENTREZGENE
ENSRNOT00000120666 ENTREZGENE
ENSRNOT00000120667 ENTREZGENE
Gene3D-CATH SH3 Domains UniProtKB/Swiss-Prot
InterPro Endophilin_SH3RF UniProtKB/Swiss-Prot
SH3-like_dom_sf UniProtKB/Swiss-Prot
SH3_domain UniProtKB/Swiss-Prot
SoHo_dom UniProtKB/Swiss-Prot
Znf_C2H2_type UniProtKB/Swiss-Prot
KEGG Report rno:114901 UniProtKB/Swiss-Prot
NCBI Gene 114901 ENTREZGENE
PANTHER PTHR14167:SF56 UniProtKB/Swiss-Prot
SH3 DOMAIN-CONTAINING UniProtKB/Swiss-Prot
Pfam SH3_1 UniProtKB/Swiss-Prot
SH3_9 UniProtKB/Swiss-Prot
Sorb UniProtKB/Swiss-Prot
PhenoGen Sorbs2 PhenoGen
PRINTS P67PHOX UniProtKB/Swiss-Prot
SH3DOMAIN UniProtKB/Swiss-Prot
PROSITE SH3 UniProtKB/Swiss-Prot
SOHO UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000013391 RatGTEx
SMART SH3 UniProtKB/Swiss-Prot
Sorb UniProtKB/Swiss-Prot
Superfamily-SCOP SSF50044 UniProtKB/Swiss-Prot
UniProt A0A8I5XWJ4_RAT UniProtKB/TrEMBL
A0A8I5YCM3_RAT UniProtKB/TrEMBL
A0A8I5ZQ23 ENTREZGENE, UniProtKB/TrEMBL
A0A8I5ZV05 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AA99 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6ABV1 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AFA3 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AN94_RAT UniProtKB/TrEMBL
A6JPQ9 ENTREZGENE, UniProtKB/TrEMBL
A6JPR0 ENTREZGENE, UniProtKB/TrEMBL
A6JPR1 ENTREZGENE, UniProtKB/TrEMBL
F1LPM3 ENTREZGENE, UniProtKB/TrEMBL
O35413 ENTREZGENE
Q923T8 ENTREZGENE
SRBS2_RAT UniProtKB/Swiss-Prot
UniProt Secondary Q923T8 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2010-04-20
Sorbs2
sorbin and SH3 domain containing 2
Argbp2
Arg/Abl-interacting protein ArgBP2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Argbp2
Arg/Abl-interacting protein ArgBP2
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Argbp2
Arg/Abl-interacting protein ArgBP2
Symbol and Name status set to provisional
70820 PROVISIONAL
