Symbol:
Mmp7
Name:
matrix metallopeptidase 7
RGD ID:
3100
Description:
Enables heparin binding activity. Involved in several processes, including cellular response to mechanical stimulus; estrous cycle; and maternal process involved in female pregnancy. Located in cell surface and extracellular space. Used to study hypertension and prostate carcinoma. Biomarker of bladder neck obstruction; coronary restenosis; hypertension; prostate cancer; and renal hypertension. Orthologous to human MMP7 (matrix metallopeptidase 7); PARTICIPATES IN syndecan signaling pathway; Wnt signaling pathway; INTERACTS WITH 1,2-dimethylhydrazine; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
matrilysin; matrin; matrix metalloproteinase 7; Matrix metalloproteinase 7 (matrilysin); matrix metalloproteinase-7; MMP-7; MPMM; pump-1 protease; uterine metalloproteinase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MMP7 (matrix metallopeptidase 7) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mmp7 (matrix metallopeptidase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mmp7 (matrix metallopeptidase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MMP7 (matrix metallopeptidase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MMP7 (matrix metallopeptidase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mmp7 (matrix metallopeptidase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MMP7 (matrix metallopeptidase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MMP7 (matrix metallopeptidase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mmp7 (matrix metallopeptidase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Mmp7 (matrix metallopeptidase 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MMP7 (matrix metallopeptidase 7)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mmp20a (matrix metallopeptidase 20a (enamelysin))
Alliance
DIOPT (Ensembl Compara|PANTHER)
Danio rerio (zebrafish):
mmp30 (matrix metallopeptidase 30)
Alliance
DIOPT (OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
zmp-6
Alliance
DIOPT (Ensembl Compara|InParanoid|PANTHER)
Xenopus tropicalis (tropical clawed frog):
mmp13
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 13,133,043 - 13,140,761 (+) NCBI GRCr8 mRatBN7.2 8 4,848,186 - 4,855,908 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 4,848,186 - 4,855,902 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 8,808,955 - 8,816,704 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 7,106,740 - 7,114,491 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 5,107,859 - 5,115,573 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 5,893,253 - 5,900,965 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 5,893,249 - 5,901,049 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 5,895,393 - 5,903,105 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 4,526,018 - 4,533,730 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 4,526,033 - 4,533,729 (+) NCBI Celera 8 6,407,543 - 6,415,255 (+) NCBI Celera Cytogenetic Map 8 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mmp7 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO MMP7 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [epigallocatechin gallate results in increased expression of MMP7 protein] more ... CTD PMID:17928719 Mmp7 Rat (-)-epigallocatechin 3-gallate increases expression ISO MMP7 (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of MMP7 protein CTD PMID:17928719 Mmp7 Rat (E)-thiamethoxam increases expression ISO Mmp7 (Mus musculus) 6480464 Thiamethoxam results in increased expression of MMP7 mRNA CTD PMID:33533595 Mmp7 Rat (S)-nicotine multiple interactions ISO Mmp7 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Mmp7 Rat (S)-nicotine increases expression ISO MMP7 (Homo sapiens) 6480464 Nicotine results in increased expression of MMP7 mRNA and Nicotine results in increased expression of MMP7 protein CTD PMID:20061081 and PMID:25847246 Mmp7 Rat (S)-nicotine affects response to substance ISO MMP7 (Homo sapiens) 6480464 MMP7 promoter SNP affects the susceptibility to Nicotine CTD PMID:25847246 Mmp7 Rat (S)-nicotine multiple interactions ISO MMP7 (Homo sapiens) 6480464 CREB1 protein promotes the reaction [Nicotine results in increased expression of MMP7 mRNA] more ... CTD PMID:20061081 and PMID:25847246 Mmp7 Rat 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of MMP7 mRNA CTD PMID:27840820 Mmp7 Rat 1,2-dimethylhydrazine increases expression ISO Mmp7 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of MMP7 mRNA CTD PMID:22206623 Mmp7 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO Mmp7 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Mmp7 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Mmp7 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Mmp7 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of MMP7 mRNA CTD PMID:30723492 Mmp7 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of MMP7 mRNA CTD PMID:17351261 Mmp7 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of MMP7 mRNA CTD PMID:12655037 more ... Mmp7 Rat 17alpha-ethynylestradiol increases expression ISO MMP7 (Homo sapiens) 6480464 Ethinyl Estradiol results in increased expression of MMP7 mRNA CTD PMID:18936297 Mmp7 Rat 17beta-estradiol multiple interactions ISO MMP7 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of MMP7 mRNA and [Estradiol co-treated with Progesterone] results in decreased secretion of MMP7 protein CTD PMID:16009159 and PMID:20660070 Mmp7 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of MMP7 mRNA CTD PMID:26945725 Mmp7 Rat 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with Plant Preparations] results in increased expression of MMP7 mRNA more ... CTD PMID:11375906 and PMID:26945725 Mmp7 Rat 17beta-estradiol increases expression ISO Mmp7 (Mus musculus) 6480464 Estradiol results in increased expression of MMP7 mRNA CTD PMID:15289156 Mmp7 Rat 17beta-estradiol increases secretion ISO MMP7 (Homo sapiens) 6480464 Estradiol results in increased secretion of MMP7 protein CTD PMID:16009159 Mmp7 Rat 17beta-hydroxy-5alpha-androstan-3-one decreases expression ISO MMP7 (Homo sapiens) 6480464 Dihydrotestosterone results in decreased expression of MMP7 mRNA CTD PMID:8798622 Mmp7 Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO MMP7 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Mmp7 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO MMP7 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin inhibits the reaction [Progesterone results in decreased secretion of MMP7 protein] CTD PMID:16009159 Mmp7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mmp7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MMP7 mRNA CTD PMID:26377647 Mmp7 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Mmp7 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Mmp7 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression EXP 6480464 tetrabromobisphenol A results in decreased expression of MMP7 mRNA CTD PMID:28300664 Mmp7 Rat 3,7-dihydropurine-6-thione increases expression EXP 6480464 Mercaptopurine results in increased expression of MMP7 mRNA CTD PMID:23358152 Mmp7 Rat 3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid multiple interactions ISO MMP7 (Homo sapiens) 6480464 MK-886 inhibits the reaction [Nicotine results in increased expression of MMP7 mRNA] CTD PMID:20061081 Mmp7 Rat 4,4'-sulfonyldiphenol decreases expression ISO Mmp7 (Mus musculus) 6480464 bisphenol S results in decreased expression of MMP7 mRNA CTD PMID:38908815 Mmp7 Rat 4,4'-sulfonyldiphenol decreases methylation ISO MMP7 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of MMP7 gene CTD PMID:31601247 Mmp7 Rat 4-hydroxyphenyl retinamide increases expression ISO Mmp7 (Mus musculus) 6480464 Fenretinide results in increased expression of MMP7 mRNA CTD PMID:28973697 Mmp7 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:19480007 Mmp7 Rat 7,12-dimethyltetraphene decreases expression EXP 6480464 9 more ... CTD PMID:19480007 Mmp7 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of MMP7 mRNA CTD PMID:31881176 Mmp7 Rat acetylsalicylic acid decreases expression EXP 6480464 Aspirin results in decreased expression of MMP7 mRNA CTD PMID:12800193 Mmp7 Rat acetylsalicylic acid multiple interactions EXP 6480464 Aspirin inhibits the reaction [Azoxymethane results in increased expression of MMP7 mRNA] CTD PMID:20043115 Mmp7 Rat acrolein increases secretion ISO MMP7 (Homo sapiens) 6480464 Acrolein results in increased secretion of MMP7 protein CTD PMID:30204913 Mmp7 Rat aflatoxin B1 affects expression ISO MMP7 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of MMP7 protein CTD PMID:20106945 Mmp7 Rat aldehydo-D-glucose multiple interactions ISO Mmp7 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of MMP7 mRNA CTD PMID:37567420 Mmp7 Rat all-trans-retinoic acid multiple interactions ISO MMP7 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Tretinoin results in increased expression of MMP7 mRNA] more ... CTD PMID:17928719 Mmp7 Rat all-trans-retinoic acid increases expression ISO MMP7 (Homo sapiens) 6480464 Tretinoin results in increased expression of MMP7 mRNA and Tretinoin results in increased expression of MMP7 protein CTD PMID:16249480 and PMID:17928719 Mmp7 Rat aluminium atom multiple interactions ISO MMP7 (Homo sapiens) 6480464 [Aluminum Chloride results in increased abundance of Aluminum] which results in increased expression of MMP7 mRNA CTD PMID:32437896 Mmp7 Rat aluminium(0) multiple interactions ISO MMP7 (Homo sapiens) 6480464 [Aluminum Chloride results in increased abundance of Aluminum] which results in increased expression of MMP7 mRNA CTD PMID:32437896 Mmp7 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MMP7 mRNA CTD PMID:16483693 Mmp7 Rat andrographolide decreases expression ISO MMP7 (Homo sapiens) 6480464 andrographolide results in decreased expression of MMP7 mRNA and andrographolide results in decreased expression of MMP7 protein CTD PMID:19426720 and PMID:35917943 Mmp7 Rat andrographolide multiple interactions ISO MMP7 (Homo sapiens) 6480464 andrographolide results in decreased expression of and results in decreased activity of MMP7 protein CTD PMID:19426720 Mmp7 Rat antimonite increases expression ISO MMP7 (Homo sapiens) 6480464 antimonite results in increased expression of MMP7 mRNA CTD PMID:17400267 Mmp7 Rat antimonite multiple interactions ISO MMP7 (Homo sapiens) 6480464 RTKI cpd inhibits the reaction [antimonite results in increased expression of MMP7 mRNA] CTD PMID:17400267 Mmp7 Rat aristolochic acid A decreases expression ISO MMP7 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of MMP7 mRNA CTD PMID:33212167 Mmp7 Rat Aroclor 1254 increases expression ISO Mmp7 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of MMP7 mRNA CTD PMID:23650126 Mmp7 Rat arsenite(3-) increases expression ISO MMP7 (Homo sapiens) 6480464 arsenite results in increased expression of MMP7 mRNA CTD PMID:17400267 Mmp7 Rat arsenite(3-) multiple interactions ISO MMP7 (Homo sapiens) 6480464 RTKI cpd inhibits the reaction [arsenite results in increased expression of MMP7 mRNA] CTD PMID:17400267 Mmp7 Rat arsenous acid decreases expression ISO MMP7 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of MMP7 mRNA CTD PMID:19128835 more ... Mmp7 Rat Azoxymethane multiple interactions ISO Mmp7 (Mus musculus) 6480464 [Dextran Sulfate co-treated with Azoxymethane] results in increased expression of MMP7 mRNA more ... CTD PMID:20681671 and PMID:31715269 Mmp7 Rat Azoxymethane increases expression ISO Mmp7 (Mus musculus) 6480464 Azoxymethane results in increased expression of MMP7 mRNA CTD PMID:20681671 Mmp7 Rat Azoxymethane increases activity ISO Mmp7 (Mus musculus) 6480464 Azoxymethane results in increased activity of MMP7 protein CTD PMID:20681671 Mmp7 Rat Azoxymethane increases expression EXP 6480464 Azoxymethane results in increased expression of MMP7 mRNA CTD PMID:20043115 Mmp7 Rat Azoxymethane multiple interactions EXP 6480464 Aspirin inhibits the reaction [Azoxymethane results in increased expression of MMP7 mRNA] CTD PMID:20043115 Mmp7 Rat benzo[a]pyrene increases expression ISO MMP7 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of MMP7 mRNA CTD PMID:20106945 and PMID:32234424 Mmp7 Rat benzo[a]pyrene decreases expression ISO MMP7 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MMP7 mRNA CTD PMID:35870112 Mmp7 Rat benzyl isothiocyanate multiple interactions ISO MMP7 (Homo sapiens) 6480464 benzyl isothiocyanate inhibits the reaction [epigallocatechin gallate results in increased expression of MMP7 protein] and benzyl isothiocyanate inhibits the reaction [Tretinoin results in increased expression of MMP7 mRNA] CTD PMID:17928719 Mmp7 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MMP7 mRNA CTD PMID:25181051 Mmp7 Rat bisphenol A increases expression ISO MMP7 (Homo sapiens) 6480464 bisphenol A results in increased expression of MMP7 mRNA CTD PMID:29718440 Mmp7 Rat bleomycin A2 increases expression ISO Mmp7 (Mus musculus) 6480464 Bleomycin results in increased expression of MMP7 protein CTD PMID:32032644 Mmp7 Rat bleomycin A2 multiple interactions ISO Mmp7 (Mus musculus) 6480464 honokiol inhibits the reaction [Bleomycin results in increased expression of MMP7 protein] CTD PMID:32032644 Mmp7 Rat BQ 123 multiple interactions ISO MMP7 (Homo sapiens) 6480464 [BQ 788 co-treated with cyclo(Trp-Asp-Pro-Val-Leu)] inhibits the reaction [EDN1 protein results in increased secretion of and results in increased activity of MMP7 protein] and cyclo(Trp-Asp-Pro-Val-Leu) inhibits the reaction [EDN1 protein results in increased secretion of and results in increased activity of MMP7 protein] CTD PMID:12875994 Mmp7 Rat butyric acid increases expression EXP 6480464 Butyric Acid results in increased expression of MMP7 mRNA CTD PMID:12800193 Mmp7 Rat C.I. Natural Red 20 decreases expression ISO MMP7 (Homo sapiens) 6480464 shikonin results in decreased expression of MMP7 protein CTD PMID:37268198 Mmp7 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of MMP7 mRNA CTD PMID:20471445 Mmp7 Rat cadmium dichloride increases expression ISO MMP7 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MMP7 mRNA CTD PMID:32512071 Mmp7 Rat cadmium dichloride increases secretion ISO MMP7 (Homo sapiens) 6480464 Cadmium Chloride results in increased secretion of MMP7 protein CTD PMID:30572105 Mmp7 Rat caffeine multiple interactions ISO Mmp7 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Mmp7 Rat calcitriol increases expression ISO MMP7 (Homo sapiens) 6480464 Calcitriol results in increased expression of MMP7 mRNA CTD PMID:26485663 Mmp7 Rat cannabidiol multiple interactions ISO MMP7 (Homo sapiens) 6480464 Cannabidiol inhibits the reaction [TNF protein results in increased expression of MMP7 mRNA] CTD PMID:31250491 Mmp7 Rat carbon nanotube increases expression ISO Mmp7 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of MMP7 mRNA CTD PMID:25620056 Mmp7 Rat carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon results in increased expression of MMP7 mRNA CTD PMID:24911292 Mmp7 Rat celastrol multiple interactions ISO Mmp7 (Mus musculus) 6480464 celastrol inhibits the reaction [[Dextran Sulfate co-treated with Azoxymethane] results in increased expression of MMP7 mRNA] CTD PMID:31715269 Mmp7 Rat chlordecone increases expression ISO Mmp7 (Mus musculus) 6480464 Chlordecone results in increased expression of MMP7 mRNA CTD PMID:33711761 Mmp7 Rat choline multiple interactions ISO Mmp7 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of MMP7 mRNA CTD PMID:29127188 Mmp7 Rat chromium(6+) affects expression ISO Mmp7 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of MMP7 mRNA CTD PMID:28472532 Mmp7 Rat cisplatin decreases expression ISO MMP7 (Homo sapiens) 6480464 Cisplatin results in decreased expression of MMP7 mRNA CTD PMID:27392435 Mmp7 Rat clofibrate multiple interactions ISO Mmp7 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of MMP7 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of MMP7 mRNA] CTD PMID:17585979 Mmp7 Rat clofibrate increases expression ISO Mmp7 (Mus musculus) 6480464 Clofibrate results in increased expression of MMP7 mRNA CTD PMID:17585979 Mmp7 Rat clozapine decreases expression ISO MMP7 (Homo sapiens) 6480464 Clozapine results in decreased expression of MMP7 mRNA CTD PMID:17346280 Mmp7 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of MMP7 mRNA CTD PMID:30556269 Mmp7 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of MMP7 mRNA CTD PMID:30556269 Mmp7 Rat crocidolite asbestos increases expression ISO Mmp7 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of MMP7 mRNA CTD PMID:16574944 Mmp7 Rat crocidolite asbestos increases secretion ISO MMP7 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased secretion of MMP7 protein CTD PMID:33581214 Mmp7 Rat curcumin multiple interactions ISO MMP7 (Homo sapiens) 6480464 Curcumin inhibits the reaction [epigallocatechin gallate results in increased expression of MMP7 protein] more ... CTD PMID:17928719 and PMID:23452621 Mmp7 Rat cyclosporin A decreases expression ISO MMP7 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MMP7 mRNA CTD PMID:20106945 Mmp7 Rat D-glucose multiple interactions ISO Mmp7 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of MMP7 mRNA CTD PMID:37567420 Mmp7 Rat deguelin decreases expression ISO MMP7 (Homo sapiens) 6480464 deguelin results in decreased expression of MMP7 mRNA CTD PMID:25322282 Mmp7 Rat delta-tocotrienol decreases expression ISO MMP7 (Homo sapiens) 6480464 tocotrienol and delta results in decreased expression of MMP7 protein CTD PMID:21453743 Mmp7 Rat dexamethasone increases expression ISO MMP7 (Homo sapiens) 6480464 Dexamethasone results in increased expression of MMP7 mRNA CTD PMID:25047013 Mmp7 Rat dextran sulfate multiple interactions ISO Mmp7 (Mus musculus) 6480464 [Dextran Sulfate co-treated with Azoxymethane] results in increased expression of MMP7 mRNA and celastrol inhibits the reaction [[Dextran Sulfate co-treated with Azoxymethane] results in increased expression of MMP7 mRNA] CTD PMID:31715269 Mmp7 Rat diallyl disulfide decreases expression ISO MMP7 (Homo sapiens) 6480464 diallyl disulfide results in decreased expression of MMP7 protein CTD PMID:21695758 Mmp7 Rat Diallyl sulfide decreases expression ISO MMP7 (Homo sapiens) 6480464 allyl sulfide results in decreased expression of MMP7 protein CTD PMID:21695758 Mmp7 Rat diallyl trisulfide decreases expression ISO MMP7 (Homo sapiens) 6480464 diallyl trisulfide results in decreased expression of MMP7 protein CTD PMID:21695758 Mmp7 Rat diarsenic trioxide decreases expression ISO MMP7 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of MMP7 mRNA CTD PMID:19128835 more ... Mmp7 Rat diethylstilbestrol increases expression ISO Mmp7 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of MMP7 mRNA CTD PMID:15289156 Mmp7 Rat dioxygen multiple interactions ISO MMP7 (Homo sapiens) 6480464 3 more ... CTD PMID:23452621 Mmp7 Rat dioxygen increases expression ISO MMP7 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of MMP7 mRNA CTD PMID:23452621 Mmp7 Rat doxorubicin increases expression ISO Mmp7 (Mus musculus) 6480464 Doxorubicin results in increased expression of MMP7 mRNA CTD PMID:28318631 Mmp7 Rat doxorubicin multiple interactions ISO Mmp7 (Mus musculus) 6480464 Niclosamide inhibits the reaction [Doxorubicin results in increased expression of MMP7 mRNA] CTD PMID:28318631 Mmp7 Rat endosulfan increases expression ISO MMP7 (Homo sapiens) 6480464 Endosulfan results in increased expression of MMP7 mRNA CTD PMID:22677888 Mmp7 Rat ergosta-4,6,8(14),22-tetraen-3-one multiple interactions ISO MMP7 (Homo sapiens) 6480464 ergosta-4 more ... CTD PMID:28578904 Mmp7 Rat ergosta-4,6,8(14),22-tetraen-3-one multiple interactions ISO Mmp7 (Mus musculus) 6480464 ergosta-4 more ... CTD PMID:28578904 Mmp7 Rat ethanol multiple interactions ISO Mmp7 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of MMP7 mRNA CTD PMID:30517762 Mmp7 Rat Evodiamine decreases expression ISO MMP7 (Homo sapiens) 6480464 evodiamine results in decreased expression of MMP7 protein CTD PMID:32425601 Mmp7 Rat fenofibrate decreases expression ISO MMP7 (Homo sapiens) 6480464 Fenofibrate results in decreased expression of MMP7 protein CTD PMID:25545733 Mmp7 Rat ferric oxide increases expression ISO MMP7 (Homo sapiens) 6480464 ferric oxide results in increased expression of MMP7 protein CTD PMID:24885771 Mmp7 Rat folic acid increases expression ISO Mmp7 (Mus musculus) 6480464 Folic Acid results in increased expression of MMP7 mRNA and Folic Acid results in increased expression of MMP7 protein CTD PMID:15149334 Mmp7 Rat folic acid multiple interactions ISO Mmp7 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of MMP7 mRNA CTD PMID:29127188 Mmp7 Rat folic acid multiple interactions EXP 6480464 [Carbon Tetrachloride co-treated with Folic Acid] results in increased expression of MMP7 mRNA CTD PMID:18156304 Mmp7 Rat fructose multiple interactions ISO Mmp7 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of MMP7 mRNA CTD PMID:37567420 Mmp7 Rat furan increases expression EXP 6480464 furan results in increased expression of MMP7 mRNA CTD PMID:26194646 and PMID:27387713 Mmp7 Rat gallic acid multiple interactions ISO MMP7 (Homo sapiens) 6480464 Gallic Acid inhibits the reaction [epigallocatechin gallate results in increased expression of MMP7 protein] and Gallic Acid inhibits the reaction [Tretinoin results in increased expression of MMP7 mRNA] CTD PMID:17928719 Mmp7 Rat gallic acid decreases expression ISO MMP7 (Homo sapiens) 6480464 Gallic Acid results in decreased expression of MMP7 mRNA CTD PMID:22387266 Mmp7 Rat Garcinol decreases expression ISO MMP7 (Homo sapiens) 6480464 garcinol results in decreased expression of MMP7 protein CTD PMID:16052481 Mmp7 Rat genistein increases expression ISO Mmp7 (Mus musculus) 6480464 Genistein results in increased expression of MMP7 mRNA CTD PMID:15289156 Mmp7 Rat genistein affects expression ISO Mmp7 (Mus musculus) 6480464 Genistein affects the expression of MMP7 mRNA CTD PMID:32186404 Mmp7 Rat genistein multiple interactions ISO MMP7 (Homo sapiens) 6480464 Genistein inhibits the reaction [Oxygen deficiency results in increased expression of MMP7 mRNA] CTD PMID:23452621 Mmp7 Rat glucose multiple interactions ISO Mmp7 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of MMP7 mRNA CTD PMID:37567420 Mmp7 Rat graphite increases expression EXP 6480464 Graphite results in increased expression of MMP7 mRNA CTD PMID:29933104 Mmp7 Rat GW 4064 decreases expression ISO Mmp7 (Mus musculus) 6480464 GW 4064 results in decreased expression of MMP7 mRNA CTD PMID:26655953 Mmp7 Rat Honokiol multiple interactions ISO Mmp7 (Mus musculus) 6480464 honokiol inhibits the reaction [Bleomycin results in increased expression of MMP7 protein] CTD PMID:32032644 Mmp7 Rat isoorientin decreases expression ISO MMP7 (Homo sapiens) 6480464 homoorientin results in decreased expression of MMP7 protein CTD PMID:34019859 Mmp7 Rat L-ascorbic acid multiple interactions ISO MMP7 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in increased expression of MMP7 mRNA CTD PMID:17639512 Mmp7 Rat L-methionine multiple interactions ISO Mmp7 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of MMP7 mRNA CTD PMID:29127188 Mmp7 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of MMP7 mRNA CTD PMID:35283115 Mmp7 Rat lipopolysaccharide decreases expression ISO MMP7 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of MMP7 mRNA CTD PMID:21540303 Mmp7 Rat lipopolysaccharide multiple interactions ISO MMP7 (Homo sapiens) 6480464 Lipopolysaccharides promotes the reaction [Propofol results in increased expression of MMP7 mRNA] and phenethyl isothiocyanate inhibits the reaction [Lipopolysaccharides results in increased expression of MMP7 mRNA] CTD PMID:23724058 and PMID:35953652 Mmp7 Rat lipopolysaccharide increases expression ISO MMP7 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of MMP7 mRNA CTD PMID:11739494 more ... Mmp7 Rat lithium chloride multiple interactions ISO MMP7 (Homo sapiens) 6480464 MALAT1 protein affects the reaction [Lithium Chloride results in increased expression of MMP7 protein] more ... CTD PMID:24244343 Mmp7 Rat lithium chloride increases expression ISO MMP7 (Homo sapiens) 6480464 Lithium Chloride results in increased expression of MMP7 protein CTD PMID:24244343 Mmp7 Rat losartan multiple interactions ISO MMP7 (Homo sapiens) 6480464 ICG 001 promotes the reaction [Losartan inhibits the reaction [AGT protein results in increased expression of MMP7 protein]] more ... CTD PMID:28578904 Mmp7 Rat losartan multiple interactions ISO Mmp7 (Mus musculus) 6480464 Losartan inhibits the reaction [AGT protein results in increased expression of MMP7 protein] CTD PMID:28578904 Mmp7 Rat mangiferin decreases expression ISO MMP7 (Homo sapiens) 6480464 mangiferin results in decreased expression of MMP7 protein CTD PMID:23707762 Mmp7 Rat mercaptopurine increases expression EXP 6480464 Mercaptopurine results in increased expression of MMP7 mRNA CTD PMID:23358152 Mmp7 Rat methotrexate increases expression ISO MMP7 (Homo sapiens) 6480464 Methotrexate results in increased expression of MMP7 mRNA CTD PMID:21678067 Mmp7 Rat mibolerone decreases expression ISO MMP7 (Homo sapiens) 6480464 mibolerone results in decreased expression of MMP7 mRNA CTD PMID:8798622 Mmp7 Rat mifepristone increases expression ISO MMP7 (Homo sapiens) 6480464 Mifepristone results in increased expression of MMP7 mRNA CTD PMID:17584828 Mmp7 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of MMP7 gene CTD PMID:33148267 Mmp7 Rat N-acetyl-L-cysteine multiple interactions ISO MMP7 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [epigallocatechin gallate results in increased expression of MMP7 protein] and Acetylcysteine inhibits the reaction [Tretinoin results in increased expression of MMP7 mRNA] CTD PMID:17928719 Mmp7 Rat niclosamide multiple interactions EXP 6480464 Niclosamide inhibits the reaction [TGFB1 protein results in increased expression of MMP7 mRNA] CTD PMID:28318631 Mmp7 Rat niclosamide multiple interactions ISO Mmp7 (Mus musculus) 6480464 Niclosamide inhibits the reaction [Doxorubicin results in increased expression of MMP7 mRNA] CTD PMID:28318631 Mmp7 Rat niclosamide decreases expression EXP 6480464 Niclosamide results in decreased expression of MMP7 mRNA CTD PMID:27338550 Mmp7 Rat nicotine multiple interactions ISO Mmp7 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Mmp7 Rat nicotine increases expression ISO MMP7 (Homo sapiens) 6480464 Nicotine results in increased expression of MMP7 mRNA and Nicotine results in increased expression of MMP7 protein CTD PMID:20061081 and PMID:25847246 Mmp7 Rat nicotine affects response to substance ISO MMP7 (Homo sapiens) 6480464 MMP7 promoter SNP affects the susceptibility to Nicotine CTD PMID:25847246 Mmp7 Rat nicotine multiple interactions ISO MMP7 (Homo sapiens) 6480464 CREB1 protein promotes the reaction [Nicotine results in increased expression of MMP7 mRNA] more ... CTD PMID:20061081 and PMID:25847246 Mmp7 Rat nitroglycerin increases expression ISO MMP7 (Homo sapiens) 6480464 Nitroglycerin results in increased expression of MMP7 mRNA CTD PMID:12084592 Mmp7 Rat nobiletin decreases expression ISO MMP7 (Homo sapiens) 6480464 nobiletin results in decreased expression of MMP7 mRNA and nobiletin results in decreased expression of MMP7 protein CTD PMID:15725655 Mmp7 Rat Pachymic acid multiple interactions ISO MMP7 (Homo sapiens) 6480464 pachymic acid analog inhibits the reaction [AGT protein results in increased expression of MMP7 protein] CTD PMID:28578904 Mmp7 Rat Pachymic acid multiple interactions ISO Mmp7 (Mus musculus) 6480464 pachymic acid analog inhibits the reaction [AGT protein results in increased expression of MMP7 protein] CTD PMID:28578904 Mmp7 Rat paracetamol multiple interactions ISO Mmp7 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of MMP7 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of MMP7 mRNA] CTD PMID:17585979 Mmp7 Rat paracetamol decreases expression ISO MMP7 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MMP7 mRNA CTD PMID:29067470 Mmp7 Rat paracetamol affects expression ISO Mmp7 (Mus musculus) 6480464 Acetaminophen affects the expression of MMP7 mRNA CTD PMID:17562736 Mmp7 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of MMP7 mRNA CTD PMID:32680482 Mmp7 Rat perfluorohexanesulfonic acid multiple interactions ISO MMP7 (Homo sapiens) 6480464 [perfluorooctanoic acid co-treated with perfluorooctane sulfonic acid co-treated with perfluorohexanesulfonic acid] results in increased expression of MMP7 mRNA CTD PMID:38603627 Mmp7 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO MMP7 (Homo sapiens) 6480464 [perfluorooctanoic acid co-treated with perfluorooctane sulfonic acid co-treated with perfluorohexanesulfonic acid] results in increased expression of MMP7 mRNA CTD PMID:38603627 Mmp7 Rat perfluorooctanoic acid multiple interactions ISO MMP7 (Homo sapiens) 6480464 [perfluorooctanoic acid co-treated with perfluorooctane sulfonic acid co-treated with perfluorohexanesulfonic acid] results in increased expression of MMP7 mRNA CTD PMID:38603627 Mmp7 Rat perfluorooctanoic acid decreases expression ISO MMP7 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of MMP7 protein CTD PMID:32916415 Mmp7 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of MMP7 gene CTD PMID:33148267 Mmp7 Rat permethrin increases expression ISO MMP7 (Homo sapiens) 6480464 Permethrin results in increased expression of MMP7 mRNA CTD PMID:37047231 Mmp7 Rat phenethyl isothiocyanate multiple interactions ISO MMP7 (Homo sapiens) 6480464 phenethyl isothiocyanate inhibits the reaction [Lipopolysaccharides results in increased expression of MMP7 mRNA] CTD PMID:23724058 Mmp7 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of MMP7 mRNA CTD PMID:15059925 Mmp7 Rat phorbol 13-acetate 12-myristate increases expression ISO MMP7 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of MMP7 mRNA CTD PMID:8798622 Mmp7 Rat pinosylvin multiple interactions ISO MMP7 (Homo sapiens) 6480464 [pinosylvin affects the localization of and results in decreased activity of CTNNB1 protein] which results in decreased expression of MMP7 mRNA CTD PMID:23333577 Mmp7 Rat pioglitazone multiple interactions ISO Mmp7 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in increased expression of MMP7 mRNA CTD PMID:27935865 Mmp7 Rat pioglitazone decreases expression ISO MMP7 (Homo sapiens) 6480464 Pioglitazone results in decreased expression of MMP7 mRNA CTD PMID:30031879 Mmp7 Rat pirinixic acid decreases expression ISO Mmp7 (Mus musculus) 6480464 pirinixic acid results in decreased expression of MMP7 mRNA CTD PMID:17426115 Mmp7 Rat procymidone affects expression ISO Mmp7 (Mus musculus) 6480464 procymidone affects the expression of MMP7 mRNA CTD PMID:36764477 Mmp7 Rat progesterone multiple interactions ISO MMP7 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of MMP7 mRNA more ... CTD PMID:16009159 and PMID:20660070 Mmp7 Rat progesterone decreases expression ISO Mmp7 (Mus musculus) 6480464 Progesterone results in decreased expression of MMP7 mRNA CTD PMID:22238285 Mmp7 Rat progesterone affects expression ISO Mmp7 (Mus musculus) 6480464 Progesterone affects the expression of MMP7 mRNA CTD PMID:17251523 Mmp7 Rat progesterone decreases secretion ISO MMP7 (Homo sapiens) 6480464 Progesterone results in decreased secretion of MMP7 protein CTD PMID:16009159 Mmp7 Rat propofol multiple interactions ISO MMP7 (Homo sapiens) 6480464 Lipopolysaccharides promotes the reaction [Propofol results in increased expression of MMP7 mRNA] CTD PMID:35953652 Mmp7 Rat propofol increases expression ISO MMP7 (Homo sapiens) 6480464 Propofol results in increased expression of MMP7 mRNA CTD PMID:35953652 Mmp7 Rat Prothioconazole-desthio increases expression ISO Mmp7 (Mus musculus) 6480464 prothioconazole-desthio results in increased expression of MMP7 mRNA CTD PMID:36007749 Mmp7 Rat pterostilbene multiple interactions ISO Mmp7 (Mus musculus) 6480464 pterostilbene inhibits the reaction [Azoxymethane results in increased activity of MMP7 protein] more ... CTD PMID:20681671 Mmp7 Rat purine-6-thiol increases expression EXP 6480464 Mercaptopurine results in increased expression of MMP7 mRNA CTD PMID:23358152 Mmp7 Rat quercetin multiple interactions ISO MMP7 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in increased expression of MMP7 mRNA CTD PMID:17639512 Mmp7 Rat quercetin decreases expression ISO MMP7 (Homo sapiens) 6480464 Quercetin results in decreased expression of MMP7 protein CTD PMID:15725655 and PMID:23645742 Mmp7 Rat resveratrol multiple interactions ISO MMP7 (Homo sapiens) 6480464 MALAT1 protein affects the reaction [resveratrol inhibits the reaction [Lithium Chloride results in increased expression of MMP7 protein]] more ... CTD PMID:23452621 and PMID:24244343 Mmp7 Rat resveratrol decreases expression ISO MMP7 (Homo sapiens) 6480464 resveratrol results in decreased expression of MMP7 protein CTD PMID:24244343 Mmp7 Rat riddelliine decreases expression EXP 6480464 riddelliine results in decreased expression of MMP7 mRNA CTD PMID:18047727 Mmp7 Rat salicylates decreases expression ISO MMP7 (Homo sapiens) 6480464 Salicylates results in decreased expression of MMP7 protein CTD PMID:15725655 Mmp7 Rat serpentine asbestos increases secretion ISO MMP7 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased secretion of MMP7 protein CTD PMID:33581214 Mmp7 Rat serpentine asbestos increases expression ISO Mmp7 (Mus musculus) 6480464 Asbestos and Serpentine results in increased expression of MMP7 CTD PMID:19105532 Mmp7 Rat serpentine asbestos increases expression ISO MMP7 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of MMP7 mRNA CTD PMID:33581214 Mmp7 Rat Shikonin decreases expression ISO MMP7 (Homo sapiens) 6480464 shikonin results in decreased expression of MMP7 protein CTD PMID:37268198 Mmp7 Rat silicon dioxide decreases expression ISO MMP7 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of MMP7 mRNA CTD PMID:25895662 Mmp7 Rat silicon dioxide increases expression ISO MMP7 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of MMP7 mRNA CTD PMID:23806026 Mmp7 Rat sodium arsenite increases expression ISO MMP7 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MMP7 mRNA CTD PMID:28595984 Mmp7 Rat sodium arsenite decreases expression ISO Mmp7 (Mus musculus) 6480464 sodium arsenite results in decreased expression of MMP7 mRNA CTD PMID:37682722 Mmp7 Rat sodium arsenite decreases expression ISO MMP7 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MMP7 mRNA CTD PMID:34032870 Mmp7 Rat streptozocin multiple interactions ISO MMP7 (Homo sapiens) 6480464 PRDX4 protein inhibits the reaction [Streptozocin results in increased expression of MMP7 mRNA] CTD PMID:20446767 Mmp7 Rat streptozocin multiple interactions ISO Mmp7 (Mus musculus) 6480464 [Streptozocin co-treated with Dietary Fats] results in increased expression of MMP7 mRNA CTD PMID:29127188 Mmp7 Rat streptozocin increases expression ISO Mmp7 (Mus musculus) 6480464 Streptozocin results in increased expression of MMP7 mRNA CTD PMID:20446767 Mmp7 Rat sulindac decreases expression ISO Mmp7 (Mus musculus) 6480464 Sulindac results in decreased expression of MMP7 mRNA and Sulindac results in decreased expression of MMP7 protein CTD PMID:18499699 Mmp7 Rat sulindac sulfone decreases expression ISO MMP7 (Homo sapiens) 6480464 sulindac sulfone results in decreased expression of MMP7 protein CTD PMID:15725655 Mmp7 Rat Tanshinone I decreases expression ISO MMP7 (Homo sapiens) 6480464 tanshinone results in decreased expression of MMP7 mRNA CTD PMID:15849732 Mmp7 Rat testosterone multiple interactions EXP 6480464 [Estradiol co-treated with Testosterone] results in increased expression of MMP7 mRNA and [Estradiol co-treated with Testosterone] results in increased expression of MMP7 protein CTD PMID:11375906 Mmp7 Rat tetrachloromethane multiple interactions EXP 6480464 [Carbon Tetrachloride co-treated with Folic Acid] results in increased expression of MMP7 mRNA CTD PMID:18156304 Mmp7 Rat tetrachloromethane multiple interactions ISO Mmp7 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of MMP7 mRNA CTD PMID:30517762 Mmp7 Rat thiamethoxam increases expression ISO Mmp7 (Mus musculus) 6480464 Thiamethoxam results in increased expression of MMP7 mRNA CTD PMID:33533595 Mmp7 Rat thymoquinone decreases expression ISO MMP7 (Homo sapiens) 6480464 thymoquinone results in decreased expression of MMP7 mRNA CTD PMID:32112862 Mmp7 Rat titanium dioxide increases expression ISO MMP7 (Homo sapiens) 6480464 titanium dioxide results in increased expression of MMP7 mRNA CTD PMID:19695317 Mmp7 Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of MMP7 mRNA CTD PMID:30012374 Mmp7 Rat titanium dioxide increases expression ISO Mmp7 (Mus musculus) 6480464 titanium dioxide results in increased expression of MMP7 mRNA CTD PMID:23557971 Mmp7 Rat trans-pinosylvin multiple interactions ISO MMP7 (Homo sapiens) 6480464 [pinosylvin affects the localization of and results in decreased activity of CTNNB1 protein] which results in decreased expression of MMP7 mRNA CTD PMID:23333577 Mmp7 Rat trichloroacetaldehyde increases expression ISO Mmp7 (Mus musculus) 6480464 trichloroacetaldehyde metabolite results in increased expression of MMP7 protein CTD PMID:17077186 Mmp7 Rat tyrphostin AG 1478 multiple interactions ISO MMP7 (Homo sapiens) 6480464 RTKI cpd inhibits the reaction [antimonite results in increased expression of MMP7 mRNA] and RTKI cpd inhibits the reaction [arsenite results in increased expression of MMP7 mRNA] CTD PMID:17400267 Mmp7 Rat valproic acid increases expression ISO MMP7 (Homo sapiens) 6480464 Valproic Acid results in increased expression of MMP7 mRNA CTD PMID:19949822 Mmp7 Rat zearalenone increases expression EXP 6480464 Zearalenone results in increased expression of MMP7 mRNA CTD PMID:17557909 Mmp7 Rat zinc dichloride decreases expression ISO MMP7 (Homo sapiens) 6480464 zinc chloride results in decreased expression of MMP7 mRNA CTD PMID:21540303
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-epigallocatechin 3-gallate (ISO) (E)-thiamethoxam (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (EXP,ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',5,5'-tetrabromobisphenol A (EXP) 3,7-dihydropurine-6-thione (EXP) 3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 7,12-dimethyltetraphene (EXP) acetamide (EXP) acetylsalicylic acid (EXP) acrolein (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) aluminium atom (ISO) aluminium(0) (ISO) ammonium chloride (EXP) andrographolide (ISO) antimonite (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) arsenous acid (ISO) Azoxymethane (EXP,ISO) benzo[a]pyrene (ISO) benzyl isothiocyanate (ISO) bisphenol A (EXP,ISO) bleomycin A2 (ISO) BQ 123 (ISO) butyric acid (EXP) C.I. Natural Red 20 (ISO) C60 fullerene (EXP) cadmium dichloride (ISO) caffeine (ISO) calcitriol (ISO) cannabidiol (ISO) carbon nanotube (EXP,ISO) celastrol (ISO) chlordecone (ISO) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) clofibrate (ISO) clozapine (ISO) copper atom (EXP) copper(0) (EXP) crocidolite asbestos (ISO) curcumin (ISO) cyclosporin A (ISO) D-glucose (ISO) deguelin (ISO) delta-tocotrienol (ISO) dexamethasone (ISO) dextran sulfate (ISO) diallyl disulfide (ISO) Diallyl sulfide (ISO) diallyl trisulfide (ISO) diarsenic trioxide (ISO) diethylstilbestrol (ISO) dioxygen (ISO) doxorubicin (ISO) endosulfan (ISO) ergosta-4,6,8(14),22-tetraen-3-one (ISO) ethanol (ISO) Evodiamine (ISO) fenofibrate (ISO) ferric oxide (ISO) folic acid (EXP,ISO) fructose (ISO) furan (EXP) gallic acid (ISO) Garcinol (ISO) genistein (ISO) glucose (ISO) graphite (EXP) GW 4064 (ISO) Honokiol (ISO) isoorientin (ISO) L-ascorbic acid (ISO) L-methionine (ISO) lidocaine (EXP) lipopolysaccharide (ISO) lithium chloride (ISO) losartan (ISO) mangiferin (ISO) mercaptopurine (EXP) methotrexate (ISO) mibolerone (ISO) mifepristone (ISO) N,N-diethyl-m-toluamide (EXP) N-acetyl-L-cysteine (ISO) niclosamide (EXP,ISO) nicotine (ISO) nitroglycerin (ISO) nobiletin (ISO) Pachymic acid (ISO) paracetamol (ISO) paraquat (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) permethrin (EXP,ISO) phenethyl isothiocyanate (ISO) PhIP (EXP) phorbol 13-acetate 12-myristate (ISO) pinosylvin (ISO) pioglitazone (ISO) pirinixic acid (ISO) procymidone (ISO) progesterone (ISO) propofol (ISO) Prothioconazole-desthio (ISO) pterostilbene (ISO) purine-6-thiol (EXP) quercetin (ISO) resveratrol (ISO) riddelliine (EXP) salicylates (ISO) serpentine asbestos (ISO) Shikonin (ISO) silicon dioxide (ISO) sodium arsenite (ISO) streptozocin (ISO) sulindac (ISO) sulindac sulfone (ISO) Tanshinone I (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) thiamethoxam (ISO) thymoquinone (ISO) titanium dioxide (EXP,ISO) trans-pinosylvin (ISO) trichloroacetaldehyde (ISO) tyrphostin AG 1478 (ISO) valproic acid (ISO) zearalenone (EXP) zinc dichloride (ISO)
Biological Process
antibacterial peptide biosynthetic process (IEA,ISO) antibacterial peptide secretion (IEA,ISO) cellular response to mechanical stimulus (IEP) collagen catabolic process (IBA,IEA) defense response to bacterium (IEA,ISO) defense response to Gram-negative bacterium (IEA,ISO) defense response to Gram-positive bacterium (IEA,ISO) estrous cycle (IEP) extracellular matrix organization (IBA) maternal process involved in female pregnancy (IEP) membrane protein ectodomain proteolysis (IEA,ISO) membrane protein intracellular domain proteolysis (IEA,ISO) positive regulation of cell migration (IEA,ISO) proteolysis (IEA,ISO) regulation of cell population proliferation (IEA,ISO) response to nutrient levels (IEP) response to xenobiotic stimulus (IEA,ISO)
1.
Characterization of rat uterine matrilysin and its cDNA. Relationship to human pump-1 and activation of procollagenases.
Abramson SR, etal., J Biol Chem 1995 Jul 7;270(27):16016-22.
2.
Ischemia-modified albumin improves the usefulness of standard cardiac biomarkers for the diagnosis of myocardial ischemia in the emergency department setting.
Anwaruddin S, etal., Am J Clin Pathol. 2005 Jan;123(1):140-5.
3.
Prostate carcinomas developing in transgenic rats with SV40 T antigen expression under probasin promoter control are strictly androgen dependent.
Asamoto M, etal., Cancer Res. 2001 Jun 15;61(12):4693-700.
4.
Fibrosis of the left atria during progression of heart failure is associated with increased matrix metalloproteinases in the rat.
Boixel C, etal., J Am Coll Cardiol. 2003 Jul 16;42(2):336-44.
5.
Mechanism of matrix accumulation and glomerulosclerosis in spontaneously hypertensive rats.
Camp TM, etal., J Hypertens 2003 Sep;21(9):1719-27.
6.
Increased susceptibility of aging kidney to ischemic injury: identification of candidate genes changed during aging, but corrected by caloric restriction.
Chen G, etal., Am J Physiol Renal Physiol. 2007 Oct;293(4):F1272-81. Epub 2007 Aug 1.
7.
Protease-activated receptor-1 antagonist F 16618 reduces arterial restenosis by down-regulation of tumor necrosis factor alpha and matrix metalloproteinase 7 expression, migration, and proliferation of vascular smooth muscle cells.
Chieng-Yane P, etal., J Pharmacol Exp Ther. 2011 Mar;336(3):643-51. doi: 10.1124/jpet.110.175182. Epub 2010 Dec 7.
8.
Matrilysin activity in the rat uterus during the oestrous cycle and implantation.
Feng J, etal., J Reprod Fertil. 1998 Nov;114(2):347-50.
9.
Role of myoglobin in the antioxidant defense of the heart.
Flogel U, etal., FASEB J. 2004 Jul;18(10):1156-8. Epub 2004 May 7.
10.
Modulation of extracellular matrix components by metalloproteinases and their tissue inhibitors during degeneration and regeneration of rat sural nerve.
Gantus MA, etal., Brain Res. 2006 Nov 29;1122(1):36-46. Epub 2006 Oct 6.
11.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
12.
Thyroid hormone stimulates myoglobin gene expression in rat cardiac muscle.
Giannocco G, etal., Mol Cell Endocrinol. 2004 Oct 29;226(1-2):19-26.
13.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
14.
Metalloproteinases and their associated genes contribute to the functional integrity and noise-induced damage in the cochlear sensory epithelium.
Hu BH, etal., J Neurosci. 2012 Oct 24;32(43):14927-41. doi: 10.1523/JNEUROSCI.1588-12.2012.
15.
Activation of adventitial fibroblasts in the early stage of the aortic transplant vasculopathy in rat.
Ji J, etal., Transplantation. 2010 Apr 27;89(8):945-53. doi: 10.1097/TP.0b013e3181d05aa7.
16.
Implication of matrix metalloproteinase 7 and the noncanonical wingless-type signaling pathway in a model of kidney allograft tolerance induced by the administration of anti-donor class II antibodies.
Jovanovic V, etal., J Immunol. 2008 Feb 1;180(3):1317-25.
17.
Matrix metalloproteinases MMP-9 and MMP-7 are expressed in experimental autoimmune neuritis and the Guillain-Barre syndrome.
Kieseier BC, etal., Ann Neurol. 1998 Apr;43(4):427-34.
18.
Matrix metalloproteinase-9 and -7 are regulated in experimental autoimmune encephalomyelitis.
Kieseier BC, etal., Brain. 1998 Jan;121 ( Pt 1):159-66.
19.
Myoglobin Translational Diffusion in Myocardium and Its Implication on Intracellular Oxygen Transport.
Lin PC, etal., J Physiol. 2006 Oct 12;.
20.
Matrix metalloproteinase-7 affects connexin-43 levels, electrical conduction, and survival after myocardial infarction.
Lindsey ML, etal., Circulation. 2006 Jun 27;113(25):2919-28. Epub 2006 Jun 12.
21.
Immunolocalization and gene expression of matrilysin during corneal wound healing.
Lu PC, etal., Invest Ophthalmol Vis Sci. 1999 Jan;40(1):20-7.
22.
MMP-7 promotes prostate cancer-induced osteolysis via the solubilization of RANKL.
Lynch CC, etal., Cancer Cell. 2005 May;7(5):485-96.
23.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
24.
Matrix metalloproteinases and tissue inhibitors of metalloproteinases in human gliomas.
Nakano A, etal., J Neurosurg. 1995 Aug;83(2):298-307.
25.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
26.
Significance of matrix metalloproteinase-7 [correction of matrix metalloproteinase-2], -11 and tissue inhibitor of metalloproteinase-1 expression in normal, hyperplastic and neoplastic endometrium.
Obokata A, etal., Anticancer Res. 2007 Jan-Feb;27(1A):95-105.
27.
Proteomic analysis of slow- and fast-twitch skeletal muscles.
Okumura N, etal., Proteomics. 2005 Jul;5(11):2896-906.
28.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
29.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
30.
Effect of inhibition of matrix metalloproteinases on endometrial decidualization and implantation in mated rats.
Rechtman MP, etal., J Reprod Fertil. 1999 Sep;117(1):169-77.
31.
GOA pipeline
RGD automated data pipeline
32.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
33.
The matrix metalloproteinase matrilysin influences early-stage mammary tumorigenesis.
Rudolph-Owen LA, etal., Cancer Res. 1998 Dec 1;58(23):5500-6.
34.
Expression of MMP-7, MMP-9, TIMP-1 and TIMP-2 mRNA in lung tissue of patients with non-small cell lung cancer (NSCLC) and benign pulmonary disease.
Safranek J, etal., Anticancer Res. 2009 Jul;29(7):2513-7.
35.
Rapamycin attenuates bladder hypertrophy during long-term outlet obstruction in vivo: tissue, matrix and mechanistic insights.
Schroder A, etal., J Urol. 2013 Jun;189(6):2377-84. doi: 10.1016/j.juro.2012.12.110. Epub 2013 Jan 9.
36.
Virtual cooperativity in myoglobin oxygen saturation curve in skeletal muscle in vivo.
Seiyama A Dyn Med. 2006 Jan 24;5:3.
37.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
38.
Evaluation of coronary artery patency using cardiac markers.
Tanasijevic MJ J Thromb Thrombolysis. 2005 Feb;19(1):21-4.
39.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
40.
WNT/beta-catenin signaling is modulated by mechanical ventilation in an experimental model of acute lung injury.
Villar J, etal., Intensive Care Med. 2011 Jul;37(7):1201-9. doi: 10.1007/s00134-011-2234-0. Epub 2011 May 13.
41.
Activation of the Wnt/beta-catenin signaling pathway by mechanical ventilation is associated with ventilator-induced pulmonary fibrosis in healthy lungs.
Villar J, etal., PLoS One. 2011;6(9):e23914. doi: 10.1371/journal.pone.0023914. Epub 2011 Sep 15.
42.
Matrix metalloproteinase-7 and ADAM-12 (a disintegrin and metalloproteinase-12) define a signaling axis in agonist-induced hypertension and cardiac hypertrophy.
Wang X, etal., Circulation. 2009 May 12;119(18):2480-9. doi: 10.1161/CIRCULATIONAHA.108.835488. Epub 2009 Apr 27.
43.
[Defensin-5 and Matrilysin mRNA expression in the intestine of scalded rats and its relation to bacterial translocation].
Yang HM, etal., Zhongguo Wei Zhong Bing Ji Jiu Yi Xue. 2004 Jun;16(6):345-7.
44.
Cyclic stretch magnitude and duration affect rat alveolar epithelial gene expression.
Yerrapureddy A, etal., Cell Physiol Biochem. 2010;25(1):113-22. doi: 10.1159/000272056. Epub 2009 Dec 22.
45.
Heparan sulfate proteoglycans as extracellular docking molecules for matrilysin (matrix metalloproteinase 7).
Yu WH and Woessner JF Jr, J Biol Chem. 2000 Feb 11;275(6):4183-91.
46.
[Influence of Bushen Huoxue decoction on beta-catenin, MMP-7 of synoviocytes in rats with knee osteoarthritis].
Yuan Q, etal., Zhongguo Gu Shang. 2012 Sep;25(9):761-5.
Mmp7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 13,133,043 - 13,140,761 (+) NCBI GRCr8 mRatBN7.2 8 4,848,186 - 4,855,908 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 4,848,186 - 4,855,902 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 8,808,955 - 8,816,704 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 7,106,740 - 7,114,491 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 5,107,859 - 5,115,573 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 5,893,253 - 5,900,965 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 5,893,249 - 5,901,049 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 5,895,393 - 5,903,105 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 4,526,018 - 4,533,730 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 4,526,033 - 4,533,729 (+) NCBI Celera 8 6,407,543 - 6,415,255 (+) NCBI Celera Cytogenetic Map 8 q11 NCBI
MMP7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 102,520,508 - 102,530,747 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 102,520,508 - 102,530,750 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 102,391,239 - 102,401,478 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 101,896,449 - 101,906,688 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 101,896,448 - 101,906,688 NCBI Celera 11 99,552,782 - 99,563,021 (-) NCBI Celera Cytogenetic Map 11 q22.2 NCBI HuRef 11 98,318,241 - 98,328,480 (-) NCBI HuRef CHM1_1 11 102,274,287 - 102,284,528 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 102,522,678 - 102,532,920 (-) NCBI T2T-CHM13v2.0
Mmp7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 7,692,095 - 7,699,587 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 7,692,091 - 7,699,587 (+) Ensembl GRCm39 Ensembl GRCm38 9 7,692,090 - 7,699,585 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 7,692,090 - 7,699,585 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 7,692,111 - 7,699,416 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 7,692,097 - 7,699,255 (+) NCBI MGSCv36 mm8 Celera 9 5,082,790 - 5,090,191 (+) NCBI Celera Cytogenetic Map 9 A1 NCBI cM Map 9 2.46 NCBI
Mmp7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955412 5,778,502 - 5,792,445 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955412 5,780,772 - 5,792,485 (-) NCBI ChiLan1.0 ChiLan1.0
MMP7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 103,319,695 - 103,329,920 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 104,408,059 - 104,418,283 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 97,467,037 - 97,477,305 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 100,960,107 - 100,970,355 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 100,960,032 - 100,971,099 (-) Ensembl panpan1.1 panPan2
MMP7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 29,187,902 - 29,196,157 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 29,187,851 - 29,196,153 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 29,135,576 - 29,143,842 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 29,239,121 - 29,247,375 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 29,238,932 - 29,247,371 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 29,273,927 - 29,282,176 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 29,153,310 - 29,161,571 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 29,328,802 - 29,337,062 (+) NCBI UU_Cfam_GSD_1.0
Mmp7 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 86,138,756 - 86,148,072 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936551 5,388,459 - 5,395,071 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936551 5,388,456 - 5,395,071 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MMP7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 33,214,594 - 33,225,080 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 33,214,590 - 33,225,080 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 37,133,037 - 37,143,432 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MMP7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 93,889,189 - 93,901,077 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 93,889,198 - 93,899,587 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 31,959,442 - 31,969,839 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mmp7
.
Predicted Target Of
Count of predictions: 37 Count of miRNA genes: 30 Interacting mature miRNAs: 34 Transcripts: ENSRNOT00000014041 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 9590084 Insglur5 Insulin/glucose ratio QTL 5 18.54 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 8 1 24597739 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 2317882 Alcrsp24 Alcohol response QTL 24 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 8 1 25902202 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
5
5
28
61
60
32
25
32
6
105
44
9
15
45
28
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014041 ⟹ ENSRNOP00000014041
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 4,848,186 - 4,855,902 (+) Ensembl Rnor_6.0 Ensembl 8 5,893,249 - 5,901,049 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000100430 ⟹ ENSRNOP00000079054
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 4,848,186 - 4,854,256 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109262 ⟹ ENSRNOP00000091123
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 4,848,186 - 4,854,275 (+) Ensembl
RefSeq Acc Id:
NM_012864 ⟹ NP_036996
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 13,133,043 - 13,140,761 (+) NCBI mRatBN7.2 8 4,848,186 - 4,855,908 (+) NCBI Rnor_6.0 8 5,893,253 - 5,900,965 (+) NCBI Rnor_5.0 8 5,895,393 - 5,903,105 (+) NCBI RGSC_v3.4 8 4,526,018 - 4,533,730 (+) RGD Celera 8 6,407,543 - 6,415,255 (+) RGD
Sequence:
TGAGAACAATCGTCTGTTGATGGCAGCTATGAGGCTCACCCTGTTCCGCATTGTGTGTCTGCTGCCAGGCTGCCTGGCCCTGCCACTGTCCCAGGAAGCCGGAGAAGTGACCGCACTTCAGTGGGAAC
hide sequence
RefSeq Acc Id:
NP_036996 ⟸ NM_012864
- Peptide Label:
precursor
- UniProtKB:
P50280 (UniProtKB/Swiss-Prot), A6JN40 (UniProtKB/TrEMBL), A0A8I5ZMN5 (UniProtKB/TrEMBL)
- Sequence:
MAAMRLTLFRIVCLLPGCLALPLSQEAGEVTALQWEQAQNYLRKFYLHDSKTKKATSAVDKLREMQKFFGLPETGKLSPRVMEIMQKPRCGVPDVAEFSLMPNSPKWHSRTVTYRIVSYTTDLPRFLV
hide sequence
Ensembl Acc Id:
ENSRNOP00000014041 ⟸ ENSRNOT00000014041
Ensembl Acc Id:
ENSRNOP00000091123 ⟸ ENSRNOT00000109262
Ensembl Acc Id:
ENSRNOP00000079054 ⟸ ENSRNOT00000100430
RGD ID: 13695735 Promoter ID: EPDNEW_R6260 Type: single initiation site Name: Mmp7_1 Description: matrix metallopeptidase 7 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 5,893,240 - 5,893,300 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Mmp7
matrix metallopeptidase 7
matrix metalloproteinase 7
Name updated
1299863 APPROVED
2002-06-10
Mmp7
Matrix metalloproteinase 7 (matrilysin)
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_function
cleaves and activates latent human interstitial collagenase 1
728999
