Symbol:
Dnase1
Name:
deoxyribonuclease 1
RGD ID:
2510
Description:
Enables deoxyribonuclease I activity. Predicted to be involved in several processes, including DNA catabolic process; neutrophil activation involved in immune response; and regulation of neutrophil mediated cytotoxicity. Located in cytoplasm. Human ortholog(s) of this gene implicated in systemic lupus erythematosus. Orthologous to human DNASE1 (deoxyribonuclease 1); INTERACTS WITH 6-propyl-2-thiouracil; Allylamine; ammonium chloride.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
deoxyribonuclease I; deoxyribonuclease-1; DNase I; MGC108543
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DNASE1 (deoxyribonuclease 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Dnase1 (deoxyribonuclease I) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Dnase1 (deoxyribonuclease 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DNASE1 (deoxyribonuclease 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DNASE1 (deoxyribonuclease 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Dnase1 (deoxyribonuclease 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DNASE1 (deoxyribonuclease 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DNASE1 (deoxyribonuclease 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Dnase1 (deoxyribonuclease 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
DNASE1 (deoxyribonuclease 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Dnase1 (deoxyribonuclease I)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dnase1 (deoxyribonuclease I)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 12,005,305 - 12,030,615 (-) NCBI GRCr8 mRatBN7.2 10 11,498,930 - 11,505,151 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 11,498,931 - 11,501,869 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 16,206,518 - 16,209,457 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 15,695,347 - 15,698,286 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 11,364,678 - 11,367,617 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 11,757,681 - 11,760,672 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 11,757,682 - 11,760,620 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 10,512,148 - 10,515,131 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 11,762,570 - 11,765,509 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 11,762,569 - 11,765,509 (-) NCBI Celera 10 10,455,483 - 10,458,422 (-) NCBI Celera Cytogenetic Map 10 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dnase1 Rat (1->4)-beta-D-glucan multiple interactions ISO Dnase1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DNASE1 mRNA CTD PMID:36331819 Dnase1 Rat 1,1-dichloroethene decreases expression ISO Dnase1 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of DNASE1 mRNA CTD PMID:26682919 Dnase1 Rat 17alpha-ethynylestradiol affects expression ISO Dnase1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of DNASE1 mRNA CTD PMID:17555576 Dnase1 Rat 17alpha-ethynylestradiol affects expression ISO DNASE1 (Homo sapiens) 6480464 Ethinyl Estradiol affects the expression of DNASE1 mRNA CTD PMID:26865667 Dnase1 Rat 17alpha-ethynylestradiol multiple interactions ISO Dnase1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DNASE1 mRNA CTD PMID:17942748 Dnase1 Rat 17alpha-ethynylestradiol increases expression ISO Dnase1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of DNASE1 mRNA CTD PMID:17942748 Dnase1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Dnase1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of DNASE1 mRNA CTD PMID:17942748 Dnase1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Dnase1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DNASE1 mRNA CTD PMID:26377647 Dnase1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Dnase1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DNASE1 mRNA CTD PMID:17942748 Dnase1 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Dnase1 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Dnase1 Rat 3-chloropropane-1,2-diol multiple interactions ISO Dnase1 (Mus musculus) 6480464 [alpha-Chlorohydrin co-treated with glycidol] results in decreased expression of DNASE1 mRNA CTD PMID:33187795 Dnase1 Rat 5-bromo-2'-deoxyuridine multiple interactions ISO Dnase1 (Mus musculus) 6480464 [Bromodeoxyuridine co-treated with furan] affects the expression of DNASE1 mRNA CTD PMID:24910943 Dnase1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of DNASE1 mRNA CTD PMID:24780913 Dnase1 Rat all-trans-retinoic acid increases expression ISO DNASE1 (Homo sapiens) 6480464 Tretinoin results in increased expression of DNASE1 protein CTD PMID:15982314 Dnase1 Rat Allylamine increases expression EXP 6480464 Allylamine results in increased expression of DNASE1 mRNA CTD PMID:15910882 Dnase1 Rat amiodarone increases expression ISO DNASE1 (Homo sapiens) 6480464 Amiodarone results in increased expression of DNASE1 mRNA CTD PMID:19774075 Dnase1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of DNASE1 mRNA CTD PMID:16483693 Dnase1 Rat aristolochic acid A increases expression ISO DNASE1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of DNASE1 mRNA CTD PMID:33212167 Dnase1 Rat bisphenol F decreases expression ISO Dnase1 (Mus musculus) 6480464 bisphenol F results in decreased expression of DNASE1 mRNA CTD PMID:38685157 Dnase1 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of DNASE1 promoter CTD PMID:22457795 Dnase1 Rat cadmium dichloride increases expression ISO DNASE1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of DNASE1 mRNA CTD PMID:12160620 Dnase1 Rat cadmium dichloride decreases expression ISO Dnase1 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of DNASE1 mRNA CTD PMID:15501611 Dnase1 Rat CGP 52608 multiple interactions ISO DNASE1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to DNASE1 gene] CTD PMID:28238834 Dnase1 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of DNASE1 mRNA CTD PMID:23914054 Dnase1 Rat dorsomorphin multiple interactions ISO DNASE1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DNASE1 mRNA CTD PMID:27188386 Dnase1 Rat doxorubicin decreases secretion EXP 6480464 Doxorubicin results in decreased secretion of DNASE1 protein CTD PMID:28885000 Dnase1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of DNASE1 mRNA CTD PMID:29391264 Dnase1 Rat formaldehyde increases expression ISO DNASE1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of DNASE1 mRNA CTD PMID:23649840 Dnase1 Rat furan multiple interactions ISO Dnase1 (Mus musculus) 6480464 [Bromodeoxyuridine co-treated with furan] affects the expression of DNASE1 mRNA CTD PMID:24910943 Dnase1 Rat genistein affects expression ISO DNASE1 (Homo sapiens) 6480464 Genistein affects the expression of DNASE1 mRNA CTD PMID:26865667 Dnase1 Rat glycidol multiple interactions ISO Dnase1 (Mus musculus) 6480464 [alpha-Chlorohydrin co-treated with glycidol] results in decreased expression of DNASE1 mRNA CTD PMID:33187795 Dnase1 Rat glyphosate increases expression ISO Dnase1 (Mus musculus) 6480464 Glyphosate results in increased expression of DNASE1 mRNA CTD PMID:35897073 Dnase1 Rat GW 4064 increases expression ISO Dnase1 (Mus musculus) 6480464 GW 4064 results in increased expression of DNASE1 mRNA CTD PMID:26655953 Dnase1 Rat inulin multiple interactions ISO Dnase1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of DNASE1 mRNA CTD PMID:36331819 Dnase1 Rat isotretinoin increases expression ISO DNASE1 (Homo sapiens) 6480464 Isotretinoin results in increased expression of DNASE1 protein CTD PMID:15982314 Dnase1 Rat L-ascorbic acid multiple interactions ISO DNASE1 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in decreased expression of DNASE1 mRNA CTD PMID:17639512 Dnase1 Rat lead nitrate multiple interactions ISO Dnase1 (Mus musculus) 6480464 lead nitrate affects the reaction [DNASE1 affects the expression of MT1 mRNA] and lead nitrate affects the reaction [DNASE1 affects the expression of MT2 mRNA] CTD PMID:11891201 Dnase1 Rat methamphetamine increases expression ISO Dnase1 (Mus musculus) 6480464 Methamphetamine results in increased expression of DNASE1 mRNA CTD PMID:26307267 Dnase1 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of DNASE1 mRNA CTD PMID:19564919 Dnase1 Rat methamphetamine multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of DNASE1 mRNA CTD PMID:19564919 Dnase1 Rat methotrexate increases expression ISO DNASE1 (Homo sapiens) 6480464 Methotrexate results in increased expression of DNASE1 mRNA CTD PMID:17400583 and PMID:24449571 Dnase1 Rat nickel atom decreases expression ISO DNASE1 (Homo sapiens) 6480464 Nickel results in decreased expression of DNASE1 mRNA CTD PMID:25583101 Dnase1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of DNASE1 mRNA CTD PMID:22546817 Dnase1 Rat p-menthan-3-ol decreases expression ISO DNASE1 (Homo sapiens) 6480464 Menthol results in decreased expression of DNASE1 mRNA CTD PMID:26760959 Dnase1 Rat paracetamol increases expression ISO Dnase1 (Mus musculus) 6480464 Acetaminophen results in increased expression of DNASE1 mRNA CTD PMID:17585979 Dnase1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of DNASE1 mRNA CTD PMID:33387578 Dnase1 Rat paracetamol increases expression ISO DNASE1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of DNASE1 mRNA CTD PMID:22230336 Dnase1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Dnase1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DNASE1 mRNA more ... CTD PMID:36331819 Dnase1 Rat pinostrobin increases expression ISO DNASE1 (Homo sapiens) 6480464 pinostrobin results in increased expression of DNASE1 mRNA CTD PMID:37777166 Dnase1 Rat pirinixic acid decreases expression ISO Dnase1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of DNASE1 mRNA CTD PMID:17426115 Dnase1 Rat pirinixic acid increases expression ISO Dnase1 (Mus musculus) 6480464 pirinixic acid results in increased expression of DNASE1 mRNA CTD PMID:18301758 and PMID:23811191 Dnase1 Rat quercetin multiple interactions ISO DNASE1 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in decreased expression of DNASE1 mRNA CTD PMID:17639512 Dnase1 Rat SB 431542 multiple interactions ISO DNASE1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DNASE1 mRNA CTD PMID:27188386 Dnase1 Rat SCH 23390 multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of DNASE1 mRNA CTD PMID:19564919 Dnase1 Rat sodium arsenite increases expression ISO DNASE1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of DNASE1 mRNA CTD PMID:38568856 Dnase1 Rat sodium dichromate decreases expression ISO Dnase1 (Mus musculus) 6480464 sodium bichromate results in decreased expression of DNASE1 mRNA CTD PMID:22155349 Dnase1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of DNASE1 mRNA CTD PMID:12325037 Dnase1 Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of DNASE1 mRNA CTD PMID:11960910 Dnase1 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of DNASE1 mRNA CTD PMID:22561333 Dnase1 Rat tamoxifen affects expression ISO Dnase1 (Mus musculus) 6480464 Tamoxifen affects the expression of DNASE1 mRNA CTD PMID:17555576 Dnase1 Rat tetrachloromethane multiple interactions ISO Dnase1 (Mus musculus) 6480464 DNASE1 protein inhibits the reaction [Carbon Tetrachloride results in increased expression of CCL2 mRNA] more ... CTD PMID:32033504 Dnase1 Rat thimerosal decreases expression ISO DNASE1 (Homo sapiens) 6480464 Thimerosal results in decreased expression of DNASE1 mRNA CTD PMID:27188386 Dnase1 Rat trichloroethene increases expression ISO Dnase1 (Mus musculus) 6480464 Trichloroethylene results in increased expression of DNASE1 mRNA CTD PMID:25549359 Dnase1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of DNASE1 mRNA CTD PMID:33387578 Dnase1 Rat triphenyl phosphate affects expression ISO DNASE1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of DNASE1 mRNA CTD PMID:37042841 Dnase1 Rat urethane decreases expression ISO DNASE1 (Homo sapiens) 6480464 Urethane results in decreased expression of DNASE1 mRNA CTD PMID:28818685 Dnase1 Rat valproic acid affects expression ISO Dnase1 (Mus musculus) 6480464 Valproic Acid affects the expression of DNASE1 mRNA CTD PMID:17292431 and PMID:17963808 Dnase1 Rat valproic acid multiple interactions ISO DNASE1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DNASE1 mRNA CTD PMID:27188386 Dnase1 Rat valproic acid decreases expression ISO DNASE1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of DNASE1 mRNA CTD PMID:26272509 Dnase1 Rat valproic acid increases methylation ISO DNASE1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of DNASE1 gene CTD PMID:29154799 Dnase1 Rat vancomycin increases expression ISO Dnase1 (Mus musculus) 6480464 Vancomycin results in increased expression of DNASE1 mRNA CTD PMID:18930951
(1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3-chloropropane-1,2-diol (ISO) 5-bromo-2'-deoxyuridine (ISO) 6-propyl-2-thiouracil (EXP) all-trans-retinoic acid (ISO) Allylamine (EXP) amiodarone (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) bisphenol F (ISO) cadmium dichloride (EXP,ISO) CGP 52608 (ISO) decabromodiphenyl ether (EXP) dorsomorphin (ISO) doxorubicin (EXP) endosulfan (EXP) formaldehyde (ISO) furan (ISO) genistein (ISO) glycidol (ISO) glyphosate (ISO) GW 4064 (ISO) inulin (ISO) isotretinoin (ISO) L-ascorbic acid (ISO) lead nitrate (ISO) methamphetamine (EXP,ISO) methotrexate (ISO) nickel atom (ISO) nickel dichloride (EXP) p-menthan-3-ol (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) pinostrobin (ISO) pirinixic acid (ISO) quercetin (ISO) SB 431542 (ISO) SCH 23390 (EXP) sodium arsenite (ISO) sodium dichromate (EXP,ISO) tamoxifen (ISO) tetrachloromethane (ISO) thimerosal (ISO) trichloroethene (EXP,ISO) triphenyl phosphate (ISO) urethane (ISO) valproic acid (ISO) vancomycin (ISO)
1.
Identification and expression of deoxyribonuclease (DNase) I alternative transcripts in the rat.
Basnakian AG, etal., Gene 2002 May 1;289(1-2):87-96.
2.
Decreased serum DNase1-activity in patients with autoimmune liver diseases.
Gatselis NK, etal., Autoimmunity. 2017 Mar;50(2):125-132. doi: 10.1080/08916934.2017.1279610. Epub 2017 Feb 14.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Host DNases prevent vascular occlusion by neutrophil extracellular traps.
Jiménez-Alcázar M, etal., Science. 2017 Dec 1;358(6367):1202-1206. doi: 10.1126/science.aam8897.
6.
DNase I primary transcript is alternatively spliced in both normal and apoptotic cells: no evidence of up-regulation in apoptosis.
Liu QY, etal., DNA Cell Biol 1997 Aug;16(8):911-8.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
Characterization of the endogenous deoxyribonuclease involved in nuclear DNA degradation during apoptosis (programmed cell death).
Peitsch MC, etal., EMBO J. 1993 Jan;12(1):371-7.
11.
Nucleotide sequence of a full length cDNA clone encoding the deoxyribonuclease I from the rat parotid gland.
Polzar B and Mannherz HG, Nucleic Acids Res 1990 Dec 11;18(23):7151.
12.
GOA pipeline
RGD automated data pipeline
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
15.
DNase I is present in the chief cells of human and rat stomachs.
Tsutsumi S, etal., Histochem J 2001 Sep-Oct;33(9-10):531-5.
16.
Immunohistochemical study of the apoptosis process in epidermal epithelial cells of rats under a physiological condition.
Udayanga KG, etal., Histol Histopathol. 2011 Jul;26(7):811-20. doi: 10.14670/HH-26.811.
Dnase1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 12,005,305 - 12,030,615 (-) NCBI GRCr8 mRatBN7.2 10 11,498,930 - 11,505,151 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 11,498,931 - 11,501,869 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 16,206,518 - 16,209,457 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 15,695,347 - 15,698,286 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 11,364,678 - 11,367,617 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 11,757,681 - 11,760,672 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 11,757,682 - 11,760,620 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 10,512,148 - 10,515,131 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 11,762,570 - 11,765,509 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 11,762,569 - 11,765,509 (-) NCBI Celera 10 10,455,483 - 10,458,422 (-) NCBI Celera Cytogenetic Map 10 q12 NCBI
DNASE1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 3,611,760 - 3,665,461 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 3,611,728 - 3,680,143 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 3,661,761 - 3,715,462 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 3,642,941 - 3,648,097 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 3,642,940 - 3,648,096 NCBI Celera 16 3,909,706 - 3,914,804 (+) NCBI Celera Cytogenetic Map 16 p13.3 NCBI HuRef 16 3,671,995 - 3,677,205 (+) NCBI HuRef CHM1_1 16 3,702,960 - 3,708,116 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 3,639,029 - 3,692,728 (+) NCBI T2T-CHM13v2.0
Dnase1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 3,855,007 - 3,857,888 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 3,854,806 - 3,857,888 (+) Ensembl GRCm39 Ensembl GRCm38 16 4,036,958 - 4,040,024 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 4,036,942 - 4,040,024 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 4,037,145 - 4,040,024 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 3,952,382 - 3,955,252 (+) NCBI MGSCv36 mm8 Celera 16 4,669,458 - 4,672,337 (+) NCBI Celera Cytogenetic Map 16 A1 NCBI cM Map 16 2.37 NCBI
Dnase1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955442 13,733,107 - 13,736,527 (-) NCBI ChiLan1.0 ChiLan1.0
DNASE1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 4,136,615 - 4,191,061 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 7,920,194 - 7,971,346 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 2,532,281 - 2,583,408 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 3,708,189 - 3,758,615 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 3,708,189 - 3,758,615 (+) Ensembl panpan1.1 panPan2
DNASE1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 37,596,735 - 37,599,953 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 37,595,911 - 37,599,827 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 38,925,673 - 38,928,375 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 37,811,866 - 37,814,684 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 37,811,867 - 37,814,566 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 37,595,076 - 37,597,778 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 37,488,193 - 37,490,895 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 37,898,900 - 37,901,602 (-) NCBI UU_Cfam_GSD_1.0
Dnase1
DNASE1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 38,586,602 - 38,646,833 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 38,590,045 - 38,646,852 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 39,859,278 - 39,914,463 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DNASE1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 3,310,853 - 3,352,483 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 3,310,824 - 3,339,870 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666068 27,475,814 - 27,507,119 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dnase1
.
Assembly: RGSC_v3.4 Assembly: Rnor_5.0
Predicted Target Of
Count of predictions: 102 Count of miRNA genes: 87 Interacting mature miRNAs: 90 Transcripts: ENSRNOT00000009283 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 634329 Pia15 Pristane induced arthritis QTL 15 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 1 24158324 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 7387235 Uae41 Urinary albumin excretion QTL 41 5.26 0.1874 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 1 29497586 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 737820 Alc9 Alcohol consumption QTL 9 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 19233348 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 631828 Alc5 Alcohol consumption QTL 5 2.4 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 17245662 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 631660 Hcar1 Hepatocarcinoma resistance QTL 1 3.4 0.0001 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 10 6154182 15990232 Rat 1576304 Schws7 Schwannoma susceptibility QTL 7 0.0115 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 4765527 19816042 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat
RH129035
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 11,498,936 - 11,499,117 (+) MAPPER mRatBN7.2 Rnor_6.0 10 11,757,688 - 11,757,868 NCBI Rnor6.0 Rnor_5.0 10 10,512,155 - 10,512,335 UniSTS Rnor5.0 RGSC_v3.4 10 11,762,577 - 11,762,757 UniSTS RGSC3.4 Celera 10 10,455,490 - 10,455,670 UniSTS Cytogenetic Map 10 q12 UniSTS
RH94863
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 11,498,754 - 11,498,992 (+) MAPPER mRatBN7.2 Rnor_6.0 10 11,757,506 - 11,757,743 NCBI Rnor6.0 Rnor_5.0 10 10,511,973 - 10,512,210 UniSTS Rnor5.0 RGSC_v3.4 10 11,762,395 - 11,762,632 UniSTS RGSC3.4 Celera 10 10,455,308 - 10,455,545 UniSTS Cytogenetic Map 10 q12 UniSTS
RH140196
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 12,004,916 - 12,005,258 (+) Marker Load Pipeline mRatBN7.2 10 11,498,541 - 11,498,883 (+) MAPPER mRatBN7.2 Rnor_6.0 10 11,757,293 - 11,757,634 NCBI Rnor6.0 Rnor_5.0 10 10,511,760 - 10,512,101 UniSTS Rnor5.0 RGSC_v3.4 10 11,762,182 - 11,762,523 UniSTS RGSC3.4 Celera 10 10,455,095 - 10,455,436 UniSTS Cytogenetic Map 10 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
111
88
87
56
25
56
6
215
97
91
45
58
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009283 ⟹ ENSRNOP00000009283
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 11,498,931 - 11,501,869 (-) Ensembl Rnor_6.0 Ensembl 10 11,757,682 - 11,760,620 (-) Ensembl
RefSeq Acc Id:
NM_013097 ⟹ NP_037229
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 12,005,305 - 12,008,244 (-) NCBI mRatBN7.2 10 11,498,930 - 11,501,869 (-) NCBI Rnor_6.0 10 11,757,681 - 11,760,620 (-) NCBI Rnor_5.0 10 10,512,148 - 10,515,131 (-) NCBI RGSC_v3.4 10 11,762,570 - 11,765,509 (-) RGD Celera 10 10,455,483 - 10,458,422 (-) RGD
Sequence:
GTGACCTGGAAAGCTAGCAGGTCTGTAATTCCCCAGTGCTTTTTGTTTTTCTCCTTTATATATTTTATAAAAGGATTTTTCCTTTAAAAGCAAAAGGAGAAATTAGTATCAGAATACTCTAGGTTTCA
hide sequence
RefSeq Acc Id:
XM_039085292 ⟹ XP_038941220
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 12,005,305 - 12,030,615 (-) NCBI mRatBN7.2 10 11,499,079 - 11,505,151 (-) NCBI
RefSeq Acc Id:
XM_039085293 ⟹ XP_038941221
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 12,005,305 - 12,030,615 (-) NCBI mRatBN7.2 10 11,499,079 - 11,505,151 (-) NCBI
RefSeq Acc Id:
XM_063268482 ⟹ XP_063124552
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 12,005,305 - 12,030,615 (-) NCBI
RefSeq Acc Id:
XM_063268483 ⟹ XP_063124553
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 12,005,305 - 12,030,615 (-) NCBI
RefSeq Acc Id:
NP_037229 ⟸ NM_013097
- Peptide Label:
precursor
- UniProtKB:
Q5FVU6 (UniProtKB/Swiss-Prot), P21704 (UniProtKB/Swiss-Prot), A6K4T9 (UniProtKB/TrEMBL)
- Sequence:
MRYTGLMGILLTLVNLLQLAATLRIAAFNIRTFGDTKMSNATLSSYIVKILSRYDIAVVQEVRDTHLVAVGKLLDELNRDIPDNYRYIISEPLGRKSYKEQYLFVYRPSQVSVLDSYHYDDGCEPCGN
hide sequence
Ensembl Acc Id:
ENSRNOP00000009283 ⟸ ENSRNOT00000009283
RefSeq Acc Id:
XP_038941221 ⟸ XM_039085293
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038941220 ⟸ XM_039085292
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063124553 ⟸ XM_063268483
- Peptide Label:
isoform X2
- UniProtKB:
Q5FVU6 (UniProtKB/Swiss-Prot), P21704 (UniProtKB/Swiss-Prot), A6K4T9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063124552 ⟸ XM_063268482
- Peptide Label:
isoform X2
- UniProtKB:
Q5FVU6 (UniProtKB/Swiss-Prot), P21704 (UniProtKB/Swiss-Prot), A6K4T9 (UniProtKB/TrEMBL)
RGD ID: 13696981 Promoter ID: EPDNEW_R7506 Type: initiation region Name: Dnase1_1 Description: deoxyribonuclease 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 11,760,632 - 11,760,692 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-07-27
Dnase1
deoxyribonuclease 1
Dnase1
deoxyribonuclease I
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Dnase1
Deoxyribonuclease I
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in the cytoplasm of chief cells of the rat pars glandularis
1298887
gene_expression
expressed principally in tissues of the digestive system
619702
gene_function
cleaves DNA endonucleolytically to yield primarily 5'-phosphodinucleotide and oligonucleotide end products
1300414
gene_homology
bovine homologue binds actin
1298889
gene_process
may not be involved in apoptosis-induced DNA degradation
1298887
gene_process
role in digestive tissues is to hydrolyze DNA
619702
gene_process
role in tissues other than those involved in digestion is uncertain
619702
gene_transcript
produces alternative transcripts
619702
