Symbol:
Pde4dip
Name:
phosphodiesterase 4D interacting protein (myomegalin)
RGD ID:
1620696
MGI Page
MGI
Description:
Predicted to enable enzyme binding activity and molecular adaptor activity. Predicted to be involved in microtubule cytoskeleton organization; protein-containing complex assembly; and regulation of organelle organization. Predicted to be located in myofibril and nucleus. Predicted to be active in Golgi apparatus and centrosome. Predicted to colocalize with cortical microtubule plus-end. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; respiratory system; and sensory organ. Orthologous to human PDE4DIP (phosphodiesterase 4D interacting protein).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
4732458A06Rik; 9430063L05Rik; C87016; D130016K21Rik; D3Bwg1078e; KIAA0477; MGC176146; mKIAA0454; myomegalin; phosphodiesterase 4D-interacting protein; upregulated during skeletal muscle growth 4; Usmg; Usmg4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 97,597,144 - 97,796,023 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 97,597,140 - 97,796,023 (-) Ensembl GRCm39 Ensembl GRCm38 3 97,689,828 - 97,888,707 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 97,689,824 - 97,888,707 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 97,493,751 - 97,692,630 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 97,775,233 - 97,974,112 (-) NCBI MGSCv36 mm8 Celera 3 99,089,670 - 99,287,699 (-) NCBI Celera Cytogenetic Map 3 F2.2 NCBI cM Map 3 42.28 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pde4dip Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PDE4DIP mRNA CTD PMID:36331819 Pde4dip Mouse 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Pde4dip Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of PDE4DIP mRNA CTD PMID:22206623 Pde4dip Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of PDE4DIP mRNA CTD PMID:22206623 Pde4dip Mouse 1,3-dinitrobenzene decreases expression ISO Pde4dip (Rattus norvegicus) 6480464 3-dinitrobenzene results in decreased expression of PDE4DIP mRNA CTD PMID:21983209 Pde4dip Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PDE4DIP mRNA CTD PMID:17942748 Pde4dip Mouse 17beta-estradiol decreases expression ISO Pde4dip (Rattus norvegicus) 6480464 Estradiol results in decreased expression of PDE4DIP mRNA CTD PMID:32145629 Pde4dip Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PDE4DIP mRNA CTD PMID:39298647 Pde4dip Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Pde4dip Mouse 2,2',5,5'-tetrachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Pde4dip Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PDE4DIP mRNA CTD PMID:17942748 Pde4dip Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PDE4DIP mRNA CTD PMID:21570461 Pde4dip Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pde4dip (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PDE4DIP mRNA CTD PMID:21215274 Pde4dip Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PDE4DIP mRNA CTD PMID:19465110 Pde4dip Mouse 2,4,4'-trichlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Pde4dip Mouse 2,6-dinitrotoluene affects expression ISO Pde4dip (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of PDE4DIP mRNA CTD PMID:21346803 Pde4dip Mouse 3,3',4,4'-tetrachlorobiphenyl multiple interactions EXP 6480464 3 more ... CTD PMID:19467301 Pde4dip Mouse 3-chloropropane-1,2-diol increases expression ISO Pde4dip (Rattus norvegicus) 6480464 alpha-Chlorohydrin results in increased expression of PDE4DIP protein CTD PMID:34915118 Pde4dip Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PDE4DIP mRNA CTD PMID:28628672 Pde4dip Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of PDE4DIP mRNA CTD PMID:39298647 Pde4dip Mouse 4,4'-sulfonyldiphenol increases methylation EXP 6480464 bisphenol S results in increased methylation of PDE4DIP exon CTD PMID:33297965 Pde4dip Mouse 4-amino-2,6-dinitrotoluene affects expression ISO Pde4dip (Rattus norvegicus) 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of PDE4DIP mRNA CTD PMID:21346803 Pde4dip Mouse 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of PDE4DIP mRNA CTD PMID:28973697 Pde4dip Mouse 5-aza-2'-deoxycytidine affects expression ISO PDE4DIP (Homo sapiens) 6480464 Decitabine affects the expression of PDE4DIP mRNA CTD PMID:17145863 Pde4dip Mouse 6-propyl-2-thiouracil increases expression ISO Pde4dip (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of PDE4DIP mRNA CTD PMID:36843608 Pde4dip Mouse 7,12-dimethyltetraphene decreases expression EXP 6480464 9 more ... CTD PMID:32553695 Pde4dip Mouse acrylamide increases expression ISO Pde4dip (Rattus norvegicus) 6480464 Acrylamide results in increased expression of PDE4DIP mRNA CTD PMID:28959563 Pde4dip Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PDE4DIP mRNA CTD PMID:19770486 Pde4dip Mouse aflatoxin B1 decreases methylation ISO PDE4DIP (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PDE4DIP gene CTD PMID:27153756 Pde4dip Mouse all-trans-retinoic acid multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [Tretinoin co-treated with arsenic trioxide] affects the expression of PDE4DIP mRNA CTD PMID:15894607 Pde4dip Mouse all-trans-retinoic acid increases expression ISO PDE4DIP (Homo sapiens) 6480464 Tretinoin results in increased expression of PDE4DIP mRNA CTD PMID:15894607 and PMID:23724009 Pde4dip Mouse alpha-Zearalanol multiple interactions ISO Pde4dip (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PDE4DIP mRNA CTD PMID:35163327 Pde4dip Mouse alpha-Zearalanol decreases expression ISO Pde4dip (Rattus norvegicus) 6480464 Zeranol results in decreased expression of PDE4DIP mRNA CTD PMID:35163327 Pde4dip Mouse ammonium chloride affects expression ISO Pde4dip (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of PDE4DIP mRNA CTD PMID:16483693 Pde4dip Mouse amphetamine decreases expression ISO Pde4dip (Rattus norvegicus) 6480464 Amphetamine results in decreased expression of PDE4DIP mRNA CTD PMID:30779732 Pde4dip Mouse amphotericin B decreases expression ISO PDE4DIP (Homo sapiens) 6480464 Amphotericin B analog results in decreased expression of PDE4DIP mRNA CTD PMID:28534445 Pde4dip Mouse antirheumatic drug increases expression ISO PDE4DIP (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PDE4DIP mRNA CTD PMID:24449571 Pde4dip Mouse arachidonic acid decreases expression ISO PDE4DIP (Homo sapiens) 6480464 Arachidonic Acid results in decreased expression of PDE4DIP mRNA CTD PMID:16704987 Pde4dip Mouse arsane affects methylation ISO PDE4DIP (Homo sapiens) 6480464 Arsenic affects the methylation of PDE4DIP gene CTD PMID:25304211 Pde4dip Mouse arsenic atom affects methylation ISO PDE4DIP (Homo sapiens) 6480464 Arsenic affects the methylation of PDE4DIP gene CTD PMID:25304211 Pde4dip Mouse arsenite(3-) affects expression ISO PDE4DIP (Homo sapiens) 6480464 arsenite affects the expression of PDE4DIP mRNA CTD PMID:22959463 Pde4dip Mouse arsenous acid multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [Tretinoin co-treated with Arsenic Trioxide] affects the expression of PDE4DIP mRNA CTD PMID:15894607 Pde4dip Mouse arsenous acid increases expression ISO PDE4DIP (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PDE4DIP mRNA CTD PMID:15761015 Pde4dip Mouse benzo[a]pyrene multiple interactions EXP 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of PDE4DIP mRNA] CTD PMID:22228805 Pde4dip Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene metabolite results in decreased expression of PDE4DIP mRNA CTD PMID:32553695 Pde4dip Mouse benzo[a]pyrene decreases methylation ISO PDE4DIP (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PDE4DIP exon and Benzo(a)pyrene results in decreased methylation of PDE4DIP promoter CTD PMID:27901495 Pde4dip Mouse beta-lapachone decreases expression ISO PDE4DIP (Homo sapiens) 6480464 beta-lapachone results in decreased expression of PDE4DIP mRNA CTD PMID:38218311 Pde4dip Mouse bisphenol A increases expression ISO PDE4DIP (Homo sapiens) 6480464 bisphenol A results in increased expression of PDE4DIP mRNA CTD PMID:20678512 and PMID:29275510 Pde4dip Mouse bisphenol A affects expression ISO Pde4dip (Rattus norvegicus) 6480464 bisphenol A affects the expression of PDE4DIP mRNA CTD PMID:32145629 Pde4dip Mouse bisphenol A increases methylation ISO Pde4dip (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of PDE4DIP gene CTD PMID:28505145 Pde4dip Mouse bisphenol A decreases expression ISO Pde4dip (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of PDE4DIP mRNA CTD PMID:25181051 Pde4dip Mouse bisphenol A increases expression ISO Pde4dip (Rattus norvegicus) 6480464 bisphenol A results in increased expression of PDE4DIP mRNA CTD PMID:18180321 Pde4dip Mouse bisphenol F multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PDE4DIP mRNA CTD PMID:28628672 Pde4dip Mouse butanal decreases expression ISO PDE4DIP (Homo sapiens) 6480464 butyraldehyde results in decreased expression of PDE4DIP mRNA CTD PMID:26079696 Pde4dip Mouse C60 fullerene affects expression ISO Pde4dip (Rattus norvegicus) 6480464 fullerene C60 affects the expression of PDE4DIP mRNA CTD PMID:19167457 Pde4dip Mouse cadmium dichloride decreases expression ISO Pde4dip (Rattus norvegicus) 6480464 Cadmium Chloride results in decreased expression of PDE4DIP mRNA CTD PMID:33453195 Pde4dip Mouse cantharidin decreases expression EXP 6480464 Cantharidin results in decreased expression of PDE4DIP mRNA CTD PMID:36907384 Pde4dip Mouse carbon nanotube affects expression EXP 6480464 Nanotubes and Carbon affects the expression of PDE4DIP mRNA CTD PMID:25554681 Pde4dip Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes and Carbon results in decreased expression of PDE4DIP mRNA CTD PMID:25554681 Pde4dip Mouse CGP 52608 multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PDE4DIP gene] CTD PMID:28238834 Pde4dip Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PDE4DIP mRNA CTD PMID:20938992 Pde4dip Mouse clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of PDE4DIP mRNA CTD PMID:23811191 Pde4dip Mouse clothianidin increases expression ISO PDE4DIP (Homo sapiens) 6480464 clothianidin results in increased expression of PDE4DIP mRNA CTD PMID:31626844 Pde4dip Mouse cobalt dichloride decreases expression ISO Pde4dip (Rattus norvegicus) 6480464 cobaltous chloride results in decreased expression of PDE4DIP mRNA CTD PMID:24386269 Pde4dip Mouse cocaine decreases expression ISO PDE4DIP (Homo sapiens) 6480464 Cocaine results in decreased expression of PDE4DIP mRNA CTD PMID:16710320 Pde4dip Mouse crocidolite asbestos affects expression ISO PDE4DIP (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of PDE4DIP mRNA CTD PMID:25757056 Pde4dip Mouse cyclosporin A decreases expression ISO PDE4DIP (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PDE4DIP mRNA CTD PMID:20106945 Pde4dip Mouse DDE decreases expression ISO PDE4DIP (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of PDE4DIP mRNA CTD PMID:38568856 Pde4dip Mouse dexamethasone multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PDE4DIP mRNA CTD PMID:28628672 Pde4dip Mouse diarsenic trioxide multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [Tretinoin co-treated with Arsenic Trioxide] affects the expression of PDE4DIP mRNA CTD PMID:15894607 Pde4dip Mouse diarsenic trioxide increases expression ISO PDE4DIP (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PDE4DIP mRNA CTD PMID:15761015 Pde4dip Mouse dorsomorphin multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pde4dip Mouse doxorubicin decreases expression ISO PDE4DIP (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PDE4DIP mRNA CTD PMID:29803840 Pde4dip Mouse entinostat increases expression ISO PDE4DIP (Homo sapiens) 6480464 entinostat results in increased expression of PDE4DIP mRNA CTD PMID:27188386 Pde4dip Mouse enzyme inhibitor multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PDE4DIP protein CTD PMID:23301498 Pde4dip Mouse ethanol increases expression ISO Pde4dip (Rattus norvegicus) 6480464 Ethanol results in increased expression of PDE4DIP mRNA CTD PMID:20655511 Pde4dip Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of PDE4DIP mRNA CTD PMID:30319688 Pde4dip Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of PDE4DIP mRNA CTD PMID:26730594 Pde4dip Mouse fenthion decreases expression EXP 6480464 Fenthion results in decreased expression of PDE4DIP mRNA CTD PMID:34813904 Pde4dip Mouse folic acid multiple interactions EXP 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Pde4dip Mouse folic acid increases expression EXP 6480464 Folic Acid results in increased expression of PDE4DIP mRNA CTD PMID:25629700 Pde4dip Mouse FR900359 affects phosphorylation ISO PDE4DIP (Homo sapiens) 6480464 FR900359 affects the phosphorylation of PDE4DIP protein CTD PMID:37730182 Pde4dip Mouse geldanamycin increases expression ISO PDE4DIP (Homo sapiens) 6480464 geldanamycin results in increased expression of PDE4DIP mRNA CTD PMID:26705709 Pde4dip Mouse genistein increases expression EXP 6480464 Genistein results in increased expression of PDE4DIP mRNA CTD PMID:32186404 Pde4dip Mouse gentamycin increases expression ISO Pde4dip (Rattus norvegicus) 6480464 Gentamicins results in increased expression of PDE4DIP mRNA CTD PMID:33387578 Pde4dip Mouse heroin increases expression ISO PDE4DIP (Homo sapiens) 6480464 Heroin results in increased expression of PDE4DIP mRNA CTD PMID:16710320 Pde4dip Mouse indometacin multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PDE4DIP mRNA CTD PMID:28628672 Pde4dip Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PDE4DIP mRNA CTD PMID:36331819 Pde4dip Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PDE4DIP mRNA CTD PMID:20938992 Pde4dip Mouse lead diacetate multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [lead acetate co-treated with zinc protoporphyrin] results in increased expression of PDE4DIP mRNA CTD PMID:22839698 Pde4dip Mouse lead(0) decreases expression ISO PDE4DIP (Homo sapiens) 6480464 Lead results in decreased expression of PDE4DIP mRNA CTD PMID:19921347 Pde4dip Mouse lead(0) affects expression ISO PDE4DIP (Homo sapiens) 6480464 Lead affects the expression of PDE4DIP mRNA CTD PMID:28903495 Pde4dip Mouse mercury atom increases expression ISO PDE4DIP (Homo sapiens) 6480464 Mercury results in increased expression of PDE4DIP mRNA CTD PMID:16823088 Pde4dip Mouse mercury(0) increases expression ISO PDE4DIP (Homo sapiens) 6480464 Mercury results in increased expression of PDE4DIP mRNA CTD PMID:16823088 Pde4dip Mouse methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of PDE4DIP mRNA CTD PMID:26307267 Pde4dip Mouse methoxychlor affects methylation ISO Pde4dip (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of PDE4DIP gene CTD PMID:35440735 Pde4dip Mouse methyl methanesulfonate increases expression ISO PDE4DIP (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of PDE4DIP mRNA CTD PMID:23649840 Pde4dip Mouse N(4)-hydroxycytidine decreases expression EXP 6480464 N(4)-hydroxycytidine results in decreased expression of PDE4DIP mRNA CTD PMID:37748715 Pde4dip Mouse N,N-diethyl-m-toluamide multiple interactions ISO Pde4dip (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in increased methylation of PDE4DIP gene CTD PMID:33148267 Pde4dip Mouse nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of PDE4DIP mRNA CTD PMID:12540486 Pde4dip Mouse nickel atom decreases expression ISO PDE4DIP (Homo sapiens) 6480464 Nickel results in decreased expression of PDE4DIP mRNA CTD PMID:25583101 Pde4dip Mouse nickel sulfate decreases expression ISO PDE4DIP (Homo sapiens) 6480464 nickel sulfate results in decreased expression of PDE4DIP mRNA CTD PMID:22714537 Pde4dip Mouse ochratoxin A increases expression ISO Pde4dip (Rattus norvegicus) 6480464 ochratoxin A results in increased expression of PDE4DIP mRNA CTD PMID:22124623 Pde4dip Mouse okadaic acid decreases expression ISO PDE4DIP (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of PDE4DIP mRNA CTD PMID:38832940 Pde4dip Mouse panobinostat multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDE4DIP mRNA CTD PMID:27188386 Pde4dip Mouse panobinostat increases expression ISO PDE4DIP (Homo sapiens) 6480464 panobinostat results in increased expression of PDE4DIP mRNA CTD PMID:26272509 Pde4dip Mouse paracetamol increases expression ISO PDE4DIP (Homo sapiens) 6480464 Acetaminophen results in increased expression of PDE4DIP mRNA CTD PMID:21420995 Pde4dip Mouse paracetamol affects expression ISO PDE4DIP (Homo sapiens) 6480464 Acetaminophen affects the expression of PDE4DIP mRNA CTD PMID:25458485 Pde4dip Mouse PCB138 multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Pde4dip Mouse pentanal increases expression ISO PDE4DIP (Homo sapiens) 6480464 pentanal results in increased expression of PDE4DIP mRNA CTD PMID:26079696 Pde4dip Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PDE4DIP mRNA more ... CTD PMID:36331819 Pde4dip Mouse perfluorooctanoic acid multiple interactions ISO Pde4dip (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PDE4DIP mRNA CTD PMID:35163327 Pde4dip Mouse permethrin multiple interactions ISO Pde4dip (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in increased methylation of PDE4DIP gene CTD PMID:33148267 Pde4dip Mouse phenylmercury acetate increases expression ISO PDE4DIP (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PDE4DIP mRNA CTD PMID:26272509 Pde4dip Mouse phenylmercury acetate multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDE4DIP mRNA CTD PMID:27188386 Pde4dip Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of PDE4DIP mRNA CTD PMID:23811191 Pde4dip Mouse potassium dichromate decreases expression EXP 6480464 Potassium Dichromate results in decreased expression of PDE4DIP mRNA CTD PMID:23608068 Pde4dip Mouse progesterone increases expression ISO Pde4dip (Rattus norvegicus) 6480464 Progesterone results in increased expression of PDE4DIP mRNA CTD PMID:20726854 Pde4dip Mouse propanal increases expression ISO PDE4DIP (Homo sapiens) 6480464 propionaldehyde results in increased expression of PDE4DIP mRNA CTD PMID:26079696 Pde4dip Mouse SB 431542 multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pde4dip Mouse silicon dioxide increases expression ISO PDE4DIP (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of PDE4DIP mRNA and Silicon Dioxide results in increased expression of PDE4DIP mRNA CTD PMID:23806026 and PMID:25351596 Pde4dip Mouse sodium arsenite affects methylation ISO PDE4DIP (Homo sapiens) 6480464 sodium arsenite affects the methylation of PDE4DIP gene CTD PMID:28589171 Pde4dip Mouse sodium arsenite increases expression ISO PDE4DIP (Homo sapiens) 6480464 sodium arsenite results in increased expression of PDE4DIP mRNA CTD PMID:38568856 Pde4dip Mouse succimer multiple interactions EXP 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of PDE4DIP mRNA and [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of PDE4DIP mRNA CTD PMID:21641980 and PMID:26378955 Pde4dip Mouse tert-butyl hydroperoxide increases expression ISO PDE4DIP (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of PDE4DIP mRNA CTD PMID:15336504 Pde4dip Mouse testosterone enanthate affects expression ISO PDE4DIP (Homo sapiens) 6480464 testosterone enanthate affects the expression of PDE4DIP mRNA CTD PMID:17440010 Pde4dip Mouse thapsigargin increases expression ISO PDE4DIP (Homo sapiens) 6480464 Thapsigargin results in increased expression of PDE4DIP mRNA CTD PMID:24247028 Pde4dip Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of PDE4DIP mRNA CTD PMID:23557971 Pde4dip Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of PDE4DIP mRNA CTD PMID:35295148 Pde4dip Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of PDE4DIP gene and titanium dioxide results in decreased methylation of PDE4DIP promoter CTD PMID:35295148 Pde4dip Mouse triacsin C decreases expression ISO PDE4DIP (Homo sapiens) 6480464 triacsin C results in decreased expression of PDE4DIP mRNA CTD PMID:16704987 Pde4dip Mouse Tributyltin oxide affects expression ISO PDE4DIP (Homo sapiens) 6480464 bis(tri-n-butyltin)oxide affects the expression of PDE4DIP mRNA CTD PMID:24247028 Pde4dip Mouse trichloroethene increases methylation ISO Pde4dip (Rattus norvegicus) 6480464 Trichloroethylene results in increased methylation of PDE4DIP gene CTD PMID:27618143 Pde4dip Mouse trichostatin A increases expression ISO PDE4DIP (Homo sapiens) 6480464 trichostatin A results in increased expression of PDE4DIP mRNA CTD PMID:24935251 more ... Pde4dip Mouse trichostatin A affects expression ISO PDE4DIP (Homo sapiens) 6480464 trichostatin A affects the expression of PDE4DIP mRNA CTD PMID:28542535 Pde4dip Mouse trichostatin A multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDE4DIP mRNA CTD PMID:27188386 Pde4dip Mouse triphenyl phosphate affects expression ISO PDE4DIP (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PDE4DIP mRNA CTD PMID:37042841 Pde4dip Mouse urethane increases expression ISO PDE4DIP (Homo sapiens) 6480464 Urethane results in increased expression of PDE4DIP mRNA CTD PMID:28818685 Pde4dip Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of PDE4DIP mRNA CTD PMID:17963808 Pde4dip Mouse valproic acid increases expression ISO PDE4DIP (Homo sapiens) 6480464 Valproic Acid results in increased expression of PDE4DIP mRNA CTD PMID:23179753 more ... Pde4dip Mouse valproic acid multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDE4DIP mRNA CTD PMID:27188386 Pde4dip Mouse valproic acid affects expression ISO PDE4DIP (Homo sapiens) 6480464 Valproic Acid affects the expression of PDE4DIP mRNA CTD PMID:25979313 Pde4dip Mouse valproic acid decreases methylation ISO PDE4DIP (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of PDE4DIP gene CTD PMID:29154799 Pde4dip Mouse vanadyl sulfate increases expression ISO PDE4DIP (Homo sapiens) 6480464 vanadyl sulfate results in increased expression of PDE4DIP mRNA CTD PMID:16330358 Pde4dip Mouse vinclozolin affects expression ISO Pde4dip (Rattus norvegicus) 6480464 vinclozolin affects the expression of PDE4DIP mRNA CTD PMID:19015723 Pde4dip Mouse vinclozolin increases methylation ISO Pde4dip (Rattus norvegicus) 6480464 vinclozolin results in increased methylation of PDE4DIP gene CTD PMID:31079544 Pde4dip Mouse vinclozolin decreases expression ISO Pde4dip (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of PDE4DIP mRNA CTD PMID:23034163 Pde4dip Mouse vorinostat multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDE4DIP mRNA CTD PMID:27188386 Pde4dip Mouse vorinostat increases expression ISO PDE4DIP (Homo sapiens) 6480464 vorinostat results in increased expression of PDE4DIP mRNA CTD PMID:26272509 Pde4dip Mouse zinc atom increases expression ISO PDE4DIP (Homo sapiens) 6480464 Zinc deficiency results in increased expression of PDE4DIP mRNA CTD PMID:18356318 Pde4dip Mouse zinc protoporphyrin multiple interactions ISO PDE4DIP (Homo sapiens) 6480464 [lead acetate co-treated with zinc protoporphyrin] results in increased expression of PDE4DIP mRNA CTD PMID:22839698 Pde4dip Mouse zinc(0) increases expression ISO PDE4DIP (Homo sapiens) 6480464 Zinc deficiency results in increased expression of PDE4DIP mRNA CTD PMID:18356318
(1->4)-beta-D-glucan (EXP) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (EXP) 1,2-dimethylhydrazine (EXP) 1,3-dinitrobenzene (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (EXP) 2,6-dinitrotoluene (ISO) 3,3',4,4'-tetrachlorobiphenyl (EXP) 3-chloropropane-1,2-diol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP) 4-amino-2,6-dinitrotoluene (ISO) 4-hydroxyphenyl retinamide (EXP) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (ISO) 7,12-dimethyltetraphene (EXP) acrylamide (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (ISO) ammonium chloride (ISO) amphetamine (ISO) amphotericin B (ISO) antirheumatic drug (ISO) arachidonic acid (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (EXP,ISO) beta-lapachone (ISO) bisphenol A (ISO) bisphenol F (ISO) butanal (ISO) C60 fullerene (ISO) cadmium dichloride (ISO) cantharidin (EXP) carbon nanotube (EXP) CGP 52608 (ISO) choline (EXP) clofibrate (EXP) clothianidin (ISO) cobalt dichloride (ISO) cocaine (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) DDE (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) enzyme inhibitor (ISO) ethanol (EXP,ISO) fenthion (EXP) folic acid (EXP) FR900359 (ISO) geldanamycin (ISO) genistein (EXP) gentamycin (ISO) heroin (ISO) indometacin (ISO) inulin (EXP) L-methionine (EXP) lead diacetate (ISO) lead(0) (ISO) mercury atom (ISO) mercury(0) (ISO) methamphetamine (EXP) methoxychlor (ISO) methyl methanesulfonate (ISO) N(4)-hydroxycytidine (EXP) N,N-diethyl-m-toluamide (ISO) nickel atom (EXP,ISO) nickel sulfate (ISO) ochratoxin A (ISO) okadaic acid (ISO) panobinostat (ISO) paracetamol (ISO) PCB138 (EXP) pentanal (ISO) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (ISO) permethrin (ISO) phenylmercury acetate (ISO) pirinixic acid (EXP) potassium dichromate (EXP) progesterone (ISO) propanal (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) succimer (EXP) tert-butyl hydroperoxide (ISO) testosterone enanthate (ISO) thapsigargin (ISO) titanium dioxide (EXP) triacsin C (ISO) Tributyltin oxide (ISO) trichloroethene (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) urethane (ISO) valproic acid (EXP,ISO) vanadyl sulfate (ISO) vinclozolin (ISO) vorinostat (ISO) zinc atom (ISO) zinc protoporphyrin (ISO) zinc(0) (ISO)
Pde4dip Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 97,597,144 - 97,796,023 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 97,597,140 - 97,796,023 (-) Ensembl GRCm39 Ensembl GRCm38 3 97,689,828 - 97,888,707 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 97,689,824 - 97,888,707 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 97,493,751 - 97,692,630 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 97,775,233 - 97,974,112 (-) NCBI MGSCv36 mm8 Celera 3 99,089,670 - 99,287,699 (-) NCBI Celera Cytogenetic Map 3 F2.2 NCBI cM Map 3 42.28 NCBI
PDE4DIP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 148,808,434 - 149,033,016 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 148,808,140 - 149,048,286 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 144,851,427 - 145,075,933 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 143,562,784 - 143,787,436 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 142,440,804 - 142,565,067 NCBI Celera 1 121,506,245 - 121,526,690 (+) NCBI Celera Cytogenetic Map 1 q21.2 NCBI HuRef 1 119,290,177 - 119,290,733 (-) NCBI HuRef HuRef 1 119,196,278 - 119,206,613 (-) NCBI HuRef HuRef 1 119,235,190 - 119,235,681 (-) NCBI HuRef HuRef 1 119,153,319 - 119,162,328 (-) NCBI HuRef HuRef 1 119,142,103 - 119,150,668 (-) NCBI HuRef HuRef 1 119,165,611 - 119,191,824 (-) ENTREZGENE HuRef HuRef 1 119,268,039 - 119,268,444 (-) NCBI HuRef CHM1_1 1 150,176,307 - 150,401,145 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 145,475,230 - 145,700,086 (+) NCBI T2T-CHM13v2.0
Pde4dip Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 187,982,002 - 188,178,937 (-) NCBI GRCr8 mRatBN7.2 2 185,293,236 - 185,490,100 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 185,293,214 - 185,468,379 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 192,940,676 - 193,137,388 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 190,749,615 - 190,945,831 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 185,573,289 - 185,769,975 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 199,867,965 - 200,066,034 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 199,867,972 - 200,003,443 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 219,345,687 - 219,479,200 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 192,534,747 - 192,671,053 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 192,497,500 - 192,633,807 (-) NCBI Celera 2 177,786,301 - 177,918,988 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
Pde4dip Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955568 1,322,470 - 1,546,256 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955568 1,321,053 - 1,546,351 (-) NCBI ChiLan1.0 ChiLan1.0
LOC100977296 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 102,698,937 - 102,705,916 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 102,273,207 - 102,294,457 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 122,445,609 - 122,452,842 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 113,064,912 - 113,084,501 (+) NCBI panpan1.1 PanPan1.1 panPan2
PDE4DIP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 57,135,716 - 57,359,348 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 57,135,308 - 57,358,978 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 56,773,133 - 56,996,596 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 58,127,352 - 58,351,715 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 17 57,038,235 - 57,262,228 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 57,074,929 - 57,298,766 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 57,722,757 - 57,947,007 (+) NCBI UU_Cfam_GSD_1.0
LOC100624559
PDE4DIP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666038 14,282,358 - 14,312,135 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 3601 Count of miRNA genes: 941 Interacting mature miRNAs: 1356 Transcripts: ENSMUST00000045243, ENSMUST00000090750, ENSMUST00000107038, ENSMUST00000163531, ENSMUST00000168438, ENSMUST00000175751 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142399 Aec1_m autoimmune exocrinopathy 1 (mouse) Not determined 7586174 102690034 Mouse 26884378 Skwq6_m skull length QTL 6, 10 week (mouse) 3 51907421 102307316 Mouse 1301971 Cia5_m collagen induced arthritis QTL 5 (mouse) Not determined 3 66046658 100046795 Mouse 1301392 Eae3_m susceptibility to experimental allergic encephalomyelitis 3 (mouse) Not determined 3 79548730 113548837 Mouse 1301904 Iba2_m induction of brown adipocytes 2 (mouse) Not determined 3 82147043 116147184 Mouse 26884382 Bzwq1_m bi-zygomatic width QTL 1, 5 week (mouse) 3 52207421 137205761 Mouse 11041900 Lmr11a_m leishmaniasis resistance 11a (mouse) 3 83463991 117464137 Mouse 1301398 Rapop3_m radiation-induced apoptosis 3 (mouse) Not determined 3 90511217 100464137 Mouse 26884380 Skwq1_m skull length QTL 1, 5 week (mouse) 3 43954435 101607316 Mouse 14746984 Manh54_m mandible shape 54 (mouse) 3 85289152 119289152 Mouse 12738440 Twq3_m testis weight QTL 3 (mouse) 3 87228015 121228015 Mouse 25314313 Syncl1_m synaptonemal complex length 1 (mouse) 3 67907333 128393649 Mouse 1301272 Cfsw1_m cystic fibrosis survival to weaning 1 (mouse) Not determined 3 83882912 117883044 Mouse 1301791 Char4_m P. chabaudi malaria resistance QTL 4 (mouse) Not determined 3 69625509 100655290 Mouse 11049572 Lmr11c_m leishmaniasis resistance 11c (mouse) 3 72139967 106140094 Mouse 26884436 Zlq3_m zygomatic length QTL 3, 10 week (mouse) 3 3265060 142405761 Mouse 1301277 nctm1_m Nakano cataract modifier 1 (mouse) Not determined 3 97698638 100373060 Mouse 26884427 Cvht4_m cranial vault height 4, 10 week (mouse) 3 16054164 109707316 Mouse 10766455 Sle22_m systematic lupus erythematosus susceptibility 22 (mouse) 3 90376936 124377072 Mouse 14747001 Mancz4_m mandible centroid size 4 (mouse) 3 90378017 124378017 Mouse 1301705 Sles3_m systemic lupus erythmatosus suppressor 3 (mouse) Not determined 3 37174862 143353183 Mouse 13207570 Tcq12_m total cholesterol QTL 12 (mouse) 3 16504164 130163649 Mouse 1357583 Sle18_m systematic lupus erythematosus susceptibility 18 (mouse) Not determined 3 87208904 125316236 Mouse 26884422 Cvht7_m cranial vault height 7, 16 week (mouse) 3 28954149 118893649 Mouse 4142178 Ctrq2_m C. trachomatis resistance QTL 2 (mouse) Not determined 3 89139967 137453008 Mouse 1300595 Tmevd2_m Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 2 (mouse) Not determined 3 75463302 109463549 Mouse 11251721 Ewc3_m ethanol withdrawal and consumption 3 (mouse) 3 69568554 103568554 Mouse 1300982 Lmr11_m leishmaniasis resistance 11 (mouse) Not determined 3 72139967 106140094 Mouse 1301947 Pcfm3_m periosteal circumference and femur length 3 (mouse) Not determined 3 81084652 115084797 Mouse 4142099 Cq3_m cholesterol QTL 3 (mouse) Not determined 3 84888918 118889067 Mouse 11039512 Ltpr3b_m Leishmania tropica response 3b (mouse) 3 83463991 117464137 Mouse 27226732 Tibmd3_m tibia midshaft diameter 3, 10 week (mouse) 3 96607316 147805636 Mouse 1301349 Pgia26_m proteoglycan induced arthritis 26 (mouse) Not determined 3 92251533 126251650 Mouse 11039519 Ltpr3_m Leishmania tropica response 3 (mouse) 3 56704102 100464137 Mouse 1302052 Etohcta4_m ethanol conditioned taste aversion 4 (mouse) Not determined 3 91000105 125008748 Mouse 1302056 Orgwq4_m organ weight QTL 4 (mouse) Not determined 3 30067588 147304689 Mouse 11039507 Ltpr3g_m Leishmania tropica response 3g (mouse) 3 83463991 117464137 Mouse 11039508 Ltpr3f_m Leishmania tropica response 3f (mouse) 3 83463991 117464137 Mouse 1301422 Sle11_m systematic lupus erythematosus susceptibility 11 (mouse) Not determined 3 70208904 104209042 Mouse 11039509 Ltpr3e_m Leishmania tropica response 3e (mouse) 3 83463991 117464137 Mouse 11039510 Ltpr3d_m Leishmania tropica response 3d (mouse) 3 83463991 117464137 Mouse 13208566 Bmiq5_m body mass index QTL 5 (mouse) 3 40954435 115793649 Mouse 11039511 Ltpr3c_m Leishmania tropica response 3c (mouse) 3 83463991 117464137 Mouse
D3Mit233
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 97,798,558 - 97,798,846 UniSTS GRCm38 MGSCv37 3 97,602,481 - 97,602,769 UniSTS GRCm37 Celera 3 99,198,107 - 99,198,395 UniSTS Cytogenetic Map 3 F2.2 UniSTS cM Map 3 47.0 UniSTS Whitehead Genetic 3 35.0 UniSTS Whitehead/MRC_RH 3 1112.91 UniSTS Whitehead_YAC 3 UniSTS
D3Mit41
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 97,791,322 - 97,791,530 UniSTS GRCm38 MGSCv37 3 97,595,245 - 97,595,453 UniSTS GRCm37 Celera 3 99,190,871 - 99,191,079 UniSTS Cytogenetic Map 3 F2.2 UniSTS cM Map 3 47.0 UniSTS Whitehead Genetic 3 35.0 UniSTS Whitehead/MRC_RH 3 1111.2 UniSTS Whitehead_YAC 3 UniSTS
D9Mit34.1
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 7 F1 UniSTS Cytogenetic Map 13 D1 UniSTS Cytogenetic Map 1 C3 UniSTS Cytogenetic Map 2 C1.3 UniSTS Cytogenetic Map 19 D1 UniSTS Cytogenetic Map 9 F1 UniSTS Cytogenetic Map 1 F UniSTS Cytogenetic Map 7 D3 UniSTS Cytogenetic Map 11 E2 UniSTS Cytogenetic Map 3 F2 UniSTS Cytogenetic Map 14 C3 UniSTS Cytogenetic Map 9 A3 UniSTS Cytogenetic Map 2 H2 UniSTS Cytogenetic Map 11 E1 UniSTS Cytogenetic Map 2 H4 UniSTS Cytogenetic Map 8 B3.3 UniSTS Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 4 E2 UniSTS Cytogenetic Map 2 E5 UniSTS Cytogenetic Map 11 B4 UniSTS Cytogenetic Map 5 G3 UniSTS Cytogenetic Map X A5 UniSTS Cytogenetic Map 10 C1 UniSTS Cytogenetic Map 12 A1.1 UniSTS Cytogenetic Map 6 F2 UniSTS Cytogenetic Map 1 C1.3 UniSTS Cytogenetic Map 16 B1 UniSTS Cytogenetic Map 12 C1 UniSTS Cytogenetic Map 7 E2 UniSTS Cytogenetic Map 9 F2 UniSTS Cytogenetic Map 5 F UniSTS Cytogenetic Map 2 H1 UniSTS Cytogenetic Map 2 E2 UniSTS Cytogenetic Map 15 F1 UniSTS Cytogenetic Map 15 E1 UniSTS Cytogenetic Map 3 G2 UniSTS Cytogenetic Map 6 F3 UniSTS Cytogenetic Map 13 B3 UniSTS Cytogenetic Map 12 F1 UniSTS Cytogenetic Map 1 E4 UniSTS Cytogenetic Map 1 E3 UniSTS Cytogenetic Map 5 E1 UniSTS Cytogenetic Map 7 F3 UniSTS Cytogenetic Map 16 B3 UniSTS Cytogenetic Map 14 D2 UniSTS Cytogenetic Map 19 C2 UniSTS Cytogenetic Map 19 D3 UniSTS Cytogenetic Map 1 H5 UniSTS Cytogenetic Map 1 D UniSTS Cytogenetic Map 14 B UniSTS Cytogenetic Map 11 C UniSTS Cytogenetic Map 10 B4 UniSTS Cytogenetic Map 6 G3 UniSTS Cytogenetic Map 7 A1 UniSTS Cytogenetic Map 7 A3 UniSTS Cytogenetic Map 8 E1 UniSTS Cytogenetic Map 8 A2 UniSTS Cytogenetic Map 4 D3 UniSTS Cytogenetic Map 2 B UniSTS Cytogenetic Map 5 A3 UniSTS Cytogenetic Map 9 D UniSTS Cytogenetic Map 5 C1 UniSTS Cytogenetic Map 19 C3 UniSTS Cytogenetic Map 13 A2-A3 UniSTS Cytogenetic Map 4 C6 UniSTS Cytogenetic Map 17 D UniSTS Cytogenetic Map 17 B1 UniSTS Cytogenetic Map 17 A3.3 UniSTS Cytogenetic Map 13 A1 UniSTS Cytogenetic Map 3 F2.1 UniSTS Cytogenetic Map 15 D3 UniSTS Cytogenetic Map 8 D2 UniSTS Cytogenetic Map 12 A3 UniSTS Cytogenetic Map 1 H2.1 UniSTS Cytogenetic Map 7 F5 UniSTS Cytogenetic Map 7 C UniSTS Cytogenetic Map 2 E1 UniSTS Cytogenetic Map 11 B2 UniSTS Cytogenetic Map 16 A3 UniSTS Cytogenetic Map 5 C3.3 UniSTS Cytogenetic Map 16 A1 UniSTS Cytogenetic Map 5 G1 UniSTS Cytogenetic Map 6 A2 UniSTS Cytogenetic Map 7 B1 UniSTS Cytogenetic Map 3 F2.2 UniSTS Cytogenetic Map 5 C3.1 UniSTS Cytogenetic Map 2 C3 UniSTS Cytogenetic Map 17 A3.2-A3.3 UniSTS Cytogenetic Map 6 E3 UniSTS Cytogenetic Map 11 B1.1 UniSTS Cytogenetic Map 1 H6 UniSTS Cytogenetic Map 2 C2 UniSTS Cytogenetic Map 19 C UniSTS Cytogenetic Map 17 E1.3 UniSTS Cytogenetic Map 5 A1 UniSTS Cytogenetic Map 11 B5 UniSTS Cytogenetic Map 9 A5.2 UniSTS Cytogenetic Map 1 A1 UniSTS Cytogenetic Map 13 A5 UniSTS Cytogenetic Map X A1.1 UniSTS Cytogenetic Map 4 D2.3 UniSTS Cytogenetic Map 4 B3 UniSTS Cytogenetic Map 3 A3 UniSTS Cytogenetic Map 2 A3 UniSTS Cytogenetic Map 8 C UniSTS Cytogenetic Map 12 E UniSTS Cytogenetic Map 10 C2 UniSTS Cytogenetic Map 5 G2 UniSTS Cytogenetic Map 5 B1 UniSTS Cytogenetic Map 3 F1 UniSTS Cytogenetic Map 2 H3 UniSTS Cytogenetic Map 2 A1 UniSTS Cytogenetic Map 1 H1 UniSTS Cytogenetic Map 15 F3 UniSTS Cytogenetic Map 9 E1 UniSTS Cytogenetic Map 9 C UniSTS Cytogenetic Map 1 A2 UniSTS Cytogenetic Map 12 C3 UniSTS Cytogenetic Map 19 A UniSTS Cytogenetic Map 5 B2 UniSTS Cytogenetic Map 3 D UniSTS Cytogenetic Map 11 B1.3 UniSTS Cytogenetic Map 6 B1 UniSTS Cytogenetic Map X C-D UniSTS Cytogenetic Map 5 G1.3 UniSTS Cytogenetic Map 7 D1-E2 UniSTS Cytogenetic Map 11 A1 UniSTS Cytogenetic Map 13 B1 UniSTS Cytogenetic Map 1 H2.2 UniSTS Cytogenetic Map 8 C3 UniSTS Cytogenetic Map 11 D UniSTS Cytogenetic Map X A7.3 UniSTS Cytogenetic Map 16 C1.1 UniSTS Cytogenetic Map 15 F2 UniSTS Cytogenetic Map 9 A2 UniSTS Cytogenetic Map 1 H4-H6 UniSTS Cytogenetic Map 12 D2 UniSTS Cytogenetic Map 1 G3 UniSTS Cytogenetic Map 5 E5 UniSTS Cytogenetic Map 1 H3 UniSTS Cytogenetic Map 19 B UniSTS cM Map 9 50.0 UniSTS Whitehead Genetic 9 43.7 UniSTS
RH125170
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 97,689,870 - 97,689,989 UniSTS GRCm38 MGSCv37 3 97,493,793 - 97,493,912 UniSTS GRCm37 Celera 3 99,089,712 - 99,089,831 UniSTS Cytogenetic Map 3 F2.2 UniSTS
Pde4dip
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 3 F2.2 UniSTS
D3Bwg1078e
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 97,689,899 - 97,690,057 UniSTS GRCm38 MGSCv37 3 97,493,822 - 97,493,980 UniSTS GRCm37 Celera 3 99,089,741 - 99,089,899 UniSTS Cytogenetic Map 3 F2.2 UniSTS cM Map 3 51.5 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000045243 ⟹ ENSMUSP00000040905
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 97,646,170 - 97,675,325 (-) Ensembl GRCm38.p6 Ensembl 3 97,738,854 - 97,768,009 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000090750 ⟹ ENSMUSP00000088254
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 97,597,181 - 97,796,023 (-) Ensembl GRCm38.p6 Ensembl 3 97,689,865 - 97,888,707 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000107038 ⟹ ENSMUSP00000102653
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 97,654,009 - 97,775,564 (-) Ensembl GRCm38.p6 Ensembl 3 97,746,693 - 97,868,248 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000163531
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 97,728,298 - 97,775,513 (-) Ensembl GRCm38.p6 Ensembl 3 97,820,982 - 97,868,197 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000168438 ⟹ ENSMUSP00000131170
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 97,597,140 - 97,796,023 (-) Ensembl GRCm38.p6 Ensembl 3 97,689,824 - 97,888,707 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000175751 ⟹ ENSMUSP00000134832
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 97,648,133 - 97,675,247 (-) Ensembl GRCm38.p6 Ensembl 3 97,740,817 - 97,767,931 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000197791
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 97,602,297 - 97,604,583 (-) Ensembl GRCm38.p6 Ensembl 3 97,694,981 - 97,697,267 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000200063
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 97,597,146 - 97,602,339 (-) Ensembl GRCm38.p6 Ensembl 3 97,689,830 - 97,695,023 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000200232 ⟹ ENSMUSP00000142941
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 97,704,048 - 97,731,937 (-) Ensembl GRCm38.p6 Ensembl 3 97,796,732 - 97,824,621 (-) Ensembl
RefSeq Acc Id:
NM_001039376 ⟹ NP_001034465
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 97,597,144 - 97,796,023 (-) NCBI GRCm38 3 97,689,828 - 97,888,707 (-) NCBI MGSCv37 3 97,493,751 - 97,692,630 (-) RGD Celera 3 99,089,670 - 99,287,699 (-) RGD cM Map 3 ENTREZGENE
Sequence:
GATCATAGCAAGGGCACAGTGCCCAGGCCTCGGAACCATGAAGCGCACGGACAGCGGGTCCATCTGCCACCACGCGCCGCCGCCGTGCTGGGCTCACCACGCACCTCGCCAGTCTCCACGGCAGCCCT
hide sequence
RefSeq Acc Id:
NM_001289701 ⟹ NP_001276630
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 97,597,144 - 97,796,023 (-) NCBI GRCm38 3 97,689,828 - 97,888,707 (-) NCBI Celera 3 99,089,670 - 99,287,699 (-) NCBI
Sequence:
GATCATAGCAAGGGCACAGTGCCCAGGCCTCGGAACCATGAAGCGCACGGACAGCGGGTCCATCTGCCACCACGCGCCGCCGCCGTGCTGGGCTCACCACGCACCTCGCCAGTCTCCACGGCAGCCCT
hide sequence
RefSeq Acc Id:
NM_001289702 ⟹ NP_001276631
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 97,597,144 - 97,796,023 (-) NCBI GRCm38 3 97,689,828 - 97,888,707 (-) NCBI Celera 3 99,089,670 - 99,287,699 (-) NCBI
Sequence:
GATCATAGCAAGGGCACAGTGCCCAGGCCTCGGAACCATGAAGCGCACGGACAGCGGGTCCATCTGCCACCACGCGCCGCCGCCGTGCTGGGCTCACCACGCACCTCGCCAGTCTCCACGGCAGCCCT
hide sequence
RefSeq Acc Id:
NM_178080 ⟹ NP_835181
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 97,646,160 - 97,675,330 (-) NCBI GRCm38 3 97,738,844 - 97,768,014 (-) NCBI MGSCv37 3 97,493,751 - 97,692,630 (-) RGD Celera 3 99,089,670 - 99,287,699 (-) RGD cM Map 3 ENTREZGENE
Sequence:
TATCCCGGCGCCATCTTGAAATCTGATGCTTCATCTCCCGGGCTTTGCGTCAGCTCTGAGCCGACTTTACTGTCCCAGAGCCTAGACTGCCCGCCCCGGAGGACGTGGAGGACGAGGCAGCCCGCGGG
hide sequence
RefSeq Acc Id:
NR_110360
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 97,646,160 - 97,675,330 (-) NCBI GRCm38 3 97,738,844 - 97,768,014 (-) NCBI Celera 3 99,089,670 - 99,287,699 (-) NCBI
Sequence:
TATCCCGGCGCCATCTTGAAATCTGATGCTTCATCTCCCGGGCTTTGCGTCAGCTCTGAGCCGA
hide sequence
RefSeq Acc Id:
NP_001034465 ⟸ NM_001039376
- Peptide Label:
isoform 1
- UniProtKB:
B2RUJ9 (UniProtKB/TrEMBL)
- Sequence:
MKRTDSGSICHHAPPPCWAHHAPRQSPRQPSSRERRPPERAGSWAVAAEEEEAASAAPWMRHYFGEDDGEMVPRTSSAAAFLSDTKDRGPPVQSQTWRSAERVPFGQAHSLRAFEKPPLVQTQALRDF
hide sequence
RefSeq Acc Id:
NP_835181 ⟸ NM_178080
- Peptide Label:
isoform 2
- UniProtKB:
Q80YT7 (UniProtKB/Swiss-Prot)
- Sequence:
MKEICRICARELCGNQRRWIFHTASKLNLQVLLSHVLGKDVSRDGKAEFACSKCAFMLDRIYRF
hide sequence
RefSeq Acc Id:
NP_001276631 ⟸ NM_001289702
- Peptide Label:
isoform 6
- UniProtKB:
E9Q1A0 (UniProtKB/TrEMBL), B7ZNY0 (UniProtKB/TrEMBL)
- Sequence:
MKRTDSGSICHHAPPPCWAHHAPRQSPRQPSSRERRPPERAGSWAVAAEEEEAASAAPWMRHYF
hide sequence
RefSeq Acc Id:
NP_001276630 ⟸ NM_001289701
- Peptide Label:
isoform 5
- UniProtKB:
G3X9L9 (UniProtKB/TrEMBL), B2RUJ9 (UniProtKB/TrEMBL)
- Sequence:
MKRTDSGSICHHAPPPCWAHHAPRQSPRQPSSRERRPPERAGSWAVAAEEEEAASAAPWMRHYF
hide sequence
Ensembl Acc Id:
ENSMUSP00000088254 ⟸ ENSMUST00000090750
Ensembl Acc Id:
ENSMUSP00000040905 ⟸ ENSMUST00000045243
Ensembl Acc Id:
ENSMUSP00000102653 ⟸ ENSMUST00000107038
Ensembl Acc Id:
ENSMUSP00000131170 ⟸ ENSMUST00000168438
Ensembl Acc Id:
ENSMUSP00000134832 ⟸ ENSMUST00000175751
Ensembl Acc Id:
ENSMUSP00000142941 ⟸ ENSMUST00000200232
RGD ID: 6834205 Promoter ID: MM_KWN:35453 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: NM_178080 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 97,570,796 - 97,572,407 (-) MPROMDB
RGD ID: 6834207 Promoter ID: MM_KWN:35454 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour Transcripts: NM_001110163 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 97,628,006 - 97,628,506 (-) MPROMDB
RGD ID: 6834201 Promoter ID: MM_KWN:35455 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Kidney, Liver, MEF_B4 Transcripts: ENSMUST00000107038, NM_177145, UC008QPH.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 97,671,854 - 97,672,354 (-) MPROMDB
RGD ID: 6834203 Promoter ID: MM_KWN:35456 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: ENSMUST00000090750, NM_001039376, UC008QPE.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 97,692,336 - 97,692,836 (-) MPROMDB
RGD ID: 6881746 Promoter ID: EPDNEW_M4324 Type: initiation region Name: Pde4dip_2 Description: Mus musculus phosphodiesterase 4D interacting protein , transcriptvariant 6, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M4325 EPDNEW_M4326 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 97,767,938 - 97,767,998 EPDNEW
RGD ID: 6881748 Promoter ID: EPDNEW_M4325 Type: initiation region Name: Pde4dip_1 Description: Mus musculus phosphodiesterase 4D interacting protein , transcriptvariant 6, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M4324 EPDNEW_M4326 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 97,868,248 - 97,868,308 EPDNEW
RGD ID: 6881750 Promoter ID: EPDNEW_M4326 Type: initiation region Name: Pde4dip_3 Description: Mus musculus phosphodiesterase 4D interacting protein , transcriptvariant 6, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M4324 EPDNEW_M4325 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 97,888,781 - 97,888,841 EPDNEW
