Advanced Search (OLGA)

Gene: Lrrc3c (leucine rich repeat containing 3C) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Lrrc3c

Name:

leucine rich repeat containing 3C

RGD ID:

1620646

MGI Page

MGI

Description:

Predicted to be active in extracellular matrix and extracellular space. Orthologous to human LRRC3C (leucine rich repeat containing 3C).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Gm12; leucine rich repeat containing 3-like; leucine-rich repeat-containing protein 3C

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	98,489,117 - 98,490,412 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	98,489,117 - 98,490,412 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	98,598,291 - 98,599,586 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	98,598,291 - 98,599,586 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	98,460,262 - 98,460,810 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	98,414,909 - 98,415,676 (+)	NCBI		MGSCv36	mm8
Celera	11	108,253,349 - 108,253,897 (+)	NCBI		Celera
Cytogenetic Map	11	D	NCBI
cM Map	11	62.12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lrrc3c	Mouse	hypertrophic cardiomyopathy 25		ISO	LRRC3C (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hypertrophic cardiomyopathy 25	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lrrc3c	Mouse	2-palmitoylglycerol	increases expression	ISO	LRRC3C (Homo sapiens)	6480464	2-palmitoylglycerol results in increased expression of LRRC3C mRNA	CTD	PMID:37199045
Lrrc3c	Mouse	bisphenol A	decreases expression	ISO	Lrrc3c (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of LRRC3C mRNA	CTD	PMID:25181051
Lrrc3c	Mouse	propanal	decreases expression	ISO	LRRC3C (Homo sapiens)	6480464	propionaldehyde results in decreased expression of LRRC3C mRNA	CTD	PMID:26079696
Lrrc3c	Mouse	trichloroethene	increases expression	ISO	Lrrc3c (Rattus norvegicus)	6480464	Trichloroethylene results in increased expression of LRRC3C mRNA	CTD	PMID:33387578

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lrrc3c	Mouse	extracellular matrix	is_active_in	IBA	PANTHER:PTN001224703 more ...	2290270		GO_Central	GO_REF:0000033
Lrrc3c	Mouse	extracellular space	is_active_in	IBA	PANTHER:PTN001224703 more ...	2290270		GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12466851	PMID:21267068	PMID:21873635	PMID:24316575

Lrrc3c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	98,489,117 - 98,490,412 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	98,489,117 - 98,490,412 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	98,598,291 - 98,599,586 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	98,598,291 - 98,599,586 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	98,460,262 - 98,460,810 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	98,414,909 - 98,415,676 (+)	NCBI		MGSCv36	mm8
Celera	11	108,253,349 - 108,253,897 (+)	NCBI		Celera
Cytogenetic Map	11	D	NCBI
cM Map	11	62.12	NCBI

LRRC3C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	39,927,732 - 39,944,999 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	39,927,732 - 39,944,999 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	38,083,985 - 38,101,252 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Celera	17	34,757,993 - 34,761,247 (+)	NCBI		Celera
Cytogenetic Map	17	q21.1	NCBI
HuRef	17	33,891,729 - 33,894,989 (+)	NCBI		HuRef
CHM1_1	17	38,333,429 - 38,336,689 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	40,791,446 - 40,808,715 (+)	NCBI		T2T-CHM13v2.0

Lrrc3c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	84,104,722 - 84,107,913 (+)	NCBI		GRCr8
mRatBN7.2	10	83,608,797 - 83,610,128 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	83,608,483 - 83,611,646 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	88,552,256 - 88,553,589 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	88,050,333 - 88,051,666 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	83,443,026 - 83,444,359 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	86,554,761 - 86,565,800 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	86,564,928 - 86,565,695 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	86,360,624 - 86,362,092 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	87,422,134 - 87,422,901 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	82,346,858 - 82,358,420 (+)	NCBI		Celera
Cytogenetic Map	10	q31	NCBI

Lrrc3c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955451	14,644,305 - 14,649,084 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955451	14,644,464 - 14,647,078 (+)	NCBI	ChiLan1.0	ChiLan1.0

LRRC3C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	25,008,224 - 25,027,378 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	26,903,050 - 26,922,994 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	17,344,449 - 17,347,977 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	17,563,906 - 17,567,160 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	17,563,906 - 17,567,160 (-)	Ensembl	panpan1.1		panPan2

LRRC3C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	22,581,358 - 22,596,646 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	22,581,615 - 22,582,436 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1 Ensembl	9	22,581,615 - 22,582,436 (-)	NCBI	CanFam3.1		canFam3	CanFam3.1
ROS_Cfam_1.0	9	23,374,231 - 23,375,222 (-)	NCBI		ROS_Cfam_1.0
UU_Cfam_GSD_1.0	9	22,531,121 - 22,532,111 (-)	NCBI		UU_Cfam_GSD_1.0

Lrrc3c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	21,985,342 - 21,986,943 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936490	15,088,079 - 15,089,797 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936490	15,088,555 - 15,090,587 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LRRC3C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	22,398,853 - 22,399,617 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	22,398,463 - 22,409,382 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	22,856,686 - 22,867,632 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LRRC3C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	66,222,782 - 66,241,944 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666077	37,135,419 - 37,137,004 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lrrc3c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624795	3,198,477 - 3,199,584 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624795	3,196,900 - 3,200,396 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Lrrc3c
46 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	230
Count of miRNA genes:	216
Interacting mature miRNAs:	227
Transcripts:	ENSMUST00000142268
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
27226783	Tibl5_m	tibia length 5, 5 week (mouse)					11	68190826	101890826	Mouse
1302034	Pkccl_m	protein kinase C content in lungs (mouse)			Not determined		11	91604608	121973369	Mouse
1300628	Lgth6_m	body length 6 (mouse)			Not determined		11	66733420	100733652	Mouse
4141367	Inf1_m	acute ozone induced inflammation (mouse)			Not determined			44630038	113058009	Mouse
1558812	Rafar_m	retinoic acid induced forelimb autopod reduction (mouse)			Not determined		11	70691198	104691366	Mouse
1301535	Pas5b_m	pulmonary adenoma susceptibility 5b (mouse)			Not determined		11	96176465	108806384	Mouse
1300766	Skull16_m	skull morphology 16 (mouse)			Not determined		11	81574481	115574636	Mouse
1301404	Sbmd4_m	spinal bone mineral density 4 (mouse)			Not determined		11	72019649	106019734	Mouse
12910539	Sstapa3_m	suseptibility to Staphylococcus aureus infection 3 (mouse)					11	96897693	110603991	Mouse
4142121	Tmc1m2_m	Tmc1 modifier 2 (mouse)			Not determined		11	56864027	114157957	Mouse
27226758	Femd3_m	femur midshaft diameter 3, 5 week (mouse)					11	80890826	101890826	Mouse
14747003	Mancz9_m	mandible centroid size 9 (mouse)					11	85844911	119844911	Mouse
1301640	Lore4_m	loss of righting induced by ethanol 4 (mouse)			Not determined		11	79156009	107616472	Mouse
10412288	Carg4_m	Candida albicans resistance gene 4 (mouse)			Not determined		11	81810267	115810267	Mouse
11251723	Ewc5_m	ethanol withdrawal and consumption 5 (mouse)					11	89869251	121973369	Mouse
1301681	Sle13_m	systematic lupus erythematosus susceptibility 13 (mouse)			Not determined		11	70691198	104691366	Mouse
1300784	Prdt3_m	prion disease incubation time 3 (mouse)			Not determined		11	66733420	100733652	Mouse
4141339	Nilac2_m	nicotine induced locomotor activity 2 (mouse)			Not determined		11	70691198	104691366	Mouse
10413882	Moe1_m	modifier of epilepsy 1 (mouse)					11	77770978	111771099	Mouse
11039501	Ltpr6a_m	Leishmania tropica response 6a (mouse)					11	64830336	98830473	Mouse
11039502	Ltpr6b_m	Leishmania tropica response 6b (mouse)					11	64830336	98830473	Mouse
4141465	Dbm2_m	diabetes modifier 2 (mouse)			Not determined			94437183	118022724	Mouse
10045617	Heal26_m	wound healing/regeneration 26 (mouse)			Not determined		11	92939373	112544554	Mouse
10045616	Heal25_m	wound healing/regeneration 25 (mouse)			Not determined		11	77437183	111437322	Mouse
1357631	Motr1_m	modifier of tubby retinal degeneration 1 (mouse)			Not determined		11	87691198	103274115	Mouse
1301310	Tmevd5_m	Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 5 (mouse)			Not determined		11	72726125	106726289	Mouse
1301153	Estq3_m	estradiol regulated response QTL 3 (mouse)			Not determined		11	96897693	99327028	Mouse
11039515	Ltpr6_m	Leishmania tropica response 6 (mouse)					11	64830336	98830473	Mouse
4142348	Pstc2_m	periosteal circumference 2 (mouse)			Not determined		11	72818615	106818733	Mouse
1301414	Heal10_m	wound healing/regeneration 10 (mouse)			Not determined		11	77437183	111437322	Mouse
1300651	Pcyts3_m	plasmacytoma susceptibility 3 (mouse)			Not determined		11	70691198	104691366	Mouse
1301546	Pcir2_m	periosteal circumference 2 (mouse)			Not determined		11	66733420	100733652	Mouse
1300649	Crhq1_m	compensatory renal hypertrophy QTL 1 (mouse)			Not determined		11	81574481	115574636	Mouse
27226789	Feml16_m	femur length 16, 10 week (mouse)					11	87490826	121873369	Mouse
14746970	Manh71_m	mandible shape 71 (mouse)					11	79416257	113416257	Mouse
10043865	T2dm5sa_m	type 2 diabetes mellitus 5 in SMXA RI mice (mouse)			Not determined		11	79813759	104502698	Mouse
39128214	Lwq20_m	liver weight QTL 20 (mouse)					11	12268637	118022724	Mouse
10043866	Adip19_m	adiposity 19 (mouse)			Not determined		11	72818615	106818733	Mouse
1301072	Eae22_m	experimental allergic encephalomyelitis 22 (mouse)			Not determined		11	82377698	116377820	Mouse
1300944	Alcp20_m	alcohol preference locus 20 (mouse)			Not determined		11	95403965	121973369	Mouse
4141939	Pregq2_m	pregnancy QTL 2 (mouse)			Not determined		11	94063779	118022724	Mouse
1301983	Berr2_m	berghei resistance locus 2 (mouse)			Not determined		11	98352609	121973369	Mouse
11038695	Par8_m	pulmonary adenoma resistance 8 (mouse)					11	77063779	111063918	Mouse
1357766	Si5lq6_m	serum IGFBP-5 level QTL 6 (mouse)			Not determined		11	66733420	100733652	Mouse
1301057	Nidd4_m	non-insulin-dependent diabetes mellitus 4 (mouse)			Not determined		11	96810136	121973369	Mouse
1301958	Alcp18_m	alcohol preference locus 18 (mouse)			Not determined		11	95403965	121973369	Mouse
1301833	Tbbmd5_m	total body bone mineral density 5 (mouse)			Not determined		11	66733420	100733652	Mouse
1301491	Abbp4_m	A/J and C57BL/6 blood pressure 4 (mouse)			Not determined		11	88699588	99081597	Mouse
15014785	Mvlq1_m	macrovesicular liver lesion QTL 1 (mouse)					11	86608320	120608320	Mouse
4141012	Femwf6_m	femur work to failure 6 (mouse)			Not determined			66733420	100733652	Mouse
15039374	Adip29_m	adiposity 29 (mouse)					11	86608320	120608320	Mouse
1300962	Cd8mts4_m	CD8 memory T cell subset 4 (mouse)			Not determined		11	96137674	121973369	Mouse
1301095	El6_m	epilepsy 6 (mouse)			Not determined		11	93229183	121973369	Mouse
27226731	Tibmd4_m	tibia midshaft diameter 4, 10 week (mouse)					11	94190826	118890826	Mouse
27226730	Tibmd1_m	tibia midshaft diameter 1, 5 week (mouse)					11	62590826	109390826	Mouse
15039376	Bw42_m	body weight QTL 42 (mouse)					11	86608320	120608320	Mouse
1558753	Ath19_m	atherosclerosis 19 (mouse)			Not determined		11	91604608	121973369	Mouse
10044007	Hbnr14_m	Heligmosomoides bakeri nematode resistance 14 (mouse)			Not determined		11	87502600	121502698	Mouse
1302124	Eae7_m	susceptibility to experimental allergic encephalomyelitis 7 (mouse)			Not determined		11	77573873	99377820	Mouse

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_001195544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AL591125	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BY232969	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000142268 ⟹ ENSMUSP00000147537

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	98,489,117 - 98,490,412 (+)	Ensembl
GRCm38.p6 Ensembl	11	98,598,291 - 98,599,586 (+)	Ensembl

RefSeq Acc Id:

NM_001195544 ⟹ NP_001182473

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	11	98,489,117 - 98,490,412 (+)	NCBI
GRCm38	11	98,598,291 - 98,599,586 (+)	ENTREZGENE
Celera	11	108,252,692 - 108,253,987 (+)	ENTREZGENE
cM Map	11		ENTREZGENE

Sequence:

show sequence

TAATATGTCACTCTTGTGACACGAGTGCCAGCCAGGCCGCCTCCCTGGTGTTTACCTGGCCTCCCTTGGCAGTCATACAGGTTCGTCTATTCCCCAGCTTCTCCTCCACTCCAGGATTATGTTTATCT
GCGACCATGCCCCTACTAGCTCCTCGCCTCCTGCCCCTCCTGCTGGTGATTGGCACCGGGGGCTCTGTGCCCCGCCCCCTGGCACTGCCCCAGGGCTGCTACGTAGCAGAAGAAGCCGGGGAACAGAC
ATTCCGCTGCAGCCGGGCTGGTCTGAGTGCCGTGCCCAACGGTATCCCCAACGACACCCGAAAGCTTTACCTGGACGCCAACCAGTTGGCATCAGTGCCAGCTGGTGCCTTCCAGCACCTGCCTGCCC
TGGAAGAACTAGACCTGTCTCATAACGCTCTTGTTCATCTCTCAGGGGCTGCTTTCCAGGGCCTGGAGGGCACTCTGCGCCACCTCGACCTCTCTGCCAACCAGCTAGCATCTGTGCCTGTGGCAGCC
TTCGTGGGGCTGCAGATCCAAGTGAACCTGTCTGCCAACCCATGGCGCTGCGACTGTGCCCTACAGGAAGTGCTCAGGCACGTCAGGTTGGCTCCAGGCTCCGGGACAGGCATTGTGTGTGGTCCAGA
AGCCCGACCAGATCTCGTGGGACACGAGTTCCTTCTGCTCACCAGGGAGGAAGAGCTGTGTGGGACAGGACGAGGTGGGACCCGAAGGAGCACGGATGTGGCCCTGTTAGTCACCATGGGGGGCTGGC
TGACACTGGTAGTGGCTTATCTGATCCGCTATGTGTGGCAGAACCGAGATGAGACGCGGCGCCCGGTCAAGCGGGCTCCTCCCGCGCAGCCTGTGCGCTCAGAGGACTCCTCTACACTCAGCACAGTG
CTCTGA

hide sequence


Protein RefSeqs	NP_001182473	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000147537
	ENSMUSP00000147537.2

RefSeq Acc Id:	NP_001182473 ⟸ NM_001195544
- Peptide Label:	precursor
- UniProtKB:	A0A1B0GRI5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPLLAPRLLPLLLVIGTGGSVPRPLALPQGCYVAEEAGEQTFRCSRAGLSAVPNGIPNDTRKLYLDANQLASVPAGAFQHLPALEELDLSHNALVHLSGAAFQGLEGTLRHLDLSANQLASVPVAAFV GLQIQVNLSANPWRCDCALQEVLRHVRLAPGSGTGIVCGPEARPDLVGHEFLLLTREEELCGTGRGGTRRSTDVALLVTMGGWLTLVVAYLIRYVWQNRDETRRPVKRAPPAQPVRSEDSSTLSTVL hide sequence

Ensembl Acc Id:

ENSMUSP00000147537 ⟸ ENSMUST00000142268

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A1B0GRI5-F1-model_v2	AlphaFold	A0A1B0GRI5	1-255	view protein structure

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000086545	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000142268	ENTREZGENE
	ENSMUST00000142268.3	UniProtKB/TrEMBL
Gene3D-CATH	3.80.10.10	UniProtKB/TrEMBL
InterPro	L_dom-like	UniProtKB/TrEMBL
	Leu-rich_rpt	UniProtKB/TrEMBL
	Leu-rich_rpt_typical-subtyp	UniProtKB/TrEMBL
	LRR_TM_domain-containing	UniProtKB/TrEMBL
KEGG Report	mmu:192852	UniProtKB/TrEMBL
MGD	MGI:2684858	ENTREZGENE
NCBI Gene	192852	ENTREZGENE
PANTHER	ANTIGEN BSP, PUTATIVE-RELATED	UniProtKB/TrEMBL
	LEUCINE-RICH REPEAT-CONTAINING PROTEIN 3B-LIKE	UniProtKB/TrEMBL
Pfam	LRR_8	UniProtKB/TrEMBL
PhenoGen	Lrrc3c	PhenoGen
PROSITE	LRR	UniProtKB/TrEMBL
SMART	LRR_TYP	UniProtKB/TrEMBL
Superfamily-SCOP	L domain-like	UniProtKB/TrEMBL
UniProt	A0A1B0GRI5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-10-13	Lrrc3c	leucine rich repeat containing 3C	Gm12	predicted gene 12	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar