Advanced Search (OLGA)

Gene: Stx19 (syntaxin 19) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Stx19

Name:

syntaxin 19

RGD ID:

1620024

MGI Page

MGI

Description:

Predicted to enable SNAP receptor activity and SNARE binding activity. Predicted to be involved in intracellular protein transport; synaptic vesicle fusion to presynaptic active zone membrane; and vesicle docking. Predicted to be located in cytoplasm. Predicted to be part of SNARE complex. Predicted to be active in endomembrane system and presynaptic active zone membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; respiratory system; and thymus. Orthologous to human STX19 (syntaxin 19).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

A030009B12Rik; syntaxin 9; syntaxin-19

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	STX19 (syntaxin 19)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Stx19 (syntaxin 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Stx19 (syntaxin 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	STX19 (syntaxin 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	STX19 (syntaxin 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Stx19 (syntaxin 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	STX19 (syntaxin 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	STX19 (syntaxin 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Stx19 (syntaxin 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	STX19 (syntaxin 19)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	stx19 (syntaxin 19)	Alliance	DIOPT (ZFIN)
Saccharomyces cerevisiae (baker's yeast):	SSO1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	SSO2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|PANTHER)
Caenorhabditis elegans (roundworm):	syx-2	Alliance	DIOPT (Ensembl Compara\|OMA)
Xenopus tropicalis (tropical clawed frog):	stx19	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	62,635,039 - 62,643,085 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	62,635,039 - 62,644,709 (+)	Ensembl		GRCm39 Ensembl
GRCm38	16	62,814,676 - 62,822,722 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	62,814,676 - 62,824,346 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	62,814,502 - 62,822,548 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	62,756,932 - 62,764,978 (+)	NCBI		MGSCv36	mm8
Celera	16	63,123,377 - 63,131,418 (+)	NCBI		Celera
Cytogenetic Map	16	C1.3	NCBI
cM Map	16	36.43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Stx19	Mouse	autosomal recessive thrombophilia due to protein S deficiency		ISO	RGD:1605776	8554872	ClinVar Annotator: match by term: Thrombophilia due to protein S deficiency, autosomal recessive	ClinVar	PMID:16363235\|PMID:22627709\|PMID:28492532\|PMID:9241758
Stx19	Mouse	Joubert syndrome 8		ISO	RGD:1605776	8554872	ClinVar Annotator: match by term: Joubert syndrome 8	ClinVar	PMID:28492532
Stx19	Mouse	protein S deficiency		ISO	RGD:1605776	8554872	ClinVar Annotator: match by term: Protein S deficiency disease	ClinVar	PMID:32581362

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Stx19	Mouse	1,2-dichloroethane	decreases expression	EXP		6480464	ethylene dichloride results in decreased expression of STX19 mRNA	CTD	PMID:28960355
Stx19	Mouse	17beta-estradiol	multiple interactions	ISO	RGD:1597703	6480464	[Testosterone co-treated with Estradiol] results in increased expression of STX19 mRNA	CTD	PMID:32741896
Stx19	Mouse	2,4-D	multiple interactions	EXP		6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ...	CTD	PMID:37567420
Stx19	Mouse	2-hydroxypropanoic acid	decreases expression	ISO	RGD:1605776	6480464	Lactic Acid results in decreased expression of STX19 mRNA	CTD	PMID:30851411
Stx19	Mouse	6-propyl-2-thiouracil	decreases expression	ISO	RGD:1597703	6480464	Propylthiouracil results in decreased expression of STX19 mRNA	CTD	PMID:24780913
Stx19	Mouse	aldehydo-D-glucose	multiple interactions	EXP		6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ...	CTD	PMID:37567420
Stx19	Mouse	arsane	multiple interactions	ISO	RGD:1605776	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of STX19 more ...	CTD	PMID:32525701
Stx19	Mouse	arsenic atom	multiple interactions	ISO	RGD:1605776	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of STX19 more ...	CTD	PMID:32525701
Stx19	Mouse	avobenzone	decreases expression	ISO	RGD:1605776	6480464	avobenzone results in decreased expression of STX19 mRNA	CTD	PMID:31016361
Stx19	Mouse	benzo[a]pyrene	decreases methylation	ISO	RGD:1605776	6480464	Benzo(a)pyrene results in decreased methylation of STX19 exon	CTD	PMID:27901495
Stx19	Mouse	benzo[a]pyrene	affects methylation	ISO	RGD:1605776	6480464	Benzo(a)pyrene affects the methylation of STX19 intron	CTD	PMID:30157460
Stx19	Mouse	benzo[e]pyrene	increases methylation	ISO	RGD:1605776	6480464	benzo(e)pyrene results in increased methylation of STX19 intron	CTD	PMID:30157460
Stx19	Mouse	bisphenol A	decreases expression	ISO	RGD:1597703	6480464	bisphenol A results in decreased expression of STX19 mRNA	CTD	PMID:25181051
Stx19	Mouse	bisphenol A	increases expression	ISO	RGD:1597703	6480464	bisphenol A results in increased expression of STX19 mRNA	CTD	PMID:33296240
Stx19	Mouse	Cuprizon	decreases expression	ISO	RGD:1597703	6480464	Cuprizone results in decreased expression of STX19 mRNA	CTD	PMID:26577399
Stx19	Mouse	D-glucose	multiple interactions	EXP		6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ...	CTD	PMID:37567420
Stx19	Mouse	fructose	multiple interactions	EXP		6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ...	CTD	PMID:37567420
Stx19	Mouse	glucose	multiple interactions	EXP		6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ...	CTD	PMID:37567420
Stx19	Mouse	lipopolysaccharide	multiple interactions	ISO	RGD:1605776	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of STX19 mRNA	CTD	PMID:35811015
Stx19	Mouse	methapyrilene	increases methylation	ISO	RGD:1605776	6480464	Methapyrilene results in increased methylation of STX19 intron	CTD	PMID:30157460
Stx19	Mouse	nickel atom	decreases expression	ISO	RGD:1605776	6480464	Nickel results in decreased expression of STX19 mRNA	CTD	PMID:24768652
Stx19	Mouse	okadaic acid	decreases expression	EXP		6480464	Okadaic Acid results in decreased expression of STX19 mRNA	CTD	PMID:25270620
Stx19	Mouse	rac-lactic acid	decreases expression	ISO	RGD:1605776	6480464	Lactic Acid results in decreased expression of STX19 mRNA	CTD	PMID:30851411
Stx19	Mouse	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1605776	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of STX19 mRNA	CTD	PMID:35811015
Stx19	Mouse	sodium arsenate	multiple interactions	ISO	RGD:1605776	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of STX19 more ...	CTD	PMID:32525701
Stx19	Mouse	sodium arsenite	decreases expression	ISO	RGD:1605776	6480464	sodium arsenite results in decreased expression of STX19 mRNA	CTD	PMID:28595984\|PMID:34032870
Stx19	Mouse	testosterone	multiple interactions	ISO	RGD:1597703	6480464	[Testosterone co-treated with Estradiol] results in increased expression of STX19 mRNA	CTD	PMID:32741896

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Stx19	Mouse	exocytosis	involved_in	IBA	PANTHER:PTN000461524\|MGI:1921982\|WB:WBGene00006374\|UniProtKB:Q16623\|MGI:103077\|MGI:1930705\|RGD:621019\|RGD:69430\|MGI:109355\|FB:FBgn0013343	2290270		GO_Central	GO_REF:0000033
Stx19	Mouse	intracellular protein transport	involved_in	IEA	InterPro:IPR006012	2290270		InterPro	GO_REF:0000002
Stx19	Mouse	intracellular protein transport	involved_in	IBA	PANTHER:PTN000461349\|SGD:S000005562\|TAIR:locus:2078042\|TAIR:locus:2148513\|SGD:S000003180\|TAIR:locus:505006427\|TAIR:locus:2032569\|TAIR:locus:2148960\|TAIR:locus:2081476\|SGD:S000005378	2290270		GO_Central	GO_REF:0000033
Stx19	Mouse	membrane fusion	involved_in	IEA	GO:0005484	2290270		GOC	GO_REF:0000108
Stx19	Mouse	synaptic vesicle fusion to presynaptic active zone membrane	involved_in	IBA	PANTHER:PTN000461527\|MGI:1930705	2290270		GO_Central	GO_REF:0000033
Stx19	Mouse	vesicle docking	involved_in	IBA	PANTHER:PTN000461349\|MGI:109355\|RGD:621019\|MGI:1930705\|SGD:S000005632\|RGD:69430	2290270		GO_Central	GO_REF:0000033
Stx19	Mouse	vesicle-mediated transport	involved_in	IEA	InterPro:IPR010989	2290270		InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Stx19	Mouse	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	2290270		UniProt	GO_REF:0000044
Stx19	Mouse	endomembrane system	is_active_in	IBA	PANTHER:PTN000461349\|FB:FBgn0011708\|TAIR:locus:505006427\|MGI:1858210\|TAIR:locus:2078042\|FB:FBgn0031106\|WB:WBGene00006374\|UniProtKB:O60499\|TAIR:locus:2148513\|RGD:61915\|SGD:S000005562\|MGI:1926235\|TAIR:locus:2032569\|UniProtKB:C8VLM4\|UniProtKB:O14662\|MGI:893577\|UniProtKB:Q9UNK0\|TAIR:locus:2087208\|MGI:103077\|RGD:708499\|SGD:S000004016\|TAIR:locus:2075054\|UniProtKB:O43752\|RGD:620977\|dictyBase:DDB_G0287733\|UniProtKB:Q12846\|MGI:1923396\|SGD:S000005378\|TAIR:locus:2081476\|UniProtKB:Q13277\|FB:FBgn0267849\|SGD:S000000012\|MGI:109355\|PomBase:SPAC6F12.03c\|SGD:S000002876\|RGD:68426\|TAIR:locus:2197749\|UniProtKB:Q86Y82\|TAIR:locus:2078282\|RGD:1309423\|UniProtKB:Q8IE08\|TAIR:locus:2082747\|RGD:69430\|UniProtKB:O15400\|PomBase:SPCC825.03c\|TAIR:locus:2166419\|FB:FBgn0013343\|UniProtKB:Q13190\|PomBase:SPCC594.06c\|UniProtKB:P56962\|TAIR:locus:2025620\|TAIR:locus:2148960\|TAIR:locus:2181484\|PomBase:SPBC31E1.04\|RGD:61917\|MGI:1890156\|RGD:619747	2290270		GO_Central	GO_REF:0000033
Stx19	Mouse	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	2290270		UniProt	GO_REF:0000044
Stx19	Mouse	plasma membrane	is_active_in	IBA	PANTHER:PTN000461524\|PomBase:SPCC825.03c\|RGD:621005\|RGD:69430\|RGD:3784\|UniProtKB:Q9SRV7\|MGI:103077\|WB:WBGene00006798\|UniProtKB:Q16623\|MGI:893577\|TAIR:locus:2181484\|SGD:S000006153\|UniProtKB:Q12846\|MGI:109355\|UniProtKB:P32856\|UniProtKB:O96189\|UniProtKB:Q13277\|TAIR:locus:2081476\|MGI:1930705\|WB:WBGene00006374\|TAIR:locus:2197749\|UniProtKB:Q3SWZ3\|SGD:S000004795\|FB:FBgn0024980\|RGD:621019\|WB:WBGene00006371\|TAIR:locus:2079894	2290270		GO_Central	GO_REF:0000033
Stx19	Mouse	presynaptic active zone membrane	is_active_in	IBA	PANTHER:PTN000461527\|MGI:1930705	2290270		GO_Central	GO_REF:0000033
Stx19	Mouse	SNARE complex	part_of	IBA	PANTHER:PTN000461349\|MGI:103077\|MGI:893577\|UniProtKB:Q16623\|FB:FBgn0013343\|UniProtKB:O14662\|TAIR:locus:2032569\|RGD:621005\|RGD:69430\|SGD:S000005632\|SGD:S000003180\|RGD:619747\|UniProtKB:Q12846\|RGD:61917\|UniProtKB:O43752\|SGD:S000004016\|UniProtKB:P56962\|SGD:S000006153\|UniProtKB:Q86Y82\|RGD:68426\|SGD:S000002876\|FB:FBgn0035540\|MGI:109355\|FB:FBgn0036341\|SGD:S000005378\|TAIR:locus:2081476\|RGD:621019\|TAIR:locus:2148513	2290270		GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Stx19	Mouse	protein binding	enables	ISO	UniProtKB:P61764	9068941	PMID:25910212, PMID:33961781	IntAct	PMID:25910212\|PMID:33961781
Stx19	Mouse	protein binding	enables	ISO	UniProtKB:O14901\|UniProtKB:P01023\|UniProtKB:P01112\|UniProtKB:P06396\|UniProtKB:P22607\|UniProtKB:P28329-3\|UniProtKB:P50570-2\|UniProtKB:Q7Z699\|UniProtKB:Q9BVL2	9068941	PMID:32814053	IntAct	PMID:32814053
Stx19	Mouse	protein binding	enables	ISO	UniProtKB:O43741	9068941	PMID:24722188	IntAct	PMID:24722188
Stx19	Mouse	protein binding	enables	ISO	UniProtKB:P60880-2\|UniProtKB:P61764\|UniProtKB:Q9BWG6\|UniProtKB:Q9H115\|UniProtKB:Q9NYB9-2\|UniProtKB:Q9UMX1\|UniProtKB:Q9Y3S2	9068941	PMID:32296183	IntAct	PMID:32296183
Stx19	Mouse	protein binding	enables	ISO	UniProtKB:O43741\|UniProtKB:P61764\|UniProtKB:Q8N0S2	9068941	PMID:25416956	IntAct	PMID:25416956
Stx19	Mouse	protein binding	enables	ISO	UniProtKB:O43463\|UniProtKB:O60341	9068941	PMID:23455924	IntAct	PMID:23455924
Stx19	Mouse	SNAP receptor activity	enables	IBA	PANTHER:PTN000461349\|SGD:S000005562\|RGD:621019\|SGD:S000005632\|RGD:619747\|SGD:S000003180\|SGD:S000004795\|TAIR:locus:2148960\|SGD:S000004016\|SGD:S000006153\|UniProtKB:P56962\|UniProtKB:Q13190\|FB:FBgn0031106\|SGD:S000002876\|FB:FBgn0013343\|UniProtKB:O14662\|FB:FBgn0035540\|RGD:621005\|FB:FBgn0011708\|SGD:S000000012\|SGD:S000005378	2290270		GO_Central	GO_REF:0000033
Stx19	Mouse	SNAP receptor activity	enables	IEA	InterPro:IPR006012	2290270		InterPro	GO_REF:0000002
Stx19	Mouse	SNARE binding	enables	IBA	PANTHER:PTN000461349\|UniProtKB:O15400\|RGD:69430\|UniProtKB:O14662\|FB:FBgn0013343\|FB:FBgn0035540\|MGI:109355\|UniProtKB:Q9SRV7\|MGI:893577\|UniProtKB:Q9UNK0\|UniProtKB:P56962\|RGD:708499\|UniProtKB:O60499\|UniProtKB:O43752\|RGD:2558\|RGD:619747\|ZFIN:ZDB-GENE-040426-1360\|RGD:621019	2290270		GO_Central	GO_REF:0000033

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Stx19	Mouse	abnormal coat appearance		IEA		5509061		MGI
Stx19	Mouse	decreased circulating chloride level		IEA		5509061		MGI
Stx19	Mouse	decreased circulating glucose level		IEA		5509061		MGI
Stx19	Mouse	increased fasting circulating glucose level		IEA		5509061		MGI

#	Reference Title	Reference Citation
1.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10349636	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12466851	PMID:12477932	PMID:15489334	PMID:16141072	PMID:16141073	PMID:16420529	PMID:21267068	PMID:21873635
PMID:24194600	PMID:27626380	PMID:32325033	PMID:36445537	PMID:38164795	PMID:38355793

Stx19
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	62,635,039 - 62,643,085 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	62,635,039 - 62,644,709 (+)	Ensembl		GRCm39 Ensembl
GRCm38	16	62,814,676 - 62,822,722 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	62,814,676 - 62,824,346 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	62,814,502 - 62,822,548 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	62,756,932 - 62,764,978 (+)	NCBI		MGSCv36	mm8
Celera	16	63,123,377 - 63,131,418 (+)	NCBI		Celera
Cytogenetic Map	16	C1.3	NCBI
cM Map	16	36.43	NCBI

STX19
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	94,014,365 - 94,028,597 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	94,014,365 - 94,028,597 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	93,733,209 - 93,747,441 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	95,215,903 - 95,230,144 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	92,116,939 - 92,131,179 (-)	NCBI		Celera
Cytogenetic Map	3	q11.2	NCBI
HuRef	3	91,095,915 - 91,110,158 (-)	NCBI		HuRef
CHM1_1	3	93,696,301 - 93,710,542 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	96,712,494 - 96,726,726 (-)	NCBI		T2T-CHM13v2.0

Stx19
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	13,619,436 - 13,624,634 (+)	NCBI		GRCr8
mRatBN7.2	11	172,855 - 178,053 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	171,395 - 179,191 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	8,769,008 - 8,774,204 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	1,562,267 - 1,567,463 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	667,048 - 672,244 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	1,145,002 - 1,149,978 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	7	1,133,989 - 1,138,965 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	13	182,296 - 187,494 (+)	NCBI		Celera
Cytogenetic Map	11	p12	NCBI

Stx19
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955407	3,397,284 - 3,437,421 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955407	3,397,284 - 3,437,421 (+)	NCBI	ChiLan1.0	ChiLan1.0

STX19
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	91,925,852 - 91,974,898 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	91,929,934 - 91,945,006 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	91,079,351 - 91,093,741 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	97,759,197 - 97,773,498 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	97,759,213 - 97,760,097 (-)	Ensembl	panpan1.1		panPan2

STX19
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	1,726,019 - 1,736,949 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	1,726,695 - 1,727,579 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	1,903,226 - 1,916,301 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	1,822,874 - 1,835,972 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	33	1,826,083 - 1,826,967 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	33	1,731,883 - 1,744,958 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	1,767,183 - 1,780,253 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	1,992,040 - 2,005,119 (-)	NCBI		UU_Cfam_GSD_1.0

Stx19
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	155,368,450 - 155,369,359 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936666	146,314 - 154,950 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936666	145,946 - 147,292 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

STX19
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	165,867,924 - 165,874,123 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	165,858,563 - 165,872,678 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	176,541,458 - 176,557,579 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

STX19
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	86,673,139 - 86,688,288 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	86,673,654 - 86,691,972 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	79,994,530 - 80,009,021 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Stx19
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624789	6,744,858 - 6,756,127 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624789	6,740,514 - 6,757,694 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Stx19
172 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	489
Count of miRNA genes:	317
Interacting mature miRNAs:	367
Transcripts:	ENSMUST00000055557
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
11059560	Lmr12b_m	leishmaniasis resistance 12b (mouse)					16	28792813	62792952	Mouse
1300915	Lmr12_m	leishmaniasis resistance 12 (mouse)			Not determined		16	28792813	62792952	Mouse
1301138	Pcd4ts3_m	p-glycoprotein positive CD4 T cell subset 3 (mouse)			Not determined		16	40593923	74594076	Mouse
1301394	Eae11_m	susceptibility to experimental allergic encephalomyelitis 11 (mouse)			Not determined		16	53561891	87562035	Mouse
26884376	Skwq4_m	skull length QTL 4, 5 week (mouse)					16	8417864	90896888	Mouse
1302096	Aod1a_m	autoimmune ovarian dysgenesis 1a (mouse)			Not determined		16	35446643	92573008	Mouse
4141212	Imraq3_m	immune response to AAV2 QTL 3 (mouse)			Not determined		16	44383350	78383506	Mouse
1558836	Dice1b_m	determination of interleukin 4 commitment 1b (mouse)			Not determined		16	45511000	72274485	Mouse
1301719	Remslp3_m	rapid eye movement sleep 3 (mouse)			Not determined		16	44383350	78383506	Mouse
1357778	Diobq_m	diet-induced obesity QTL (mouse)			Not determined		16	42197817	82331174	Mouse
1301364	Lith14_m	lithogenic gene 14 (mouse)			Not determined		16	55661846	89661961	Mouse
26884432	Zlq7_m	zygomatic length QTL 7, 10 week (mouse)					16	3817864	64620363	Mouse
11049571	Lmr12c_m	leishmaniasis resistance 12c (mouse)					16	28792813	62792952	Mouse
11059559	Lmr12a_m	leishmaniasis resistance 12a (mouse)					16	28792813	62792952	Mouse
4142187	Arrd3_m	age-related retinal degeneration 3 (mouse)			Not determined			32522909	65466552	Mouse
11522747	Eae41_m	experimental allergic encephalomyelitis susceptibility 41 (mouse)					16	40399134	78015472	Mouse
14928310	Manh80_m	mandible shape 80 (mouse)					16	48219841	82219841	Mouse
1301125	Sluc27_m	susceptibility to lung cancer 27 (mouse)			Not determined		16	61608644	95608764	Mouse
1357763	Lp1_m	lymphocyte proliferation 1 (mouse)			Not determined		16	6542979	65466552	Mouse
1357517	Bwtn1_m	body weight at necropsy 1 (mouse)			Not determined		16	20019329	85600826	Mouse
26884416	Bzwq5_m	bi-zygomatic width QTL 5, 5 week (mouse)					16	37320362	84696888	Mouse
1301070	Cypr1_m	cytokine production 1 (mouse)			Not determined		16	32312795	66312933	Mouse
27226785	Feml12_m	femur length 12, 5 week (mouse)					16	3317864	64620363	Mouse
4142112	Skts-fp3_m	skin tumor susceptibility in FVB and PWK 3 (mouse)			Not determined		16	40053881	72924385	Mouse

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_026588	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC154309	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK009770	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK020701	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK076337	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC023414	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466521	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000055557 ⟹ ENSMUSP00000055901

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	16	62,635,039 - 62,644,709 (+)	Ensembl
GRCm38.p6 Ensembl	16	62,814,676 - 62,824,346 (+)	Ensembl

RefSeq Acc Id:

NM_026588 ⟹ NP_080864

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	16	62,635,039 - 62,643,085 (+)	NCBI
GRCm38	16	62,814,676 - 62,822,722 (+)	ENTREZGENE
MGSCv37	16	62,814,502 - 62,822,548 (+)	RGD
Celera	16	63,123,377 - 63,131,418 (+)	RGD
cM Map	16		ENTREZGENE

Sequence:

show sequence

GGAACAGGTGAGGAGCAGGCAGAACCTGATTCTCCAGGTGTGAGGTAAGCAGTCTGTGCCTCTCACTTCATAGTTACAGCAAATGGACAACTTTATCGCCGACTTATTTGACTTCACTGTTTGGCTTT
CAATTAACTGTATGAGAACCATAAAGGGAGCCTGTGGCTTAGACTGATTTAGCATTGGGCCAGGCATTACACTCCATGGCACTTGGATTTTCTCTCGGACTAAGGACTCTCACACCCCAGGTGGGAAA
ACAAGAACAAGACACCCAGGGGGTAAAGGAAGATGAAAGACCGACTTCAAGAATTAAAACAGAAAACCAAGGAAATAGAACTCTCTCGGGACGGTCAGGTGTTTGTGGAAGAGGAACAAGGGGTGCTC
GTCCAGCAAGCTGTCATTTATGAAAGAGAGCCTGTAGCTGAGAGGCACCTACATGAGATCCAAAAACTGCAGGAGAATATTAACAGTTTTGTGGATGATGTTCAACGATTTGGACAGCAACAGAAAAG
TCTAGTGGCTTCCATGAGAAGGTTTAGTCTACTTAAAAGAGACTCTACCATTGCAAAGGAGATAAAAATCCAAGCAGAACACATAAACAGGGCACTGGGTGACGTAGTCAAAGAAGTGAAAAAGTCAG
AGGTTGAAAATGGTCCATCATCAGTGGTCACAAGGATACTGAAGTCTCAGTATGCTGCGATGTTCCGCCGCTTCCAGCAAACCATGTTTCTATACAATGACACAATAGCTTTAAAGCAAGAAAAATGC
AAAACGTTTATTGTTCGTCAGCTTGAAGTGGCCGGAAAAGAAGTTTCTGAAGAAGAAGTGAATGACATGCTTCACCATGGAAAATGGGAAGTTTTCAACGAAAGCTTACTTACAGAAACCAGTATCAC
TAAAGCACAGCTCTCGGAAATTGAACAGAGACACAAGGAACTTGTGAATTTGGAGAACCAAGTGAAGGACCTCCGGGACCTTTTCATTCAGATATCTCTTCTGGTAGAGGAACAGGGAGAGAGCATCA
ACAGCATTGAGGTGATGGTGAACAGCACAAAAGATTATGTTAACAACACCAAAGAGAAATTTGGACTGGCTGTAAAATACAAAAAAAGAAACCCCTGCCGGGCCCTGTGCTGTTGCTGTTGCCCACGC
TGTGGCTCCAAATAAAGATGCTACTTTAGAAACGTTAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_080864	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH23414	(Get FASTA)	NCBI Sequence Viewer
	BAB26492	(Get FASTA)	NCBI Sequence Viewer
	BAB32182	(Get FASTA)	NCBI Sequence Viewer
	EDK98236	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000055901
	ENSMUSP00000055901.6
GenBank Protein	Q8R1Q0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_080864 ⟸ NM_026588

- UniProtKB:

Q9CTR6 (UniProtKB/Swiss-Prot), Q9CV39 (UniProtKB/Swiss-Prot), Q8R1Q0 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MKDRLQELKQKTKEIELSRDGQVFVEEEQGVLVQQAVIYEREPVAERHLHEIQKLQENINSFVDDVQRFGQQQKSLVASMRRFSLLKRDSTIAKEIKIQAEHINRALGDVVKEVKKSEVENGPSSVVT
RILKSQYAAMFRRFQQTMFLYNDTIALKQEKCKTFIVRQLEVAGKEVSEEEVNDMLHHGKWEVFNESLLTETSITKAQLSEIEQRHKELVNLENQVKDLRDLFIQISLLVEEQGESINSIEVMVNSTK
DYVNNTKEKFGLAVKYKKRNPCRALCCCCCPRCGSK

hide sequence

Ensembl Acc Id:

ENSMUSP00000055901 ⟸ ENSMUST00000055557

Protein Domains

t-SNARE coiled-coil homology

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8R1Q0-F1-model_v2	AlphaFold	Q8R1Q0	1-292	view protein structure

RGD ID:

13674208

Promoter ID:

EPDNEW_M21253

Type:

initiation region

Name:

Stx19_1

Description:

Mus musculus syntaxin 19 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	16	62,814,726 - 62,814,786	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000047854	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000055557	ENTREZGENE
	ENSMUST00000055557.6	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.110	UniProtKB/Swiss-Prot
	1.20.58.70	UniProtKB/Swiss-Prot
InterPro	SNARE	UniProtKB/Swiss-Prot
	Syntaxin	UniProtKB/Swiss-Prot
	Syntaxin/epimorphin_CS	UniProtKB/Swiss-Prot
	Syntaxin_N	UniProtKB/Swiss-Prot
	T_SNARE_dom	UniProtKB/Swiss-Prot
KEGG Report	mmu:68159	UniProtKB/Swiss-Prot
MGD	MGI:1915409	ENTREZGENE
NCBI Gene	68159	ENTREZGENE
PANTHER	PTHR19957	UniProtKB/Swiss-Prot
	PTHR19957:SF29	UniProtKB/Swiss-Prot
Pfam	Syntaxin	UniProtKB/Swiss-Prot
PhenoGen	Stx19	PhenoGen
PROSITE	SYNTAXIN	UniProtKB/Swiss-Prot
	T_SNARE	UniProtKB/Swiss-Prot
SMART	t_SNARE	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47661	UniProtKB/Swiss-Prot
UniProt	Q8R1Q0	ENTREZGENE
	Q9CTR6	ENTREZGENE
	Q9CV39	ENTREZGENE
	STX19_MOUSE	UniProtKB/Swiss-Prot
UniProt Secondary	Q9CTR6	UniProtKB/Swiss-Prot
	Q9CV39	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype