Symbol:
Utp25
Name:
UTP25 small subunit processome component
RGD ID:
1619010
MGI Page
MGI
Description:
Predicted to enable U3 snoRNA binding activity and rRNA binding activity. Involved in positive regulation of embryonic development. Predicted to be part of small-subunit processome. Predicted to be active in nucleolus. Is expressed in cerebral cortex; submandibular gland primordium; tooth; and vibrissa. Orthologous to human UTP25 (UTP25 small subunit processome component).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AA4082; AA408296; AW045375; Def; Diex; Diexf; digestive organ expansion factor homolog; digestive organ expansion factor homolog (zebrafish); digestive-organ expansion factor homolog; expressed sequence AA408296; mDef; U3 small nucleolar RNA-associated protein 25 homolog; UTP25 small subunit processor component
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
UTP25 (UTP25 small subunit processome component) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Utp25 (UTP25 small subunit processome component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Utp25 (UTP25 small subunit processome component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
UTP25 (UTP25 small subunit processome component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
UTP25 (UTP25 small subunit processome component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Utp25 (UTP25 small subunit processome component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
UTP25 (UTP25 small subunit processome component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
UTP25 (UTP25 small subunit processome component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Utp25 (UTP25 small subunit processome component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Utp25 (UTP25 small subunit processome component)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
UTP25 (UTP25 small subunit processome component)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
Y41C4A.9
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG3735
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
UTP25
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
utp25
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Xenopus tropicalis (tropical clawed frog):
utp25
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 192,786,707 - 192,812,603 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 192,773,412 - 192,812,580 (-) Ensembl GRCm39 Ensembl GRCm38 1 193,104,399 - 193,130,283 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 193,091,104 - 193,130,272 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 194,930,597 - 194,956,445 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 194,805,127 - 194,830,975 (-) NCBI MGSCv36 mm8 Celera 1 199,979,507 - 200,005,362 (-) NCBI Celera Cytogenetic Map 1 H6 NCBI cM Map 1 97.56 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Utp25 Mouse (+)-schisandrin B multiple interactions ISO Utp25 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of DIEXF mRNA] CTD PMID:31150632 Utp25 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of DIEXF mRNA CTD PMID:22206623 Utp25 Mouse 1-chloro-2,4-dinitrobenzene affects binding ISO UTP25 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to DIEXF protein CTD PMID:32991956 Utp25 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of UTP25 mRNA CTD PMID:39298647 Utp25 Mouse 17beta-estradiol increases expression ISO UTP25 (Homo sapiens) 6480464 Estradiol results in increased expression of UTP25 mRNA CTD PMID:31614463 Utp25 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of UTP25 mRNA CTD PMID:23994337 Utp25 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO UTP25 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Utp25 Mouse 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23994337 Utp25 Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of UTP25 mRNA CTD PMID:19770486 Utp25 Mouse all-trans-retinoic acid decreases expression ISO UTP25 (Homo sapiens) 6480464 Tretinoin results in decreased expression of DIEXF mRNA CTD PMID:33167477 Utp25 Mouse amphetamine decreases expression ISO Utp25 (Rattus norvegicus) 6480464 Amphetamine results in decreased expression of UTP25 mRNA CTD PMID:30779732 Utp25 Mouse antirheumatic drug decreases expression ISO UTP25 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of UTP25 mRNA CTD PMID:24449571 Utp25 Mouse aristolochic acid A increases expression ISO UTP25 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of UTP25 mRNA and aristolochic acid I results in increased expression of UTP25 protein CTD PMID:33212167 Utp25 Mouse arsane increases methylation ISO UTP25 (Homo sapiens) 6480464 Arsenic results in increased methylation of UTP25 promoter CTD PMID:21291286 Utp25 Mouse arsane multiple interactions ISO UTP25 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of UTP25 mRNA CTD PMID:39836092 Utp25 Mouse arsenic atom increases methylation ISO UTP25 (Homo sapiens) 6480464 Arsenic results in increased methylation of UTP25 promoter CTD PMID:21291286 Utp25 Mouse arsenic atom multiple interactions ISO UTP25 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of UTP25 mRNA CTD PMID:39836092 Utp25 Mouse arsenite(3-) increases methylation ISO UTP25 (Homo sapiens) 6480464 arsenite results in increased methylation of UTP25 promoter CTD PMID:23974009 Utp25 Mouse benzo[a]pyrene affects methylation ISO UTP25 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of UTP25 promoter CTD PMID:27901495 Utp25 Mouse benzo[a]pyrene decreases methylation EXP 6480464 Benzo(a)pyrene results in decreased methylation of DIEXF intron CTD PMID:27901495 Utp25 Mouse benzo[a]pyrene diol epoxide I increases expression ISO UTP25 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Utp25 Mouse beta-naphthoflavone increases expression EXP 6480464 beta-Naphthoflavone results in increased expression of UTP25 mRNA CTD PMID:23994337 Utp25 Mouse bisphenol A decreases expression ISO UTP25 (Homo sapiens) 6480464 bisphenol A results in decreased expression of UTP25 mRNA CTD PMID:20678512 Utp25 Mouse bisphenol A increases expression ISO Utp25 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of UTP25 mRNA CTD PMID:25181051 more ... Utp25 Mouse cadmium dichloride decreases expression ISO UTP25 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of UTP25 mRNA CTD PMID:38568856 Utp25 Mouse chromium(6+) multiple interactions ISO UTP25 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of UTP25 mRNA CTD PMID:38479592 Utp25 Mouse cisplatin decreases expression ISO UTP25 (Homo sapiens) 6480464 Cisplatin results in decreased expression of UTP25 mRNA CTD PMID:27594783 Utp25 Mouse crocidolite asbestos increases expression ISO UTP25 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of UTP25 mRNA CTD PMID:18687144 Utp25 Mouse cyclosporin A increases expression ISO UTP25 (Homo sapiens) 6480464 Cyclosporine results in increased expression of UTP25 mRNA CTD PMID:20106945 and PMID:25562108 Utp25 Mouse DDE increases expression ISO UTP25 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of UTP25 mRNA CTD PMID:38568856 Utp25 Mouse dorsomorphin multiple interactions ISO UTP25 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of UTP25 mRNA CTD PMID:27188386 Utp25 Mouse doxorubicin decreases expression ISO UTP25 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of UTP25 mRNA CTD PMID:29803840 Utp25 Mouse elemental selenium decreases expression ISO UTP25 (Homo sapiens) 6480464 Selenium results in decreased expression of UTP25 mRNA CTD PMID:19244175 Utp25 Mouse ethyl methanesulfonate decreases expression ISO UTP25 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of UTP25 mRNA CTD PMID:23649840 Utp25 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of DIEXF mRNA CTD PMID:25629700 Utp25 Mouse gentamycin increases expression ISO Utp25 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of UTP25 mRNA CTD PMID:33387578 Utp25 Mouse hydrogen peroxide affects expression ISO UTP25 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of UTP25 mRNA CTD PMID:20044591 Utp25 Mouse lead(0) decreases expression ISO UTP25 (Homo sapiens) 6480464 Lead results in decreased expression of UTP25 mRNA CTD PMID:19921347 Utp25 Mouse leflunomide increases expression ISO UTP25 (Homo sapiens) 6480464 leflunomide results in increased expression of UTP25 mRNA CTD PMID:28988120 Utp25 Mouse manganese atom multiple interactions ISO UTP25 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of UTP25 mRNA CTD PMID:39836092 Utp25 Mouse manganese(0) multiple interactions ISO UTP25 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of UTP25 mRNA CTD PMID:39836092 Utp25 Mouse manganese(II) chloride multiple interactions ISO UTP25 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of UTP25 mRNA CTD PMID:39836092 Utp25 Mouse melphalan increases expression ISO UTP25 (Homo sapiens) 6480464 Melphalan results in increased expression of UTP25 mRNA CTD PMID:22363485 Utp25 Mouse paracetamol decreases expression ISO UTP25 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of UTP25 mRNA CTD PMID:21420995 Utp25 Mouse paracetamol decreases expression ISO Utp25 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of UTP25 mRNA CTD PMID:33387578 Utp25 Mouse perfluorononanoic acid increases expression ISO UTP25 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of UTP25 mRNA CTD PMID:32588087 Utp25 Mouse phenylmercury acetate increases expression ISO UTP25 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of UTP25 mRNA CTD PMID:26272509 Utp25 Mouse phenylmercury acetate multiple interactions ISO UTP25 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of UTP25 mRNA CTD PMID:27188386 Utp25 Mouse potassium chromate decreases expression ISO UTP25 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of UTP25 mRNA CTD PMID:22714537 Utp25 Mouse SB 431542 multiple interactions ISO UTP25 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of UTP25 mRNA CTD PMID:27188386 Utp25 Mouse selenium atom decreases expression ISO UTP25 (Homo sapiens) 6480464 Selenium results in decreased expression of UTP25 mRNA CTD PMID:19244175 Utp25 Mouse sodium arsenite multiple interactions ISO UTP25 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of UTP25 mRNA CTD PMID:39836092 Utp25 Mouse sunitinib increases expression ISO UTP25 (Homo sapiens) 6480464 Sunitinib results in increased expression of UTP25 mRNA CTD PMID:31533062 Utp25 Mouse tert-butyl hydroperoxide increases expression ISO UTP25 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of UTP25 mRNA CTD PMID:15336504 Utp25 Mouse tetrachloromethane increases expression ISO Utp25 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of DIEXF mRNA CTD PMID:31150632 Utp25 Mouse tetrachloromethane multiple interactions ISO Utp25 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of DIEXF mRNA] CTD PMID:31150632 Utp25 Mouse thioacetamide increases expression ISO Utp25 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of UTP25 mRNA CTD PMID:34492290 Utp25 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of DIEXF gene CTD PMID:35295148 Utp25 Mouse triphenyl phosphate affects expression ISO UTP25 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of UTP25 mRNA CTD PMID:37042841 Utp25 Mouse triphenyl phosphate decreases expression ISO Utp25 (Rattus norvegicus) 6480464 triphenyl phosphate results in decreased expression of DIEXF mRNA CTD PMID:30589522 Utp25 Mouse triptonide affects expression EXP 6480464 triptonide affects the expression of UTP25 mRNA CTD PMID:33045310 Utp25 Mouse troglitazone decreases expression EXP 6480464 Troglitazone results in decreased expression of UTP25 mRNA CTD PMID:28973697 Utp25 Mouse urethane decreases expression ISO UTP25 (Homo sapiens) 6480464 Urethane results in decreased expression of UTP25 mRNA CTD PMID:28818685 Utp25 Mouse valproic acid decreases methylation ISO UTP25 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of UTP25 gene CTD PMID:29154799 Utp25 Mouse valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of UTP25 mRNA CTD PMID:19136453 and PMID:21427059 Utp25 Mouse valproic acid affects expression ISO UTP25 (Homo sapiens) 6480464 Valproic Acid affects the expression of UTP25 mRNA CTD PMID:25979313 Utp25 Mouse valproic acid decreases expression ISO UTP25 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of UTP25 mRNA CTD PMID:23179753 and PMID:27188386 Utp25 Mouse vitamin E decreases expression ISO UTP25 (Homo sapiens) 6480464 Vitamin E results in decreased expression of UTP25 mRNA CTD PMID:19244175
(+)-schisandrin B (ISO) 1,2-dimethylhydrazine (EXP) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) aflatoxin B1 (EXP) all-trans-retinoic acid (ISO) amphetamine (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) beta-naphthoflavone (EXP) bisphenol A (ISO) cadmium dichloride (ISO) chromium(6+) (ISO) cisplatin (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) DDE (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) ethyl methanesulfonate (ISO) folic acid (EXP) gentamycin (ISO) hydrogen peroxide (ISO) lead(0) (ISO) leflunomide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) melphalan (ISO) paracetamol (ISO) perfluorononanoic acid (ISO) phenylmercury acetate (ISO) potassium chromate (ISO) SB 431542 (ISO) selenium atom (ISO) sodium arsenite (ISO) sunitinib (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (ISO) thioacetamide (ISO) titanium dioxide (EXP) triphenyl phosphate (ISO) triptonide (EXP) troglitazone (EXP) urethane (ISO) valproic acid (EXP,ISO) vitamin E (ISO)
Utp25 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 192,786,707 - 192,812,603 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 192,773,412 - 192,812,580 (-) Ensembl GRCm39 Ensembl GRCm38 1 193,104,399 - 193,130,283 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 193,091,104 - 193,130,272 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 194,930,597 - 194,956,445 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 194,805,127 - 194,830,975 (-) NCBI MGSCv36 mm8 Celera 1 199,979,507 - 200,005,362 (-) NCBI Celera Cytogenetic Map 1 H6 NCBI cM Map 1 97.56 NCBI
UTP25 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 209,827,972 - 209,857,565 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 209,827,972 - 209,857,565 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 210,001,317 - 210,030,910 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 208,067,956 - 208,097,531 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 183,232,203 - 183,261,798 (+) NCBI Celera Cytogenetic Map 1 q32.2 NCBI HuRef 1 180,676,427 - 180,706,025 (+) NCBI HuRef CHM1_1 1 211,273,584 - 211,303,174 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 209,074,743 - 209,104,338 (+) NCBI T2T-CHM13v2.0
Utp25 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 107,159,092 - 107,180,361 (-) NCBI GRCr8 mRatBN7.2 13 104,630,390 - 104,651,681 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 104,630,391 - 104,651,662 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 107,148,008 - 107,169,277 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 108,531,858 - 108,553,127 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 105,749,825 - 105,771,095 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 111,828,052 - 111,849,654 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 111,828,043 - 111,849,653 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 116,382,860 - 116,404,451 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 108,945,112 - 108,966,381 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 109,134,216 - 109,155,439 (-) NCBI Celera 13 104,060,438 - 104,081,707 (-) NCBI Celera Cytogenetic Map 13 q27 NCBI
Utp25 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955489 2,339,745 - 2,387,103 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955489 2,362,290 - 2,387,162 (-) NCBI ChiLan1.0 ChiLan1.0
UTP25 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 39,548,962 - 39,574,522 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 39,515,382 - 39,540,687 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 185,403,715 - 185,433,830 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 190,268,857 - 190,292,729 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 190,268,857 - 190,292,980 (+) Ensembl panpan1.1 panPan2
UTP25 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 8,477,026 - 8,512,713 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 8,488,350 - 8,512,705 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 8,065,263 - 8,090,352 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 8,188,707 - 8,214,441 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 8,188,839 - 8,215,357 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 8,118,398 - 8,143,450 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 8,215,411 - 8,240,320 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 8,242,865 - 8,266,776 (-) NCBI UU_Cfam_GSD_1.0
Utp25 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 66,003,992 - 66,028,584 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936557 3,223,470 - 3,268,888 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936557 3,244,274 - 3,268,853 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
UTP25 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 133,105,063 - 133,141,217 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 133,115,177 - 133,141,258 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 146,382,511 - 146,400,265 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
UTP25 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 19,601,165 - 19,625,274 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 19,600,266 - 19,625,229 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 20,200,305 - 20,224,419 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Utp25
.
Predicted Target Of
Count of predictions: 1286 Count of miRNA genes: 617 Interacting mature miRNAs: 777 Transcripts: ENSMUST00000085555 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 1301431 Pcho1_m plasma cholesterol 1 (mouse) Not determined 1 159262573 193262693 Mouse 1300823 Ath9_m atherosclerosis 9 (mouse) Not determined 1 160112768 194112883 Mouse 1558802 Skmw6_m skeletal muscle weight 6 (mouse) Not determined 1 167954584 195154279 Mouse 1559024 Zit1_m zinc induced tolerance 1 (mouse) Not determined 1 167462514 195154279 Mouse 1301652 Cpfd2_m cerebellum pattern fissures (mouse) Not determined 1 172303451 195154279 Mouse 12790987 Tgl5_m triglyceride 5 (mouse) 1 160097157 194097157 Mouse 1301339 Hdlq15_m HDL QTL 15 (mouse) Not determined 1 165873675 195154279 Mouse 12880429 V25Dq1_m vitamin D inactive form serum level QTL 1 (mouse) 1 172632197 195154279 Mouse 10043863 Swrl5_m SWR lupus locus 5 (mouse) Not determined 1 172303451 195154279 Mouse 12880426 V25Dq2_m vitamin D inactive form serum level QTL 2 (mouse) 1 172532197 195154279 Mouse 12790988 Phdlc5_m plasma HDL cholesterol 5 (mouse) 9 160097157 194097157 Mouse 1301596 Elnt_m escape latencies during navigation task (mouse) Not determined 1 162145207 194111528 Mouse 11049575 Lmr8b_m leishmaniasis resistance 8b (mouse) 1 172303451 195154279 Mouse 1301251 Scc3_m colon tumor susceptibility 3 (mouse) Not determined 1 168213823 195154279 Mouse 1357732 Tbbmd1_m total body bone mineral density 1 (mouse) Not determined 1 171983110 195154279 Mouse 1301632 Bw8q1_m body weight at 8 weeks QTL 1 (mouse) Not determined 1 161201261 195154279 Mouse 4141483 Femwf7_m femur work to failure 7 (mouse) Not determined 167462514 195154279 Mouse 1302023 Orch4_m autoimmune orchitis resistance 4 (mouse) Not determined 1 175211318 195154279 Mouse 1302158 Fembrs5_m femur breaking strength 5 (mouse) Not determined 1 167462514 195154279 Mouse 11532690 Sluc37_m susceptibility to lung cancer 37 (mouse) 1 175468817 194111528 Mouse 1301132 Mors1_m modifier of obesity related sterility 1 (mouse) Not determined 1 170379500 195154279 Mouse
RH125792
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 193,107,049 - 193,107,165 UniSTS GRCm38 MGSCv37 1 194,933,243 - 194,933,359 UniSTS GRCm37 Celera 1 199,982,153 - 199,982,269 UniSTS Cytogenetic Map 1 H6 UniSTS
AW045375
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 193,107,096 - 193,107,233 UniSTS GRCm38 MGSCv37 1 194,933,290 - 194,933,427 UniSTS GRCm37 Celera 1 199,982,200 - 199,982,337 UniSTS Cytogenetic Map 1 H6 UniSTS Whitehead/MRC_RH 1 2445.75 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000085555 ⟹ ENSMUSP00000082691
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 192,786,710 - 192,812,580 (-) Ensembl GRCm38.p6 Ensembl 1 193,104,402 - 193,130,272 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000191928
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 192,802,786 - 192,804,779 (-) Ensembl GRCm38.p6 Ensembl 1 193,120,478 - 193,122,471 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000193070
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 192,790,061 - 192,797,686 (-) Ensembl GRCm38.p6 Ensembl 1 193,107,753 - 193,115,378 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000193460 ⟹ ENSMUSP00000142059
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 192,774,900 - 192,799,865 (-) Ensembl GRCm38.p6 Ensembl 1 193,092,566 - 193,117,557 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000194124
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 192,804,368 - 192,806,116 (-) Ensembl GRCm38.p6 Ensembl 1 193,122,060 - 193,123,808 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000194335
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 192,802,951 - 192,810,653 (-) Ensembl GRCm38.p6 Ensembl 1 193,120,643 - 193,128,345 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000194412 ⟹ ENSMUSP00000142099
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 192,773,412 - 192,796,983 (-) Ensembl GRCm38.p6 Ensembl 1 193,091,104 - 193,114,675 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000195291 ⟹ ENSMUSP00000141676
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 192,786,726 - 192,812,552 (-) Ensembl GRCm38.p6 Ensembl 1 193,104,418 - 193,130,244 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000195848 ⟹ ENSMUSP00000141950
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 192,804,350 - 192,812,515 (-) Ensembl GRCm38.p6 Ensembl 1 193,122,042 - 193,130,207 (-) Ensembl
RefSeq Acc Id:
NM_001368818 ⟹ NP_001355747
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 192,786,707 - 192,812,544 (-) NCBI GRCm38 1 193,104,403 - 193,129,983 (-) NCBI
Sequence:
GTGCAGGACGGGAACCCCGCTGCGGAGGTGCGCTCTGCACCGGGACCTGCTGAGACCGCGGGCCGTGCTGCCTGTCATCCGAGCACGCGCGGGCTCAGGCGCGAAATCGCAGCTTAGCCCAGCCAGGG
hide sequence
RefSeq Acc Id:
NM_001368819 ⟹ NP_001355748
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 192,798,985 - 192,812,544 (-) NCBI GRCm38 1 193,115,656 - 193,130,251 (-) NCBI
Sequence:
CTCCGCCGTAAAGCCAGCGTGCCCACGTGCGACAGCGACAACTTGCCACTGGGAACCTTGTGTTTTGTTTGTTTGTTTGTGGCGAGCTTGACGTTTCCGCTATGGGCAAACGCCGGAACCGGGGCCGC
hide sequence
RefSeq Acc Id:
NM_145415 ⟹ NP_663390
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 192,786,707 - 192,812,544 (-) NCBI GRCm38 1 193,104,403 - 193,130,251 (-) NCBI MGSCv37 1 194,930,597 - 194,956,445 (-) RGD Celera 1 199,979,507 - 200,005,362 (-) RGD cM Map 1 ENTREZGENE
Sequence:
CTCCGCCGTAAAGCCAGCGTGCCCACGTGCGACAGCGACAACTTGCCACTGGGAACCTTGTGTT
hide sequence
RefSeq Acc Id:
NR_151719
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 192,786,707 - 192,812,544 (-) NCBI GRCm38 1 193,104,399 - 193,130,270 (-) NCBI
Sequence:
TTTGCTTTACGGCTCCCGCCTCCGCCGTAAAGCCAGCGTGCCCACGTGCGACAGCGACAACTTGCCACTGGGAACCTTGTGTTTTGTTTGTTTGTTTGTGGCGAGCTTGACGTTTCCGCTATGGGCAA
hide sequence
RefSeq Acc Id:
NR_185200
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 192,786,707 - 192,812,544 (-) NCBI
RefSeq Acc Id:
XM_006497250 ⟹ XP_006497313
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 192,789,578 - 192,812,467 (-) NCBI GRCm38 1 193,107,270 - 193,130,159 (-) NCBI
Sequence:
GTTTCCGCTATGGGCAAACGCCGGAACCGGGGCCGCAGCCAGATGCTCAGCACCATGACCAAGA
hide sequence
RefSeq Acc Id:
XM_030252943 ⟹ XP_030108803
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 192,789,578 - 192,812,586 (-) NCBI GRCm38 1 193,107,270 - 193,129,525 (-) NCBI
Sequence:
AAAGCAGCTTTGCTTTACGGCTCCCGCCTCCGCCGTAAAGCCAGCGTGCCCACGTGCGACAGCG
hide sequence
RefSeq Acc Id:
XR_004941611
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 192,789,578 - 192,812,603 (-) NCBI
Sequence:
TCGTACTCTCTGGGCGTAAAGCAGCTTTGCTTTACGGCTCCCGCCTCCGCCGTAAAGCCAGCGTGCCCACGTGCGACAGCGACAACTTGCCACTGGGAACCTTGTGTTTTGTTTGTTTGTTTGTGGCG
hide sequence
RefSeq Acc Id:
NP_663390 ⟸ NM_145415
- Peptide Label:
isoform 1
- UniProtKB:
Q8VEC2 (UniProtKB/Swiss-Prot), Q8BWJ1 (UniProtKB/Swiss-Prot), Q8BTT6 (UniProtKB/Swiss-Prot), A0A0R4J114 (UniProtKB/TrEMBL)
- Sequence:
MGKRRNRGRSQMLSTMTKKQKKHLRDFGEEHPFYDRVSKKEAKPQICQLPESSDSSHSESESESEQEHVSGYHRLLATLKNVSEEEEEEEEEEEEEEEEEEEEEDDSAVGDAEMNEEAGSEDGSVGEA
hide sequence
RefSeq Acc Id:
XP_006497313 ⟸ XM_006497250
- Peptide Label:
isoform X2
- Sequence:
MNSYRDLFYPERTALKNGEEVRHVYCLHAINHVLKANAQVLANNSRRRSQKLGVGEDDDFRDQGLTRPKVLIVVPFREAALRVVQLFISLLEGDSKKKIIVSNKKRFQGEYGSDPEERPPNLKRPEDY
hide sequence
RefSeq Acc Id:
NP_001355747 ⟸ NM_001368818
- Peptide Label:
isoform 2
- UniProtKB:
Q8VEC2 (UniProtKB/Swiss-Prot), Q8BWJ1 (UniProtKB/Swiss-Prot), Q8BTT6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_030108803 ⟸ XM_030252943
- Peptide Label:
isoform X1
- UniProtKB:
Q8VEC2 (UniProtKB/Swiss-Prot), Q8BWJ1 (UniProtKB/Swiss-Prot), Q8BTT6 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
NP_001355748 ⟸ NM_001368819
- Peptide Label:
isoform 3
Ensembl Acc Id:
ENSMUSP00000082691 ⟸ ENSMUST00000085555
Ensembl Acc Id:
ENSMUSP00000142099 ⟸ ENSMUST00000194412
Ensembl Acc Id:
ENSMUSP00000142059 ⟸ ENSMUST00000193460
Ensembl Acc Id:
ENSMUSP00000141950 ⟸ ENSMUST00000195848
Ensembl Acc Id:
ENSMUSP00000141676 ⟸ ENSMUST00000195291
RGD ID: 6876154 Promoter ID: EPDNEW_M1528 Type: initiation region Name: Diexf_1 Description: Mus musculus digestive organ expansion factor homolog , transcriptvariant 2, non-coding RNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 193,130,236 - 193,130,296 EPDNEW
RGD ID: 6817176 Promoter ID: MM_KWN:3346 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: NM_145415 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 194,956,254 - 194,956,754 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-21
Utp25
UTP25 small subunit processome component
AA408296
expressed sequence AA408296
Symbol and/or name change
5135510 APPROVED
2024-08-21
AA408296
expressed sequence AA408296
Utp25
UTP25 small subunit processome component
Symbol and/or name change
5135510 APPROVED
2019-04-23
Utp25
UTP25 small subunit processome component
Diexf
digestive organ expansion factor homolog (zebrafish)
Symbol and/or name change
5135510 APPROVED
2011-07-27
Diexf
digestive organ expansion factor homolog (zebrafish)
AA408296
expressed sequence AA408296
Symbol and/or name change
5135510 APPROVED
