Symbol:
Ankrd13a
Name:
ankyrin repeat domain 13a
RGD ID:
1617543
MGI Page
MGI
Description:
Predicted to enable ubiquitin-modified protein reader activity. Predicted to be involved in negative regulation of protein localization to endosome and negative regulation of receptor internalization. Predicted to be located in late endosome; perinuclear region of cytoplasm; and plasma membrane. Predicted to be active in cytoplasm. Is expressed in acoustic ganglion; endolymphatic appendage; and otocyst. Orthologous to human ANKRD13A (ankyrin repeat domain 13A).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1100001D10Rik; ANKRD13; ankyrin repeat domain-containing protein 13A; AU046136; MGC118502
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ANKRD13A (ankyrin repeat domain 13A) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Ankrd13a (ankyrin repeat domain 13a) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ankrd13a (ankyrin repeat domain 13A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ANKRD13A (ankyrin repeat domain 13A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ANKRD13A (ankyrin repeat domain 13A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ankrd13a (ankyrin repeat domain 13A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ANKRD13A (ankyrin repeat domain 13A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ANKRD13A (ankyrin repeat domain 13A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ankrd13a (ankyrin repeat domain 13A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Ankrd13a (ankyrin repeat domain 13a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ANKRD13A (ankyrin repeat domain 13A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ankrd13a (ankyrin repeat domain 13A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
C18F10.7
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG15118
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ankrd13a
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 114,913,009 - 114,943,882 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 114,912,738 - 114,944,261 (+) Ensembl GRCm39 Ensembl GRCm38 5 114,774,948 - 114,805,821 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 114,774,677 - 114,806,200 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 115,225,149 - 115,255,830 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 115,036,139 - 115,066,820 (+) NCBI MGSCv36 mm8 Celera 5 111,873,346 - 111,903,995 (+) NCBI Celera Cytogenetic Map 5 F NCBI cM Map 5 55.99 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ankrd13a Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ANKRD13A mRNA CTD PMID:36331819 Ankrd13a Mouse 1,2-dimethylhydrazine affects expression EXP 6480464 1 and 2-Dimethylhydrazine affects the expression of ANKRD13A mRNA CTD PMID:22206623 Ankrd13a Mouse 2,3',4,4',5-Pentachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:31388691 Ankrd13a Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ANKRD13A mRNA CTD PMID:21570461 Ankrd13a Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ankrd13a (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ANKRD13A mRNA CTD PMID:34747641 Ankrd13a Mouse 2-hydroxypropanoic acid decreases expression ISO ANKRD13A (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ANKRD13A mRNA CTD PMID:30851411 Ankrd13a Mouse 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ANKRD13A mRNA CTD PMID:20188158 Ankrd13a Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ANKRD13A (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ANKRD13A mRNA more ... CTD PMID:28628672 Ankrd13a Mouse 4,4'-sulfonyldiphenol multiple interactions ISO ANKRD13A (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of ANKRD13A mRNA CTD PMID:28628672 Ankrd13a Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of ANKRD13A mRNA CTD PMID:39298647 Ankrd13a Mouse 6-propyl-2-thiouracil increases expression ISO Ankrd13a (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of ANKRD13A mRNA CTD PMID:30047161 Ankrd13a Mouse aconitine increases expression ISO Ankrd13a (Rattus norvegicus) 6480464 Aconitine results in increased expression of ANKRD13A protein CTD PMID:33236894 Ankrd13a Mouse all-trans-retinoic acid increases expression ISO ANKRD13A (Homo sapiens) 6480464 Tretinoin results in increased expression of ANKRD13A mRNA CTD PMID:33167477 Ankrd13a Mouse amitrole increases expression ISO Ankrd13a (Rattus norvegicus) 6480464 Amitrole results in increased expression of ANKRD13A mRNA CTD PMID:30047161 Ankrd13a Mouse aristolochic acid A increases expression ISO ANKRD13A (Homo sapiens) 6480464 aristolochic acid I results in increased expression of ANKRD13A mRNA CTD PMID:33212167 Ankrd13a Mouse arsane multiple interactions ISO ANKRD13A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ANKRD13A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ANKRD13A mRNA CTD PMID:39836092 Ankrd13a Mouse arsenic atom multiple interactions ISO ANKRD13A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ANKRD13A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ANKRD13A mRNA CTD PMID:39836092 Ankrd13a Mouse atrazine decreases expression ISO ANKRD13A (Homo sapiens) 6480464 Atrazine results in decreased expression of ANKRD13A mRNA CTD PMID:22378314 Ankrd13a Mouse bisphenol A increases expression ISO Ankrd13a (Rattus norvegicus) 6480464 bisphenol A results in increased expression of ANKRD13A mRNA CTD PMID:25181051 Ankrd13a Mouse bisphenol A increases expression ISO ANKRD13A (Homo sapiens) 6480464 bisphenol A results in increased expression of ANKRD13A protein CTD PMID:32981897 Ankrd13a Mouse bisphenol A decreases expression ISO ANKRD13A (Homo sapiens) 6480464 bisphenol A results in decreased expression of ANKRD13A mRNA CTD PMID:29275510 Ankrd13a Mouse bisphenol A multiple interactions ISO ANKRD13A (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ANKRD13A gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ANKRD13A mRNA CTD PMID:28628672 and PMID:31601247 Ankrd13a Mouse bisphenol F multiple interactions ISO ANKRD13A (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ANKRD13A mRNA CTD PMID:28628672 Ankrd13a Mouse C60 fullerene increases expression ISO Ankrd13a (Rattus norvegicus) 6480464 fullerene C60 results in increased expression of ANKRD13A mRNA CTD PMID:19167457 Ankrd13a Mouse cadmium dichloride decreases expression ISO Ankrd13a (Rattus norvegicus) 6480464 Cadmium Chloride results in decreased expression of ANKRD13A mRNA CTD PMID:33453195 Ankrd13a Mouse caffeine decreases phosphorylation ISO ANKRD13A (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of ANKRD13A protein CTD PMID:35688186 Ankrd13a Mouse CGP 52608 multiple interactions ISO ANKRD13A (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ANKRD13A gene] CTD PMID:28238834 Ankrd13a Mouse dexamethasone multiple interactions ISO ANKRD13A (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ANKRD13A mRNA more ... CTD PMID:28628672 Ankrd13a Mouse Dibutyl phosphate affects expression ISO ANKRD13A (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ANKRD13A mRNA CTD PMID:37042841 Ankrd13a Mouse dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of ANKRD13A mRNA CTD PMID:21266533 Ankrd13a Mouse diquat decreases expression EXP 6480464 Diquat results in decreased expression of ANKRD13A protein CTD PMID:36851058 Ankrd13a Mouse endosulfan increases expression ISO Ankrd13a (Rattus norvegicus) 6480464 Endosulfan results in increased expression of ANKRD13A mRNA CTD PMID:29391264 Ankrd13a Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of ANKRD13A mRNA CTD PMID:30319688 Ankrd13a Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of ANKRD13A mRNA CTD PMID:30319688 Ankrd13a Mouse fulvestrant multiple interactions ISO ANKRD13A (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ANKRD13A gene CTD PMID:31601247 Ankrd13a Mouse glyphosate increases methylation ISO Ankrd13a (Rattus norvegicus) 6480464 Glyphosate results in increased methylation of ANKRD13A gene CTD PMID:31011160 Ankrd13a Mouse glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of ANKRD13A mRNA CTD PMID:35897073 Ankrd13a Mouse hydrogen peroxide multiple interactions EXP 6480464 [Hydrogen Peroxide co-treated with N-(oxo-5 more ... CTD PMID:31494107 Ankrd13a Mouse indometacin multiple interactions ISO ANKRD13A (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ANKRD13A mRNA more ... CTD PMID:28628672 Ankrd13a Mouse lead(0) affects expression ISO ANKRD13A (Homo sapiens) 6480464 Lead affects the expression of ANKRD13A mRNA CTD PMID:28903495 Ankrd13a Mouse manganese atom multiple interactions ISO ANKRD13A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ANKRD13A mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of ANKRD13A mRNA CTD PMID:39836092 Ankrd13a Mouse manganese(0) multiple interactions ISO ANKRD13A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ANKRD13A mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of ANKRD13A mRNA CTD PMID:39836092 Ankrd13a Mouse manganese(II) chloride multiple interactions ISO ANKRD13A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ANKRD13A mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of ANKRD13A mRNA CTD PMID:39836092 Ankrd13a Mouse methimazole increases expression ISO Ankrd13a (Rattus norvegicus) 6480464 Methimazole results in increased expression of ANKRD13A mRNA CTD PMID:30047161 Ankrd13a Mouse methyl methanesulfonate increases expression ISO ANKRD13A (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of ANKRD13A mRNA CTD PMID:23649840 Ankrd13a Mouse N,N-diethyl-m-toluamide multiple interactions ISO Ankrd13a (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in decreased methylation of ANKRD13A gene CTD PMID:33148267 Ankrd13a Mouse paracetamol increases expression ISO ANKRD13A (Homo sapiens) 6480464 Acetaminophen results in increased expression of ANKRD13A mRNA CTD PMID:21420995 Ankrd13a Mouse paracetamol increases expression ISO Ankrd13a (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of ANKRD13A mRNA CTD PMID:33387578 Ankrd13a Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ANKRD13A mRNA CTD PMID:36331819 Ankrd13a Mouse permethrin multiple interactions ISO Ankrd13a (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in decreased methylation of ANKRD13A gene CTD PMID:33148267 Ankrd13a Mouse pirinixic acid multiple interactions ISO ANKRD13A (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of ANKRD13A mRNA CTD PMID:19710929 Ankrd13a Mouse propiconazole increases expression ISO Ankrd13a (Rattus norvegicus) 6480464 propiconazole results in increased expression of ANKRD13A mRNA CTD PMID:30047161 Ankrd13a Mouse rac-lactic acid decreases expression ISO ANKRD13A (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ANKRD13A mRNA CTD PMID:30851411 Ankrd13a Mouse sodium arsenite decreases expression ISO ANKRD13A (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ANKRD13A mRNA CTD PMID:21457566 Ankrd13a Mouse sodium arsenite multiple interactions ISO ANKRD13A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ANKRD13A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ANKRD13A mRNA CTD PMID:39836092 Ankrd13a Mouse Soman increases expression ISO Ankrd13a (Rattus norvegicus) 6480464 Soman results in increased expression of ANKRD13A mRNA CTD PMID:19281266 Ankrd13a Mouse sulfadimethoxine increases expression ISO Ankrd13a (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of ANKRD13A mRNA CTD PMID:30047161 Ankrd13a Mouse sunitinib increases expression ISO ANKRD13A (Homo sapiens) 6480464 Sunitinib results in increased expression of ANKRD13A mRNA CTD PMID:31533062 Ankrd13a Mouse temozolomide decreases expression ISO ANKRD13A (Homo sapiens) 6480464 Temozolomide results in decreased expression of ANKRD13A mRNA CTD PMID:31758290 Ankrd13a Mouse trichostatin A affects expression ISO ANKRD13A (Homo sapiens) 6480464 trichostatin A affects the expression of ANKRD13A mRNA CTD PMID:28542535 Ankrd13a Mouse triphenyl phosphate affects expression ISO ANKRD13A (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ANKRD13A mRNA CTD PMID:37042841 Ankrd13a Mouse Triptolide increases expression EXP 6480464 triptolide results in increased expression of ANKRD13A mRNA CTD PMID:32835833 Ankrd13a Mouse urethane increases expression ISO ANKRD13A (Homo sapiens) 6480464 Urethane results in increased expression of ANKRD13A mRNA CTD PMID:28818685 Ankrd13a Mouse valproic acid increases expression ISO ANKRD13A (Homo sapiens) 6480464 Valproic Acid results in increased expression of ANKRD13A mRNA CTD PMID:23179753 Ankrd13a Mouse valproic acid affects expression ISO ANKRD13A (Homo sapiens) 6480464 Valproic Acid affects the expression of ANKRD13A mRNA CTD PMID:25979313
(1->4)-beta-D-glucan (EXP) 1,2-dimethylhydrazine (EXP) 2,3',4,4',5-Pentachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (ISO) aconitine (ISO) all-trans-retinoic acid (ISO) amitrole (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) bisphenol A (ISO) bisphenol F (ISO) C60 fullerene (ISO) cadmium dichloride (ISO) caffeine (ISO) CGP 52608 (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) diquat (EXP) endosulfan (ISO) ethanol (EXP) fulvestrant (ISO) glyphosate (EXP,ISO) hydrogen peroxide (EXP) indometacin (ISO) lead(0) (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methimazole (ISO) methyl methanesulfonate (ISO) N,N-diethyl-m-toluamide (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (EXP) permethrin (ISO) pirinixic acid (ISO) propiconazole (ISO) rac-lactic acid (ISO) sodium arsenite (ISO) Soman (ISO) sulfadimethoxine (ISO) sunitinib (ISO) temozolomide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) Triptolide (EXP) urethane (ISO) valproic acid (ISO)
Ankrd13a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 114,913,009 - 114,943,882 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 114,912,738 - 114,944,261 (+) Ensembl GRCm39 Ensembl GRCm38 5 114,774,948 - 114,805,821 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 114,774,677 - 114,806,200 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 115,225,149 - 115,255,830 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 115,036,139 - 115,066,820 (+) NCBI MGSCv36 mm8 Celera 5 111,873,346 - 111,903,995 (+) NCBI Celera Cytogenetic Map 5 F NCBI cM Map 5 55.99 NCBI
ANKRD13A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 109,999,213 - 110,039,763 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 109,999,186 - 110,039,763 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 110,437,235 - 110,477,568 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 108,921,618 - 108,961,620 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 108,899,954 - 108,939,953 NCBI Celera 12 110,061,469 - 110,101,471 (+) NCBI Celera Cytogenetic Map 12 q24.11 NCBI HuRef 12 107,452,978 - 107,493,242 (+) NCBI HuRef CHM1_1 12 110,405,030 - 110,445,032 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 109,974,902 - 110,015,456 (+) NCBI T2T-CHM13v2.0
Ankrd13a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 47,458,828 - 47,488,959 (-) NCBI GRCr8 mRatBN7.2 12 41,798,196 - 41,828,327 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 41,798,199 - 41,829,327 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 42,966,191 - 42,995,521 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 43,579,769 - 43,609,099 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 42,640,261 - 42,669,591 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 47,558,587 - 47,588,486 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 47,558,590 - 47,588,335 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 49,352,113 - 49,382,397 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 43,086,125 - 43,115,877 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 42,949,513 - 42,979,265 (-) NCBI Celera 12 43,413,708 - 43,443,457 (-) NCBI Celera Cytogenetic Map 12 q16 NCBI
Ankrd13a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955455 8,576,406 - 8,610,995 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955455 8,576,406 - 8,610,878 (-) NCBI ChiLan1.0 ChiLan1.0
ANKRD13A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 118,066,369 - 118,106,651 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 118,062,768 - 118,103,839 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 107,575,427 - 107,615,706 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 110,970,433 - 111,009,773 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 110,979,786 - 111,007,899 (+) Ensembl panpan1.1 panPan2
ANKRD13A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 17,135,500 - 17,168,003 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 17,137,297 - 17,167,932 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 18,634,213 - 18,666,708 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 17,479,956 - 17,512,486 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 17,479,969 - 17,512,837 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 18,843,776 - 18,876,267 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 17,469,736 - 17,502,237 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 17,487,197 - 17,519,707 (-) NCBI UU_Cfam_GSD_1.0
Ankrd13a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 143,858,198 - 143,894,383 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936769 1,581,187 - 1,617,712 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936769 1,581,517 - 1,617,696 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ANKRD13A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 40,954,347 - 40,990,451 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 40,954,345 - 40,995,882 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 43,479,735 - 43,506,000 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ANKRD13A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 105,238,471 - 105,280,712 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 105,238,744 - 105,281,489 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 139,840,457 - 139,882,147 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ankrd13a
.
Predicted Target Of
Count of predictions: 1079 Count of miRNA genes: 463 Interacting mature miRNAs: 563 Transcripts: ENSMUST00000102578, ENSMUST00000129001, ENSMUST00000131803, ENSMUST00000137519, ENSMUST00000140604 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301399 Cpfd3_m cerebellum pattern fissures (mouse) Not determined 5 87386871 121387065 Mouse 25314310 Syncl4_m synaptonemal complex length 4 (mouse) 5 103047866 115538059 Mouse 25314315 Mlh1fc4_m MLH1 foci count 4 (mouse) 5 74460661 132528839 Mouse 1357725 Eae39_m experimental allergic encephalomyelitis 39 (mouse) Not determined 5 89418876 118864028 Mouse 14746986 Manh58_m mandible shape 58 (mouse) 5 102446283 136446283 Mouse 1300993 Hycdc_m hypercapnic duty cycle (mouse) Not determined 5 90561006 124561151 Mouse 1301126 Bwem1_m body weight day 30 males 1 (mouse) Not determined 5 87386871 121387065 Mouse 1300659 Pcd8ts1_m p-glycoprotein positive CD8 T cell subset 1 (mouse) Not determined 5 97021753 131021986 Mouse 1301042 Elmaz1_m elevated maze behavior 1 (mouse) Not determined 5 98019649 116876624 Mouse 1300913 Bwefm_m body weight females and males day 10 (mouse) Not determined 5 109439348 143439459 Mouse 10402486 Dipa1_m drug induced psychomotor activation 1 (mouse) Not determined 5 95465549 129465722 Mouse 1357886 Diht_m dopamine-induced hypothermia (mouse) Not determined 5 104498738 115101540 Mouse 10043958 Chldq12_m cholesterol and HDL QTL 12 (mouse) Not determined 5 87386871 121387065 Mouse 26884395 Humsd2_m humerus midshaft diameter 2, 10 week (mouse) 5 70057343 132528839 Mouse 10412202 Bbaa26_m B.burgdorferi-associated arthritis 26 (mouse) Not determined 5 104583688 138555455 Mouse 1301543 Hypch_m hypercholesterolemia (mouse) Not determined 5 109238624 139118905 Mouse 12904945 Tammq2_m tibialis anterior muscle mass QTL 2 (mouse) 5 100665965 134665965 Mouse 4142473 Chlq11_m circulating hormone level QTL 11 (mouse) Not determined 5 107906299 141906412 Mouse 1301419 Cypr3_m cytokine production 3 (mouse) Not determined 5 81019649 115019803 Mouse 11341716 Rvfs3_m Rift Valley fever susceptibility 3 (mouse) 5 26441234 138455402 Mouse 12904959 Smmq1_m soleus muscle mass QTL 1 (mouse) 5 100665965 134665965 Mouse 10412197 Bbaa25_m B.burgdorferi-associated arthritis 25 (mouse) Not determined 5 109167240 143167381 Mouse 13506928 Recrq8_m recombination rate in male meiosis QTL 8 (mouse) 5 74460661 132528839 Mouse 27226719 Tibw6_m tibia width 6, proximal, 16 week (mouse) 5 72857343 139985755 Mouse 1301457 Cfsw2_m cystic fibrosis survival to weaning 2 (mouse) Not determined 5 90561006 124561151 Mouse 10401245 Bglu18_m blood glucose level 18 (mouse) Not determined 5 82838468 116838597 Mouse 1301974 Chab7_m cholesterol absorption 7 (mouse) Not determined 5 95233214 129233330 Mouse 11528550 Sluc33_m susceptibility to lung cancer 33 (mouse) 5 104386871 120711986 Mouse 1357662 Lprq4_m lipoprotein QTL 4 (mouse) Not determined 5 114021753 129632606 Mouse 4142064 Tmc1m4_m Tmc1 modifier 4 (mouse) Not determined 5 54500177 127001072 Mouse 10412239 Alpq7_m alcohol preference QTL 7 (mouse) Not determined 5 104705939 138705939 Mouse 1300801 Drb2_m dopamine receptor binding 2 (mouse) Not determined 5 87386871 121387065 Mouse 9587780 Afw16_m abdominal fat weight QTL 16 (mouse) Not determined 5 92830166 126830285 Mouse 1357644 Egrd1_m early growth rate, direct effect 1 (mouse) Not determined 5 95434580 129434786 Mouse 12859290 Criq2_m Citrobacter rodentium infection QTL 2 (mouse) 5 101332579 135332579 Mouse 1300940 Actd3_m activity-distance traveled 3 (mouse) Not determined 5 96320385 130320533 Mouse 1301362 Prnr1_m prion resistance 1 (mouse) Not determined 5 89418876 146787935 Mouse 1558774 Lith17_m lithogenic gene 17 (mouse) Not determined 5 95465549 129465722 Mouse 1357431 Cia27_m collagen induced arthritis 27 (mouse) Not determined 5 75315348 120018629 Mouse 1301624 Aevm2_m autoimmune extremity vasculitis in MRL mice 2 (mouse) Not determined 5 101863832 135864028 Mouse 10043890 Trigq4_m triglyceride QTL 4 (mouse) Not determined 5 107906299 141906412 Mouse 4141652 Mrdq2_m modifier of retinal degeneration QTL 2 (mouse) Not determined 110253106 118093673 Mouse 4141139 Hmtb4_m hemostasis and thrombosis rebleeding time 4 (mouse) Not determined 108762509 126882944 Mouse 11532736 Sluc33b_m susceptibility to lung cancer 33b (mouse) 5 102945037 136945196 Mouse 4141519 Hmtb5_m hemostasis and thrombosis bleeding time 5 (mouse) Not determined 99949422 126882944 Mouse 1301858 Smdq1_m segregation of mitochondrial DNA QTL 1 (mouse) Not determined 5 97021753 131021986 Mouse 11049562 Lmr24f_m leishmaniasis resistance 24f (mouse) 5 90320962 124321041 Mouse 13464251 Ahl21_m age related hearing loss, early onset 21 (mouse) 5 109167240 143167381 Mouse 13464244 Ahl19_m age related hearing loss, early onset 19 (mouse) 5 95465549 129465722 Mouse 1300968 Skts4_m skin tumor susceptibility 4 (mouse) Not determined 5 89418876 124238239 Mouse 13464241 Ahl18_m age related hearing loss, early onset 18 (mouse) 5 87386871 121387065 Mouse 1301102 Cia14_m collagen induced arthritis 14 (mouse) Not determined 5 113320385 138555455 Mouse 13464243 Ahl20_m age related hearing loss, early onset 20 (mouse) 5 107906299 141906412 Mouse 13464242 Ahl17_m age related hearing loss, early onset 17 (mouse) 5 82838468 116838597 Mouse
AU046136
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 114,805,518 - 114,805,699 UniSTS GRCm38 MGSCv37 5 115,255,527 - 115,255,708 UniSTS GRCm37 Celera 5 111,903,692 - 111,903,873 UniSTS Cytogenetic Map 5 F UniSTS Whitehead/MRC_RH 5 1383.51 UniSTS
AU047752
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 114,775,596 - 114,775,673 UniSTS GRCm38 MGSCv37 5 115,225,605 - 115,225,682 UniSTS GRCm37 Celera 5 111,873,802 - 111,873,879 UniSTS Cytogenetic Map 5 F UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000102578 ⟹ ENSMUSP00000099638
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 114,912,738 - 114,943,883 (+) Ensembl GRCm38.p6 Ensembl 5 114,774,677 - 114,805,822 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000129001
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 114,933,804 - 114,944,261 (+) Ensembl GRCm38.p6 Ensembl 5 114,795,743 - 114,806,200 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000131803
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 114,937,518 - 114,944,261 (+) Ensembl GRCm38.p6 Ensembl 5 114,799,457 - 114,806,200 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000137519 ⟹ ENSMUSP00000116994
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 114,924,106 - 114,941,672 (+) Ensembl GRCm38.p6 Ensembl 5 114,786,045 - 114,803,611 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000140604
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 114,913,006 - 114,944,261 (+) Ensembl GRCm38.p6 Ensembl 5 114,774,945 - 114,806,200 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000200704
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 114,937,632 - 114,939,624 (+) Ensembl GRCm38.p6 Ensembl 5 114,799,571 - 114,801,563 (+) Ensembl
RefSeq Acc Id:
NM_001378897 ⟹ NP_001365826
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 114,913,009 - 114,943,882 (+) NCBI GRCm38 5 114,774,948 - 114,805,821 (+) NCBI
Sequence:
AGTCGGTTCGCGAGCTGTCAGCGCGGGCGCGAGCGCGCGGGGCGCGGGGTGGGCGCGGCCGAGCGGGTCCCCGAGCCGGTCCCCAGCCCGGCCCGCGACCCCAGGCCTGCCGCGCCGCCCGCTCCGGA
hide sequence
RefSeq Acc Id:
NM_026718 ⟹ NP_080994
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 114,913,201 - 114,943,882 (+) NCBI GRCm38 5 114,775,140 - 114,805,821 (+) NCBI MGSCv37 5 115,225,149 - 115,255,830 (+) RGD Celera 5 111,873,346 - 111,903,995 (+) RGD cM Map 5 ENTREZGENE
Sequence:
CTCCGGCCGGTCGGGCGGGCCCCCGAGACCCCGTCGGGTCCAGGCTGGTGGCAGGCGGGCGGTCAGGCCCGGGTGGCGGCCTCCTCGCCATGTCCTCGGCCCGCGACACCAGCAGCCGCTTCCCGCTG
hide sequence
RefSeq Acc Id:
NP_080994 ⟸ NM_026718
- Peptide Label:
isoform 1
- UniProtKB:
Q2VPQ7 (UniProtKB/Swiss-Prot), Q6P7F2 (UniProtKB/Swiss-Prot), Q80UP5 (UniProtKB/Swiss-Prot), Q3U0V3 (UniProtKB/TrEMBL)
- Sequence:
MSSARDTSSRFPLHLLVWNNDYEQLEKELRDQNAEALDPRGRTLLHLAVSLGHLESARVLLRHKADVTKENGQGWTVLHEAVSTGDPEMVYTVLQHRDYHNTSMALEGVPELLHKILEAPDFYVQMKW
hide sequence
RefSeq Acc Id:
NP_001365826 ⟸ NM_001378897
- Peptide Label:
isoform 2
- UniProtKB:
Q3U0V3 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000116994 ⟸ ENSMUST00000137519
Ensembl Acc Id:
ENSMUSP00000099638 ⟸ ENSMUST00000102578
RGD ID: 6837079 Promoter ID: MM_KWN:43573 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000034604, OTTMUST00000034605 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 115,223,696 - 115,225,022 (+) MPROMDB
RGD ID: 6837081 Promoter ID: MM_KWN:43575 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Lung, Spleen Transcripts: OTTMUST00000034612 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 115,234,946 - 115,235,446 (+) MPROMDB
RGD ID: 6837083 Promoter ID: MM_KWN:43576 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_4Hour, Spleen Transcripts: UC008ZAG.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 115,236,266 - 115,236,872 (+) MPROMDB
RGD ID: 6837078 Promoter ID: MM_KWN:43577 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lung Transcripts: OTTMUST00000034606 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 115,244,811 - 115,245,311 (+) MPROMDB
RGD ID: 6837080 Promoter ID: MM_KWN:43578 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Kidney Transcripts: OTTMUST00000034607 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 115,249,024 - 115,249,524 (+) MPROMDB
