Symbol:
Pid1
Name:
phosphotyrosine interaction domain containing 1
RGD ID:
1616664
MGI Page
MGI
Description:
Involved in several processes, including cellular response to cytokine stimulus; negative regulation of D-glucose import; and positive regulation of ATP biosynthetic process. Located in cytoplasm. Is expressed in genitourinary system and retina. Orthologous to human PID1 (phosphotyrosine interaction domain containing 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
5033414K04Rik; MGC90850; NYGGF4; P-CLI1; phosphotyrosine interaction domain-containing protein 1; PTB-containing, cubilin and LRP1-interacting protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 84,014,014 - 84,317,550 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 84,014,017 - 84,341,901 (-) Ensembl GRCm39 Ensembl GRCm38 1 84,036,293 - 84,339,842 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 84,036,296 - 84,364,180 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 84,032,868 - 84,281,220 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 83,915,325 - 84,163,616 (-) NCBI MGSCv36 mm8 Celera 1 84,096,465 - 84,343,985 (-) NCBI Celera Cytogenetic Map 1 C5 NCBI cM Map 1 43.14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pid1 Mouse (+)-schisandrin B multiple interactions ISO Pid1 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PID1 mRNA] CTD PMID:31150632 Pid1 Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO PID1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of PID1 mRNA CTD PMID:22079256 Pid1 Mouse 17beta-estradiol multiple interactions ISO PID1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of PID1 mRNA more ... CTD PMID:17404688 more ... Pid1 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of PID1 mRNA CTD PMID:39298647 Pid1 Mouse 17beta-estradiol affects expression ISO PID1 (Homo sapiens) 6480464 Estradiol affects the expression of PID1 mRNA CTD PMID:22574217 Pid1 Mouse 2,2',5,5'-tetrachlorobiphenyl increases expression ISO PID1 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Pid1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PID1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PID1 mRNA CTD PMID:11489354 Pid1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pid1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PID1 mRNA CTD PMID:33387578 and PMID:34747641 Pid1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pid1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PID1 mRNA CTD PMID:32109520 Pid1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pid1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of PID1 mRNA CTD PMID:22298810 Pid1 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2 more ... CTD PMID:38648751 Pid1 Mouse 2-methoxyethanol increases expression ISO Pid1 (Rattus norvegicus) 6480464 methyl cellosolve results in increased expression of PID1 mRNA CTD PMID:21061450 Pid1 Mouse 2-palmitoylglycerol increases expression ISO PID1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of PID1 mRNA CTD PMID:37199045 Pid1 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PID1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PID1 mRNA CTD PMID:28628672 Pid1 Mouse 4-aminosalicylic acid increases expression ISO PID1 (Homo sapiens) 6480464 Aminosalicylic Acid results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of PID1 mRNA CTD PMID:28973697 Pid1 Mouse 6-propyl-2-thiouracil decreases expression ISO Pid1 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of PID1 mRNA CTD PMID:25825206 and PMID:30047161 Pid1 Mouse 8-Br-cAMP increases expression ISO PID1 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of PID1 mRNA CTD PMID:20147733 Pid1 Mouse acetamide decreases expression ISO Pid1 (Rattus norvegicus) 6480464 acetamide results in decreased expression of PID1 mRNA CTD PMID:31881176 Pid1 Mouse aflatoxin B1 affects expression ISO PID1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of PID1 protein CTD PMID:20106945 Pid1 Mouse aflatoxin B1 decreases methylation ISO PID1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PID1 gene and Aflatoxin B1 results in decreased methylation of PID1 intron CTD PMID:27153756 and PMID:30157460 Pid1 Mouse aflatoxin B1 decreases expression ISO PID1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of PID1 mRNA CTD PMID:22100608 Pid1 Mouse aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of PID1 mRNA CTD PMID:19770486 Pid1 Mouse alatrofloxacin increases expression ISO PID1 (Homo sapiens) 6480464 alatrofloxacin results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse albuterol increases expression ISO PID1 (Homo sapiens) 6480464 Albuterol results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse alpha-Zearalanol multiple interactions ISO Pid1 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of PID1 mRNA CTD PMID:35163327 Pid1 Mouse alpidem decreases expression ISO PID1 (Homo sapiens) 6480464 alpidem results in decreased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse amikacin increases expression ISO PID1 (Homo sapiens) 6480464 Amikacin results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse amitrole decreases expression ISO Pid1 (Rattus norvegicus) 6480464 Amitrole results in decreased expression of PID1 mRNA CTD PMID:30047161 Pid1 Mouse amodiaquine increases expression ISO PID1 (Homo sapiens) 6480464 Amodiaquine results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse aristolochic acid A decreases expression ISO PID1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PID1 mRNA CTD PMID:33212167 Pid1 Mouse arsane multiple interactions ISO PID1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of PID1 mRNA CTD PMID:32525701 Pid1 Mouse arsenic atom multiple interactions ISO PID1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of PID1 mRNA CTD PMID:32525701 Pid1 Mouse benzatropine increases expression ISO PID1 (Homo sapiens) 6480464 Benztropine results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of PID1 mRNA CTD PMID:19770486 Pid1 Mouse benzo[a]pyrene decreases expression ISO PID1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PID1 mRNA CTD PMID:32234424 Pid1 Mouse benzo[a]pyrene affects methylation ISO PID1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PID1 intron CTD PMID:30157460 Pid1 Mouse benzo[a]pyrene increases methylation ISO PID1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PID1 5' UTR CTD PMID:27901495 Pid1 Mouse benzo[e]pyrene decreases methylation ISO PID1 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of PID1 intron CTD PMID:30157460 Pid1 Mouse biperiden increases expression ISO PID1 (Homo sapiens) 6480464 Biperiden results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse bis(2-ethylhexyl) phthalate increases expression ISO PID1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of PID1 mRNA CTD PMID:31163220 Pid1 Mouse bisphenol A decreases expression ISO Pid1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of PID1 mRNA CTD PMID:25181051 and PMID:30816183 Pid1 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PID1 mRNA CTD PMID:35479511 Pid1 Mouse bisphenol A decreases methylation ISO PID1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PID1 gene CTD PMID:31601247 Pid1 Mouse bisphenol A multiple interactions ISO PID1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PID1 mRNA CTD PMID:28628672 Pid1 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of PID1 mRNA CTD PMID:38685157 Pid1 Mouse butanal increases expression ISO PID1 (Homo sapiens) 6480464 butyraldehyde results in increased expression of PID1 mRNA CTD PMID:26079696 Pid1 Mouse cadmium dichloride decreases expression ISO PID1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PID1 mRNA CTD PMID:38568856 Pid1 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Pid1 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25620056 Pid1 Mouse cisplatin increases expression ISO PID1 (Homo sapiens) 6480464 Cisplatin results in increased expression of PID1 mRNA CTD PMID:27392435 Pid1 Mouse copper(II) chloride increases expression ISO PID1 (Homo sapiens) 6480464 cupric chloride results in increased expression of PID1 mRNA CTD PMID:38568856 Pid1 Mouse crocidolite asbestos affects expression ISO PID1 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of PID1 mRNA CTD PMID:24160326 and PMID:25757056 Pid1 Mouse crocidolite asbestos decreases expression EXP 6480464 Asbestos and Crocidolite results in decreased expression of PID1 mRNA CTD PMID:29279043 Pid1 Mouse cyclosporin A decreases expression ISO PID1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PID1 mRNA CTD PMID:20106945 Pid1 Mouse dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of PID1 CTD PMID:22733784 Pid1 Mouse dexamethasone multiple interactions ISO PID1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PID1 mRNA CTD PMID:28628672 Pid1 Mouse diazinon increases methylation ISO PID1 (Homo sapiens) 6480464 Diazinon results in increased methylation of PID1 gene CTD PMID:22964155 Pid1 Mouse dibenz[a,h]anthracene decreases expression EXP 6480464 1 more ... CTD PMID:26377693 Pid1 Mouse Dibutyl phosphate affects expression ISO PID1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PID1 mRNA CTD PMID:37042841 Pid1 Mouse diclofenac increases expression ISO PID1 (Homo sapiens) 6480464 Diclofenac results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse diisononyl phthalate decreases expression EXP 6480464 diisononyl phthalate results in decreased expression of PID1 mRNA CTD PMID:31546122 Pid1 Mouse disodium selenite increases expression ISO PID1 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of PID1 mRNA CTD PMID:24383545 Pid1 Mouse dorsomorphin multiple interactions ISO PID1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pid1 Mouse doxorubicin decreases expression ISO PID1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PID1 mRNA CTD PMID:29803840 Pid1 Mouse endosulfan decreases expression ISO Pid1 (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of PID1 mRNA CTD PMID:29391264 Pid1 Mouse entacapone decreases expression ISO PID1 (Homo sapiens) 6480464 entacapone results in decreased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse entinostat increases expression ISO PID1 (Homo sapiens) 6480464 entinostat results in increased expression of PID1 mRNA CTD PMID:26272509 Pid1 Mouse entinostat multiple interactions ISO PID1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PID1 mRNA CTD PMID:27188386 Pid1 Mouse epoxiconazole increases expression EXP 6480464 epoxiconazole results in increased expression of PID1 mRNA CTD PMID:35436446 Pid1 Mouse esmolol increases expression ISO PID1 (Homo sapiens) 6480464 esmolol results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse ethambutol increases expression ISO PID1 (Homo sapiens) 6480464 Ethambutol results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse ethanol multiple interactions EXP 6480464 Ethanol affects the expression of and affects the splicing of PID1 mRNA CTD PMID:30319688 Pid1 Mouse etodolac increases expression ISO PID1 (Homo sapiens) 6480464 Etodolac results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse fenthion decreases expression EXP 6480464 Fenthion results in decreased expression of PID1 mRNA CTD PMID:34813904 Pid1 Mouse Fexofenadine hydrochloride increases expression ISO PID1 (Homo sapiens) 6480464 fexofenadine results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse fludrocortisone increases expression ISO PID1 (Homo sapiens) 6480464 Fludrocortisone results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse flutamide increases expression ISO PID1 (Homo sapiens) 6480464 Flutamide results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse folic acid increases expression ISO PID1 (Homo sapiens) 6480464 Folic Acid results in increased expression of PID1 mRNA CTD PMID:21867686 Pid1 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of PID1 mRNA CTD PMID:25629700 Pid1 Mouse furan decreases expression ISO Pid1 (Rattus norvegicus) 6480464 furan results in decreased expression of PID1 mRNA CTD PMID:25539665 Pid1 Mouse gentamycin increases expression ISO Pid1 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of PID1 mRNA CTD PMID:33387578 Pid1 Mouse GW 4064 decreases expression EXP 6480464 GW 4064 results in decreased expression of PID1 mRNA CTD PMID:26655953 Pid1 Mouse hydroxyzine increases expression ISO PID1 (Homo sapiens) 6480464 Hydroxyzine results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse indometacin multiple interactions ISO PID1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PID1 mRNA CTD PMID:28628672 Pid1 Mouse Iproniazid increases expression ISO PID1 (Homo sapiens) 6480464 Iproniazid results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse isoniazide increases expression ISO PID1 (Homo sapiens) 6480464 Isoniazid results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse levofloxacin increases expression ISO Pid1 (Rattus norvegicus) 6480464 Levofloxacin results in increased expression of PID1 mRNA CTD PMID:24136188 Pid1 Mouse levofloxacin decreases expression ISO PID1 (Homo sapiens) 6480464 Levofloxacin results in decreased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse lipopolysaccharide multiple interactions ISO PID1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Pid1 Mouse mebendazole increases expression ISO PID1 (Homo sapiens) 6480464 Mebendazole results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse metaproterenol increases expression ISO PID1 (Homo sapiens) 6480464 Metaproterenol results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse methapyrilene decreases methylation ISO PID1 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of PID1 intron CTD PMID:30157460 Pid1 Mouse methylmercury chloride increases expression ISO PID1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of PID1 mRNA CTD PMID:28001369 Pid1 Mouse mono(2-ethylhexyl) phthalate increases expression ISO PID1 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of PID1 mRNA CTD PMID:36695872 Pid1 Mouse nefazodone increases expression ISO PID1 (Homo sapiens) 6480464 nefazodone results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse nevirapine increases expression ISO PID1 (Homo sapiens) 6480464 Nevirapine results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse nomifensine increases expression ISO PID1 (Homo sapiens) 6480464 Nomifensine results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse O-methyleugenol decreases expression ISO PID1 (Homo sapiens) 6480464 methyleugenol results in decreased expression of PID1 mRNA CTD PMID:32234424 Pid1 Mouse orciprenaline increases expression ISO PID1 (Homo sapiens) 6480464 Metaproterenol results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of PID1 mRNA CTD PMID:34911549 Pid1 Mouse ozone multiple interactions ISO Pid1 (Rattus norvegicus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of PID1 mRNA CTD PMID:37871705 Pid1 Mouse panobinostat multiple interactions ISO PID1 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PID1 mRNA CTD PMID:27188386 Pid1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of PID1 mRNA CTD PMID:17562736 Pid1 Mouse paracetamol increases expression ISO Pid1 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of PID1 mRNA CTD PMID:33387578 Pid1 Mouse parathion decreases expression EXP 6480464 Parathion results in decreased expression of PID1 mRNA CTD PMID:34813904 Pid1 Mouse penbutolol increases expression ISO PID1 (Homo sapiens) 6480464 Penbutolol results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse pentanal increases expression ISO PID1 (Homo sapiens) 6480464 pentanal results in increased expression of PID1 mRNA CTD PMID:26079696 Pid1 Mouse perfluorononanoic acid decreases expression ISO PID1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of PID1 mRNA CTD PMID:32588087 Pid1 Mouse perfluorooctane-1-sulfonic acid decreases expression ISO PID1 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of PID1 mRNA CTD PMID:32588087 and PMID:38568856 Pid1 Mouse perfluorooctanoic acid multiple interactions ISO Pid1 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of PID1 mRNA CTD PMID:35163327 Pid1 Mouse perfluorooctanoic acid decreases expression ISO PID1 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of PID1 mRNA CTD PMID:32588087 Pid1 Mouse permethrin increases expression ISO PID1 (Homo sapiens) 6480464 Permethrin results in increased expression of PID1 mRNA CTD PMID:37047231 Pid1 Mouse pioglitazone increases expression ISO PID1 (Homo sapiens) 6480464 Pioglitazone results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of PID1 mRNA CTD PMID:19710929 Pid1 Mouse pirprofen increases expression ISO PID1 (Homo sapiens) 6480464 pirprofen results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse potassium chromate increases expression ISO PID1 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of PID1 mRNA CTD PMID:22079256 Pid1 Mouse potassium chromate multiple interactions ISO PID1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of PID1 mRNA CTD PMID:22079256 Pid1 Mouse procyclidine increases expression ISO PID1 (Homo sapiens) 6480464 Procyclidine results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse progesterone multiple interactions ISO PID1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of PID1 mRNA and [Progesterone co-treated with Estradiol] results in increased expression of PID1 mRNA CTD PMID:17404688 and PMID:20660070 Pid1 Mouse progesterone increases expression ISO PID1 (Homo sapiens) 6480464 Progesterone results in increased expression of PID1 mRNA CTD PMID:17404688 Pid1 Mouse promethazine increases expression ISO PID1 (Homo sapiens) 6480464 Promethazine results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse propanal increases expression ISO PID1 (Homo sapiens) 6480464 propionaldehyde results in increased expression of PID1 mRNA CTD PMID:26079696 Pid1 Mouse protein kinase inhibitor multiple interactions ISO PID1 (Homo sapiens) 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in decreased expression of PID1 mRNA] CTD PMID:28003376 Pid1 Mouse protriptyline increases expression ISO PID1 (Homo sapiens) 6480464 Protriptyline results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse rotenone increases expression ISO PID1 (Homo sapiens) 6480464 Rotenone results in increased expression of PID1 mRNA CTD PMID:29955902 Pid1 Mouse S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO PID1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of PID1 mRNA CTD PMID:35811015 Pid1 Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO PID1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Pid1 Mouse SB 431542 multiple interactions ISO PID1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pid1 Mouse senecionine decreases expression EXP 6480464 senecionine results in decreased expression of PID1 protein CTD PMID:35357534 Pid1 Mouse serpentine asbestos affects expression ISO PID1 (Homo sapiens) 6480464 Asbestos and Serpentine affects the expression of PID1 mRNA CTD PMID:24160326 Pid1 Mouse silver atom decreases expression EXP 6480464 Silver results in decreased expression of PID1 mRNA CTD PMID:27131904 Pid1 Mouse silver(0) decreases expression EXP 6480464 Silver results in decreased expression of PID1 mRNA CTD PMID:27131904 Pid1 Mouse sodium arsenate multiple interactions ISO PID1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of PID1 mRNA CTD PMID:32525701 Pid1 Mouse sodium arsenite decreases expression ISO PID1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PID1 mRNA CTD PMID:29301061 and PMID:38568856 Pid1 Mouse sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of PID1 mRNA CTD PMID:37682722 Pid1 Mouse sulfadimethoxine decreases expression ISO Pid1 (Rattus norvegicus) 6480464 Sulfadimethoxine results in decreased expression of PID1 mRNA CTD PMID:30047161 Pid1 Mouse tacrolimus hydrate increases expression EXP 6480464 Tacrolimus results in increased expression of PID1 mRNA CTD PMID:29362864 Pid1 Mouse temozolomide decreases expression ISO PID1 (Homo sapiens) 6480464 Temozolomide results in decreased expression of PID1 mRNA CTD PMID:31758290 Pid1 Mouse tert-butyl hydroperoxide increases expression ISO PID1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of PID1 mRNA CTD PMID:15336504 Pid1 Mouse tetrachloromethane multiple interactions ISO Pid1 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PID1 mRNA] CTD PMID:31150632 Pid1 Mouse tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PID1 mRNA CTD PMID:31919559 Pid1 Mouse tetrachloromethane decreases expression ISO Pid1 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of PID1 mRNA CTD PMID:31150632 Pid1 Mouse tetraphene increases expression EXP 6480464 benz(a)anthracene results in increased expression of PID1 mRNA CTD PMID:26377693 Pid1 Mouse thiram decreases expression ISO PID1 (Homo sapiens) 6480464 Thiram results in decreased expression of PID1 mRNA CTD PMID:38568856 Pid1 Mouse trazodone increases expression ISO PID1 (Homo sapiens) 6480464 Trazodone results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse trichostatin A increases expression ISO PID1 (Homo sapiens) 6480464 trichostatin A results in increased expression of PID1 mRNA CTD PMID:24935251 Pid1 Mouse Trihexyphenidyl increases expression ISO PID1 (Homo sapiens) 6480464 Trihexyphenidyl results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse triphenyl phosphate affects expression ISO PID1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PID1 mRNA CTD PMID:37042841 Pid1 Mouse troglitazone increases expression ISO PID1 (Homo sapiens) 6480464 Troglitazone results in increased expression of PID1 mRNA CTD PMID:32816093 Pid1 Mouse valproic acid affects expression ISO PID1 (Homo sapiens) 6480464 Valproic Acid affects the expression of PID1 mRNA CTD PMID:25979313 Pid1 Mouse valproic acid increases expression ISO PID1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PID1 mRNA CTD PMID:24383497 more ... Pid1 Mouse zafirlukast increases expression ISO PID1 (Homo sapiens) 6480464 zafirlukast results in increased expression of PID1 mRNA CTD PMID:32816093
(+)-schisandrin B (ISO) (-)-epigallocatechin 3-gallate (ISO) 17beta-estradiol (EXP,ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2-methoxyethanol (ISO) 2-palmitoylglycerol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4-aminosalicylic acid (ISO) 4-hydroxyphenyl retinamide (EXP) 6-propyl-2-thiouracil (ISO) 8-Br-cAMP (ISO) acetamide (ISO) aflatoxin B1 (EXP,ISO) alatrofloxacin (ISO) albuterol (ISO) alpha-Zearalanol (ISO) alpidem (ISO) amikacin (ISO) amitrole (ISO) amodiaquine (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzatropine (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) biperiden (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) butanal (ISO) cadmium dichloride (ISO) carbon nanotube (EXP) cisplatin (ISO) copper(II) chloride (ISO) crocidolite asbestos (EXP,ISO) cyclosporin A (ISO) dexamethasone (EXP,ISO) diazinon (ISO) dibenz[a,h]anthracene (EXP) Dibutyl phosphate (ISO) diclofenac (ISO) diisononyl phthalate (EXP) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (ISO) entacapone (ISO) entinostat (ISO) epoxiconazole (EXP) esmolol (ISO) ethambutol (ISO) ethanol (EXP) etodolac (ISO) fenthion (EXP) Fexofenadine hydrochloride (ISO) fludrocortisone (ISO) flutamide (ISO) folic acid (EXP,ISO) furan (ISO) gentamycin (ISO) GW 4064 (EXP) hydroxyzine (ISO) indometacin (ISO) Iproniazid (ISO) isoniazide (ISO) levofloxacin (ISO) lipopolysaccharide (ISO) mebendazole (ISO) metaproterenol (ISO) methapyrilene (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) nefazodone (ISO) nevirapine (ISO) nomifensine (ISO) O-methyleugenol (ISO) orciprenaline (ISO) ozone (EXP,ISO) panobinostat (ISO) paracetamol (EXP,ISO) parathion (EXP) penbutolol (ISO) pentanal (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) permethrin (ISO) pioglitazone (ISO) pirinixic acid (EXP) pirprofen (ISO) potassium chromate (ISO) procyclidine (ISO) progesterone (ISO) promethazine (ISO) propanal (ISO) protein kinase inhibitor (ISO) protriptyline (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) senecionine (EXP) serpentine asbestos (ISO) silver atom (EXP) silver(0) (EXP) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sulfadimethoxine (ISO) tacrolimus hydrate (EXP) temozolomide (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) tetraphene (EXP) thiram (ISO) trazodone (ISO) trichostatin A (ISO) Trihexyphenidyl (ISO) triphenyl phosphate (ISO) troglitazone (ISO) valproic acid (ISO) zafirlukast (ISO)
Biological Process
cellular response to cytokine stimulus (IDA) cellular response to fatty acid (IDA) cellular response to interleukin-6 (IDA) cellular response to leptin stimulus (IDA) cellular response to tumor necrosis factor (IDA) fat cell differentiation (ISO) mitochondrion organization (IEA,ISO) negative regulation of ATP biosynthetic process (IEA,ISO) negative regulation of D-glucose import (IBA,IMP,ISO) negative regulation of insulin receptor signaling pathway (IEA,ISO) negative regulation of protein localization to plasma membrane (IEA,ISO) negative regulation of protein phosphorylation (ISO) positive regulation of ATP biosynthetic process (IMP) positive regulation of fat cell proliferation (IEA,ISO) positive regulation of gene expression (IEA,ISO) positive regulation of reactive oxygen species metabolic process (IEA,ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO) regulation of mitochondrial membrane potential (IMP) regulation of reactive oxygen species metabolic process (IBA,IMP)
Pid1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 84,014,014 - 84,317,550 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 84,014,017 - 84,341,901 (-) Ensembl GRCm39 Ensembl GRCm38 1 84,036,293 - 84,339,842 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 84,036,296 - 84,364,180 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 84,032,868 - 84,281,220 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 83,915,325 - 84,163,616 (-) NCBI MGSCv36 mm8 Celera 1 84,096,465 - 84,343,985 (-) NCBI Celera Cytogenetic Map 1 C5 NCBI cM Map 1 43.14 NCBI
PID1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 229,023,973 - 229,271,287 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 228,850,526 - 229,271,287 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 229,888,689 - 230,136,003 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 229,596,933 - 229,844,301 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 2 223,664,258 - 223,911,580 (-) NCBI Celera Cytogenetic Map 2 q36.3 NCBI HuRef 2 221,730,137 - 221,977,045 (-) NCBI HuRef CHM1_1 2 229,894,849 - 230,141,840 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 229,506,578 - 229,753,882 (-) NCBI T2T-CHM13v2.0
Pid1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 92,732,471 - 92,951,168 (-) NCBI GRCr8 mRatBN7.2 9 85,284,335 - 85,503,035 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 85,284,335 - 85,503,044 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 93,711,730 - 93,931,323 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 98,840,254 - 99,059,827 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 97,227,160 - 97,454,126 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 91,667,748 - 91,683,468 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 91,665,986 - 91,882,927 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 91,403,609 - 91,419,329 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 83,412,797 - 83,429,039 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 9 82,716,587 - 82,732,827 (-) NCBI Celera Cytogenetic Map 9 q35 NCBI
Pid1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955453 5,680,211 - 5,911,589 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955453 5,680,418 - 5,913,236 (+) NCBI ChiLan1.0 ChiLan1.0
PID1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 131,096,877 - 131,892,315 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 131,111,847 - 131,907,249 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 116,265,529 - 116,517,557 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 235,071,888 - 235,317,332 (-) NCBI panpan1.1 PanPan1.1 panPan2
PID1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 41,424,307 - 41,649,736 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 41,425,811 - 41,652,672 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 42,048,042 - 42,273,688 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 41,678,727 - 41,905,113 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 41,678,745 - 41,907,940 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 41,607,636 - 41,823,824 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 41,449,548 - 41,675,112 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 41,622,258 - 41,848,314 (-) NCBI UU_Cfam_GSD_1.0
Pid1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 183,602,535 - 183,824,866 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936525 7,114,849 - 7,337,185 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936525 7,114,856 - 7,337,179 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PID1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 130,075,143 - 130,332,698 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 130,080,821 - 130,215,548 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 144,255,953 - 144,256,107 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PID1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 115,012,225 - 115,268,843 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 115,012,168 - 115,268,884 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 84,166,699 - 84,420,555 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pid1
.
Predicted Target Of
Count of predictions: 1523 Count of miRNA genes: 702 Interacting mature miRNAs: 859 Transcripts: ENSMUST00000168574, ENSMUST00000175948, ENSMUST00000175996, ENSMUST00000176559, ENSMUST00000176720, ENSMUST00000176822, ENSMUST00000177458 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 1357847 Jckm2_m juvenile cystic kidney modifier 2 (mouse) Not determined 1 74991977 133290937 Mouse 4142394 Mssq1_m mandible size and shape QTL 1 (mouse) Not determined 73615692 107615830 Mouse 4141625 Emo4_m emotionality 4 (mouse) Not determined 68071345 86235027 Mouse 10412185 Hcs9_m hepatocarcinogenesis susceptibility 9 (mouse) Not determined 1 63854690 189303617 Mouse 1558928 Mord2_m modifier of retinal degeneration 2 (mouse) Not determined 1 77123115 110536075 Mouse 25394564 Skmw49_m skeletal muscle weight 49, TA (mouse) 1 83420119 88552630 Mouse 13824984 Twq5_m testis weight QTL 5 (mouse) 1 3069992 184732197 Mouse 14697706 Stsl3a_m Salmonella typhimurium susceptibility locus 3a (mouse) 1 77476637 95827725 Mouse 1357721 Sle17_m systematic lupus erythematosus susceptibility 17 (mouse) Not determined 1 39132808 126445310 Mouse 1302146 Cocrb1_m cocaine related behavior 1 (mouse) Not determined 1 70133533 104139557 Mouse 14696691 Malq1_m mean attack latency QTL 1 (mouse) 1 77976637 87927722 Mouse 14696692 Tavq1_m total attack value QTL 1 (mouse) 1 81977715 88427722 Mouse 14696693 Avd2q1_m attack value day 2 QTL 1 (mouse) 1 78977717 90927722 Mouse 14746998 Mancz1_m mandible centroid size 1 (mouse) 1 57941351 91941351 Mouse 1300746 Skl1_m skeletal size (tail length) 1 (mouse) Not determined 1 57991977 91992080 Mouse 1302029 Sst1_m susceptibility to tuberculosis 1 (mouse) Not determined 1 81652114 87130822 Mouse 12791004 Aath7_m aortic arch atherosclerosis 7 (mouse) 1 82832635 116832635 Mouse 4141725 Wbcq4_m white blood cell quantitative locus 4 (mouse) Not determined 1 79858683 113858791 Mouse 12050069 Nabq1_m nasal bone morphology QTL 1 (mouse) 1 79858683 113858791 Mouse 1357488 Splq3_m spleen weight QTL 3 (mouse) Not determined 1 34760138 150193871 Mouse 10043965 Obq24_m obesity QTL 24 (mouse) Not determined 1 50890216 84890216 Mouse 13452395 Leusq2_m leucocytosis susceptibility QTL 2 (mouse) 1 80245593 126386517 Mouse 1558717 Ses1a_m salmonella enteritidis susceptibility 1a (mouse) Not determined 1 56726922 90727077 Mouse 1301304 Hrq3_m heart rate quantitative locus 3 (mouse) Not determined 1 73615692 107615830 Mouse 1357753 Kidq2_m kidney weight QTL 2 (mouse) Not determined 1 34760138 150193871 Mouse 1301667 Lxw5_m lupus BXSB x NZW 5 (mouse) Not determined 1 58549191 92549443 Mouse 1357741 Nidd5k_m Nidd5 on KK-A<y> (mouse) Not determined 1 55974948 89975057 Mouse 1301162 Skull1_m skull morphology 1 (mouse) Not determined 1 57991977 91992080 Mouse 4142467 Wbcq1_m white blood cell quantitative locus 1 (mouse) Not determined 1 56266214 90266360 Mouse 1301933 Insq6_m insulin QTL 6 (mouse) Not determined 1 56726922 90727077 Mouse 4141305 Tgq9_m triglyceride QTL 9 (mouse) Not determined 51421605 85421605 Mouse 1300821 Lore1_m loss of righting induced by ethanol 1 (mouse) Not determined 1 75549191 92941077 Mouse 1301722 Cia9_m collagen induced arthritis QTL 9 (mouse) Not determined 1 45783900 189303617 Mouse 10412238 Alpq5_m alcohol preference QTL 5 (mouse) Not determined 1 82832635 116832635 Mouse 1357505 Vtbt1_m vertebral trabecular bone trait 1 (mouse) Not determined 1 56266214 90266360 Mouse 1301444 Alcw5_m alcohol withdrawal 5 (mouse) Not determined 1 58549191 92549443 Mouse 1558860 W10q7_m weight 10 weeks QTL 7 (mouse) Not determined 1 34760138 150193871 Mouse 14747009 Manh49_m mandible shape 49 (mouse) 1 57941351 91941351 Mouse 1300976 Bmd19_m bone mineral density 19 (mouse) Not determined 1 73266214 108838414 Mouse 4141914 Gcsfis_m G-CSF induced splenomegaly (mouse) Not determined 74516235 148715579 Mouse 27095928 Pglq6_m pelvic girdle length QTL 6, 10 week (mouse) 1 75976637 148775742 Mouse 27095931 Pglq1_m pelvic girdle length QTL 1, 5 week (mouse) 1 75976637 128527737 Mouse 1301748 Abbp1_m A/J and C57BL/6 blood pressure 1 (mouse) Not determined 1 62946755 120529678 Mouse 1357439 Popoa_m premature ovulation and primary oocyte arrest (mouse) Not determined 1 82643189 135615379 Mouse 4142291 Aec2_m autoimmune exocrinopathy 2 (mouse) Not determined 52457737 182250592 Mouse 1300989 Lrdg1_m light induced retinal degeneration 1 (mouse) Not determined 1 73755175 147125370 Mouse 27095918 Ulnl1_m ulna length 1, 5 week (mouse) 1 67339159 129727737 Mouse 1302119 Cia15_m collagen induced arthritis 15 (mouse) Not determined 1 65889006 88496101 Mouse 1301350 Nidd4k_m Nidd4 on KK-A (mouse) Not determined 7 82291982 147125370 Mouse 1300841 Ssial1_m susceptibility to sialadenitis 1 (mouse) Not determined 1 63920002 153557562 Mouse 26884448 Sklq1_m skull length QTL 1, 5 week (mouse) 1 75976637 181327565 Mouse 1357679 Egrm1_m early growth rate, maternal effect 1 (mouse) Not determined 1 57991977 91992080 Mouse
34.MMHAP70FLD4.seq
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 84,087,555 - 84,087,753 UniSTS GRCm38 MGSCv37 1 84,084,130 - 84,084,328 UniSTS GRCm37 Celera 1 84,147,873 - 84,148,071 UniSTS Cytogenetic Map 1 C5 UniSTS Whitehead_YAC 1 UniSTS
RH125466
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 84,036,892 - 84,036,986 UniSTS GRCm38 MGSCv37 1 84,033,467 - 84,033,561 UniSTS GRCm37 Celera 1 84,097,064 - 84,097,158 UniSTS Cytogenetic Map 1 C5 UniSTS
Ptrh2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 86,689,590 - 86,689,701 UniSTS GRCm38 GRCm38 1 84,168,219 - 84,168,330 UniSTS GRCm38 MGSCv37 11 86,503,092 - 86,503,203 UniSTS GRCm37 MGSCv37 1 84,164,794 - 84,164,905 UniSTS GRCm37 Celera 11 96,305,020 - 96,305,131 UniSTS Celera 1 84,227,935 - 84,228,046 UniSTS Cytogenetic Map 1 C5 UniSTS Cytogenetic Map 11 C UniSTS cM Map 11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000168574 ⟹ ENSMUSP00000127716
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 84,014,017 - 84,262,366 (-) Ensembl GRCm38.p6 Ensembl 1 84,036,296 - 84,284,645 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000175948
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 84,015,647 - 84,030,974 (-) Ensembl GRCm38.p6 Ensembl 1 84,037,926 - 84,053,253 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000175996 ⟹ ENSMUSP00000134979
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 84,085,515 - 84,341,901 (-) Ensembl GRCm38.p6 Ensembl 1 84,107,794 - 84,364,180 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000176559 ⟹ ENSMUSP00000135164
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 84,014,952 - 84,313,894 (-) Ensembl GRCm38.p6 Ensembl 1 84,037,231 - 84,336,173 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000176720 ⟹ ENSMUSP00000134961
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 84,058,300 - 84,262,144 (-) Ensembl GRCm38.p6 Ensembl 1 84,080,579 - 84,284,423 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000176822 ⟹ ENSMUSP00000135425
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 84,093,053 - 84,318,831 (-) Ensembl GRCm38.p6 Ensembl 1 84,115,332 - 84,341,110 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000177458 ⟹ ENSMUSP00000135120
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 84,134,850 - 84,262,332 (-) Ensembl GRCm38.p6 Ensembl 1 84,157,129 - 84,284,611 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000187992
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 84,260,914 - 84,262,344 (-) Ensembl GRCm38.p6 Ensembl 1 84,283,193 - 84,284,623 (-) Ensembl
RefSeq Acc Id:
NM_001003948 ⟹ NP_001003948
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 84,014,014 - 84,262,366 (-) NCBI GRCm38 1 84,036,293 - 84,284,645 (-) NCBI MGSCv37 1 84,032,868 - 84,281,220 (-) RGD Celera 1 84,096,465 - 84,343,985 (-) RGD cM Map 1 ENTREZGENE
Sequence:
AGCGGCCGCGGCGCTGGGGCCCGGGCGGAGCTGCGCAATCGTCTGAGCTGCGCACCGACTGGCGGCCGGAGCGGAGCCCACAAGTTGCCGGCAGCGGAGCGCCGCCTCGTCCCGCTCTCAGCCCTTGC
hide sequence
RefSeq Acc Id:
XM_011238717 ⟹ XP_011237019
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 84,014,017 - 84,262,405 (-) NCBI GRCm38 1 84,036,296 - 84,284,675 (-) NCBI
Sequence:
CAGACCGCGCAGGTCCGGGCGGCGGCGGGGGGAGGAGGGAGCGGCCGCGGCGCTGGGGCCCGGGCGGAGCTGCGCAATCGTCTGAGCTGCGCACCGACTGGCGGCCGGAGCGGAGCCCACAAGTTGCC
hide sequence
RefSeq Acc Id:
XM_011238718 ⟹ XP_011237020
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 84,014,017 - 84,262,405 (-) NCBI GRCm38 1 84,036,296 - 84,284,674 (-) NCBI
Sequence:
CAGACCGCGCAGGTCCGGGCGGCGGCGGGGGGAGGAGGGAGCGGCCGCGGCGCTGGGGCCCGGGCGGAGCTGCGCAATCGTCTGAGCTGCGCACCGACTGGCGGCCGGAGCGGAGCCCACAAGTTGCC
hide sequence
RefSeq Acc Id:
XM_017313047 ⟹ XP_017168536
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 84,014,017 - 84,317,550 (-) NCBI GRCm38 1 84,036,296 - 84,339,842 (-) NCBI
Sequence:
AGCAGACCCCACTTTGGACCTGGCGATCCAGAAACCCTGGAGATCAAGTCAAACAATCTGCATATGAATATGAATTCCTGTTAACTCCAGTGCACACACTTCCAGACCATGCTGAAGTCTAAGTTGAA
hide sequence
RefSeq Acc Id:
XM_036154687 ⟹ XP_036010580
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 84,014,017 - 84,287,811 (-) NCBI
Sequence:
ACATTGCTCTTCACTGTTGCATTTTAGTAGGATTTCCCAGCAGGGCATTTCCATGGAATTTAACTAGATGGAAAAACCTACTATGAACATGGATCACAGCATCACACAGCACTTCCAGACCATGCTGA
hide sequence
RefSeq Acc Id:
XM_036154689 ⟹ XP_036010582
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 84,014,017 - 84,153,280 (-) NCBI
Sequence:
TGAAGTGGGGTCACATGGACTCTTCAGTCTGGACTCAGAGAAGAATGATTGTGCCCAGGCATCCTCTTCTTCTGCAGCCAAGGACCTCAACCTAGGGTGGAGTCACTGGTGCCAGTCACTTTTAGGCA
hide sequence
RefSeq Acc Id:
XM_036154693 ⟹ XP_036010586
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 84,014,017 - 84,287,845 (-) NCBI
Sequence:
AGGGATGGAATGCTGAGCCTTCAGACAAGCTGGAACATTGCTCTTCACTGTTGCATTTTAGTAGGATTTCCCAGCAGGGCATTTCCATGGAATTTAACTAGATGGAAAAACCTACTATGAACATGGAT
hide sequence
RefSeq Acc Id:
NP_001003948 ⟸ NM_001003948
- UniProtKB:
Q68EE9 (UniProtKB/Swiss-Prot), Q3UAR0 (UniProtKB/Swiss-Prot), Q7TPS1 (UniProtKB/Swiss-Prot), Q3UBG2 (UniProtKB/Swiss-Prot)
- Sequence:
MWQPATERLQHFQTMLKSKLNVLTLKKEPIPAVLFHEPEAIELCTTTPLMKARTHSGCKVTYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGEATVHMDTF
hide sequence
RefSeq Acc Id:
XP_011237019 ⟸ XM_011238717
- Peptide Label:
isoform X1
- Sequence:
MWQPATERLQHFQTMLKSKLNVLTLKKEPIPAVLFHEPEAIELCTTTPLMKARTHSGCKGQEAGSCNPPALHLYLRSHLPSVTYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIR
hide sequence
RefSeq Acc Id:
XP_011237020 ⟸ XM_011238718
- Peptide Label:
isoform X2
- Sequence:
MWQPATERLQVTYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGEATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVQCESKLEAKK
hide sequence
RefSeq Acc Id:
XP_017168536 ⟸ XM_017313047
- Peptide Label:
isoform X4
- Sequence:
MLKSKLNVLTLKKEPIPAVLFHEPEAIELCTTTPLMKARTHSGCKGQEAGSCNPPALHLYLRSH
hide sequence
Ensembl Acc Id:
ENSMUSP00000135120 ⟸ ENSMUST00000177458
Ensembl Acc Id:
ENSMUSP00000127716 ⟸ ENSMUST00000168574
Ensembl Acc Id:
ENSMUSP00000134961 ⟸ ENSMUST00000176720
Ensembl Acc Id:
ENSMUSP00000135425 ⟸ ENSMUST00000176822
Ensembl Acc Id:
ENSMUSP00000135164 ⟸ ENSMUST00000176559
Ensembl Acc Id:
ENSMUSP00000134979 ⟸ ENSMUST00000175996
RefSeq Acc Id:
XP_036010586 ⟸ XM_036154693
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_036010580 ⟸ XM_036154687
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_036010582 ⟸ XM_036154689
- Peptide Label:
isoform X4
RGD ID: 6848941 Promoter ID: MM_XEF:232 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_4Hour Transcripts: NM_001096831 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 84,034,656 - 84,035,156 (-) MPROMDB
RGD ID: 6818253 Promoter ID: MM_KWN:1368 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Liver Transcripts: NM_001003948, UC007BSV.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 84,281,041 - 84,282,037 (-) MPROMDB
RGD ID: 6874258 Promoter ID: EPDNEW_M579 Type: initiation region Name: Pid1_1 Description: Mus musculus phosphotyrosine interaction domain containing 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M580 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 84,284,601 - 84,284,661 EPDNEW
RGD ID: 6874260 Promoter ID: EPDNEW_M580 Type: multiple initiation site Name: Pid1_2 Description: Mus musculus phosphotyrosine interaction domain containing 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M579 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 84,341,096 - 84,341,156 EPDNEW
