Advanced Search (OLGA)

Gene: A3galt2 (alpha 1,3-galactosyltransferase 2) Mus musculus

Subscribe to Updates

Analyze

Symbol:

A3galt2

Name:

alpha 1,3-galactosyltransferase 2

RGD ID:

1616578

MGI Page

MGI

Description:

Enables alpha-1,3-galactosyltransferase activity. Acts upstream of or within glycosphingolipid biosynthetic process. Predicted to be located in Golgi cisterna membrane. Predicted to be active in Golgi apparatus and vesicle. Orthologous to human A3GALT2 (alpha 1,3-galactosyltransferase 2).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

alpha 1,3-galactosyltransferase 2 (isoglobotriaosylceramide synthase); alpha-1,3-galactosyltransferase 2; galactosyltransferase; Gm433; iGb; iGb3; iGb3 synthase; iGb3S; isoglobotriaosylceramide synthase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	128,653,051 - 128,663,091 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	128,649,157 - 128,663,091 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	128,759,258 - 128,769,298 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	128,755,364 - 128,769,298 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	128,436,502 - 128,446,542 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	128,261,562 - 128,271,602 (+)	NCBI		MGSCv36	mm8
Celera	4	127,097,903 - 127,107,951 (+)	NCBI		Celera
Cytogenetic Map	4	D2.2	NCBI
cM Map	4	62.23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
A3galt2	Mouse	Charcot-Marie-Tooth disease dominant intermediate C		ISO	A3GALT2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Charcot-Marie-Tooth disease dominant intermediate C	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
A3galt2	Mouse	1,2-dichloroethane	decreases expression	EXP		6480464	ethylene dichloride results in decreased expression of A3GALT2 mRNA	CTD	PMID:28960355
A3galt2	Mouse	1-naphthyl isothiocyanate	increases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	1-Naphthylisothiocyanate results in increased expression of A3GALT2 mRNA	CTD	PMID:30723492
A3galt2	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of A3GALT2 mRNA	CTD	PMID:21570461
A3galt2	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of A3GALT2 mRNA	CTD	PMID:33387578 and PMID:34747641
A3galt2	Mouse	acetamide	increases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	acetamide results in increased expression of A3GALT2 mRNA	CTD	PMID:31881176
A3galt2	Mouse	atrazine	decreases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	Atrazine results in decreased expression of A3GALT2 mRNA	CTD	PMID:36841081
A3galt2	Mouse	beta-naphthoflavone	multiple interactions	ISO	A3galt2 (Rattus norvegicus)	6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of A3GALT2 mRNA	CTD	PMID:18164116
A3galt2	Mouse	bisphenol A	decreases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of A3GALT2 mRNA	CTD	PMID:25181051 and PMID:34947998
A3galt2	Mouse	bisphenol A	decreases methylation	EXP		6480464	bisphenol A results in decreased methylation of A3GALT2 promoter	CTD	PMID:27312807
A3galt2	Mouse	bisphenol A	increases methylation	ISO	A3galt2 (Rattus norvegicus)	6480464	bisphenol A results in increased methylation of A3GALT2 gene	CTD	PMID:28505145
A3galt2	Mouse	cadmium dichloride	increases expression	ISO	A3GALT2 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of A3GALT2 mRNA	CTD	PMID:38568856
A3galt2	Mouse	cobalt dichloride	decreases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	cobaltous chloride results in decreased expression of A3GALT2 mRNA	CTD	PMID:24386269
A3galt2	Mouse	copper atom	decreases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	Copper results in decreased expression of A3GALT2 mRNA	CTD	PMID:30556269
A3galt2	Mouse	copper(0)	decreases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	Copper results in decreased expression of A3GALT2 mRNA	CTD	PMID:30556269
A3galt2	Mouse	diuron	decreases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	Diuron results in decreased expression of A3GALT2 mRNA	CTD	PMID:21551480
A3galt2	Mouse	dopamine	increases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	Dopamine results in increased expression of A3GALT2 mRNA	CTD	PMID:21983523
A3galt2	Mouse	endosulfan	decreases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	Endosulfan results in decreased expression of A3GALT2 mRNA	CTD	PMID:29391264
A3galt2	Mouse	fenoldopam	increases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	Fenoldopam results in increased expression of A3GALT2 mRNA	CTD	PMID:21983523
A3galt2	Mouse	fenvalerate	increases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	fenvalerate results in increased expression of A3GALT2 mRNA	CTD	PMID:30307764
A3galt2	Mouse	flavonoids	increases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	Flavonoids results in increased expression of A3GALT2 mRNA	CTD	PMID:18035473
A3galt2	Mouse	furan	increases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	furan results in increased expression of A3GALT2 mRNA	CTD	PMID:27387713
A3galt2	Mouse	graphite	affects expression	ISO	A3galt2 (Rattus norvegicus)	6480464	Graphite affects the expression of A3GALT2 mRNA	CTD	PMID:29933104
A3galt2	Mouse	Muraglitazar	decreases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	muraglitazar results in decreased expression of A3GALT2 mRNA	CTD	PMID:21515302
A3galt2	Mouse	N-methyl-4-phenylpyridinium	decreases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	1-Methyl-4-phenylpyridinium results in decreased expression of A3GALT2 mRNA	CTD	PMID:28801915
A3galt2	Mouse	N-nitrosodiethylamine	multiple interactions	ISO	A3galt2 (Rattus norvegicus)	6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of A3GALT2 mRNA	CTD	PMID:18164116
A3galt2	Mouse	oxaliplatin	multiple interactions	ISO	A3galt2 (Rattus norvegicus)	6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of A3GALT2 mRNA	CTD	PMID:25729387
A3galt2	Mouse	ozone	multiple interactions	ISO	A3GALT2 (Homo sapiens)	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of A3GALT2 mRNA	CTD	PMID:35430440
A3galt2	Mouse	paracetamol	decreases expression	ISO	A3GALT2 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of A3GALT2 mRNA	CTD	PMID:22230336
A3galt2	Mouse	paracetamol	decreases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	Acetaminophen results in decreased expression of A3GALT2 mRNA	CTD	PMID:33387578
A3galt2	Mouse	resveratrol	multiple interactions	ISO	A3GALT2 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of A3GALT2 mRNA	CTD	PMID:23557933
A3galt2	Mouse	Soman	increases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	Soman results in increased expression of A3GALT2 mRNA	CTD	PMID:19281266
A3galt2	Mouse	Tesaglitazar	decreases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	tesaglitazar results in decreased expression of A3GALT2 mRNA	CTD	PMID:21515302
A3galt2	Mouse	testosterone	decreases expression	EXP		6480464	Testosterone deficiency results in decreased expression of A3GALT2 mRNA	CTD	PMID:33848595
A3galt2	Mouse	thioacetamide	increases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	Thioacetamide results in increased expression of A3GALT2 mRNA	CTD	PMID:34492290
A3galt2	Mouse	thiram	increases expression	ISO	A3GALT2 (Homo sapiens)	6480464	Thiram results in increased expression of A3GALT2 mRNA	CTD	PMID:38568856
A3galt2	Mouse	topotecan	multiple interactions	ISO	A3galt2 (Rattus norvegicus)	6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of A3GALT2 mRNA	CTD	PMID:25729387
A3galt2	Mouse	topotecan	increases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	Topotecan results in increased expression of A3GALT2 mRNA	CTD	PMID:25729387
A3galt2	Mouse	trichloroethene	decreases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	Trichloroethylene results in decreased expression of A3GALT2 mRNA	CTD	PMID:33387578
A3galt2	Mouse	triptonide	increases expression	EXP		6480464	triptonide results in increased expression of A3GALT2 mRNA	CTD	PMID:33045310
A3galt2	Mouse	troglitazone	decreases expression	ISO	A3galt2 (Rattus norvegicus)	6480464	troglitazone results in decreased expression of A3GALT2 mRNA	CTD	PMID:21515302

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
A3galt2	Mouse	carbohydrate metabolic process	involved_in	IEA	InterPro:IPR005076	2290270		InterPro	GO_REF:0000002
A3galt2	Mouse	cellular response to manganese ion		ISO	A3galt2 (Rattus norvegicus)	9068941		RGD	PMID:1569388 and REF_RGD_ID:13831122
A3galt2	Mouse	cellular response to manganese ion	involved_in	ISO	A3galt2 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
A3galt2	Mouse	glycosphingolipid biosynthetic process		ISO	A3galt2 (Rattus norvegicus)	9068941		RGD	PMID:10854427 and REF_RGD_ID:1299594
A3galt2	Mouse	glycosphingolipid biosynthetic process	acts_upstream_of_or_within	IGI	MGI:1347344 and MGI:3512453	2290270	PMID:22875802	MGI	PMID:22875802
A3galt2	Mouse	glycosphingolipid biosynthetic process	involved_in	ISO	A3galt2 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
A3galt2	Mouse	glycosphingolipid biosynthetic process	involved_in	ISS	UniProtKB:A0A4Z3	2290270		UniProt	GO_REF:0000024
A3galt2	Mouse	glycosphingolipid biosynthetic process	acts_upstream_of_or_within	ISO	UniProtKB:A0A4Z3	2290270		MGI	GO_REF:0000008
A3galt2	Mouse	lipid glycosylation	involved_in	ISO	A3galt2 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
A3galt2	Mouse	lipid glycosylation	involved_in	IBA	PANTHER:PTN000049004 and A3galt2 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000033
A3galt2	Mouse	lipid glycosylation	involved_in	ISS	UniProtKB:A0A4Z3	2290270		UniProt	GO_REF:0000024

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
A3galt2	Mouse	Golgi apparatus	located_in	ISS	UniProtKB:A0A4Z3	2290270		UniProt	GO_REF:0000024
A3galt2	Mouse	Golgi apparatus	located_in	ISO	A3galt2 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
A3galt2	Mouse	Golgi apparatus	is_active_in	IBA	PANTHER:PTN000049004 more ...	2290270		GO_Central	GO_REF:0000033
A3galt2	Mouse	Golgi cisterna membrane	located_in	IEA	UniProtKB-SubCell:SL-0136	2290270		UniProt	GO_REF:0000044
A3galt2	Mouse	vesicle	located_in	ISO	A3galt2 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
A3galt2	Mouse	vesicle	located_in	ISS	UniProtKB:A0A4Z3	2290270		UniProt	GO_REF:0000024
A3galt2	Mouse	vesicle	is_active_in	IBA	PANTHER:PTN000049004 and A3galt2 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
A3galt2	Mouse	alpha-1,3-galactosyltransferase activity	NOT\|enables	ISO	A3GALT2 (Homo sapiens)	9068941	PMID:18630988	UniProt	PMID:18630988
A3galt2	Mouse	alpha-1,3-galactosyltransferase activity	enables	IGI	MGI:1347344 and MGI:3512453	2290270	PMID:22875802	MGI	PMID:22875802
A3galt2	Mouse	alpha-1,3-galactosyltransferase activity	enables	ISO	UniProtKB:A0A4Z3	2290270		MGI	GO_REF:0000008
A3galt2	Mouse	glycosyltransferase activity	enables	ISO	A3galt2 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
A3galt2	Mouse	glycosyltransferase activity	enables	IBA	PANTHER:PTN000049004 more ...	2290270		GO_Central	GO_REF:0000033
A3galt2	Mouse	glycosyltransferase activity		ISO	A3galt2 (Rattus norvegicus)	9068941		RGD	PMID:10854427 and REF_RGD_ID:1299594
A3galt2	Mouse	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	2290270		UniProt	GO_REF:0000043
A3galt2	Mouse	N-acetyllactosaminide 3-alpha-galactosyltransferase activity	enables	ISO	A3galt2 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
A3galt2	Mouse	N-acetyllactosaminide 3-alpha-galactosyltransferase activity	enables	ISS	UniProtKB:A0A4Z3	2290270		UniProt	GO_REF:0000024

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
A3galt2	Mouse	no abnormal phenotype detected		IAGP		5509061		MGI	PMID:17372206

#	Reference Title	Reference Citation
1.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10349636	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12466851	PMID:15539565	PMID:16141072	PMID:16141073	PMID:16456004	PMID:16476743	PMID:17372206	PMID:18348765
PMID:18810447	PMID:19033672	PMID:21677750	PMID:21873635	PMID:22875802

A3galt2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	128,653,051 - 128,663,091 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	128,649,157 - 128,663,091 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	128,759,258 - 128,769,298 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	128,755,364 - 128,769,298 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	128,436,502 - 128,446,542 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	128,261,562 - 128,271,602 (+)	NCBI		MGSCv36	mm8
Celera	4	127,097,903 - 127,107,951 (+)	NCBI		Celera
Cytogenetic Map	4	D2.2	NCBI
cM Map	4	62.23	NCBI

A3GALT2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	33,306,766 - 33,321,098 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	33,306,766 - 33,321,098 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	33,772,367 - 33,786,699 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	33,544,954 - 33,559,286 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	32,044,033 - 32,050,184 (-)	NCBI		Celera
Cytogenetic Map	1	p35.1	NCBI
HuRef	1	31,888,724 - 31,902,934 (-)	NCBI		HuRef
CHM1_1	1	33,887,824 - 33,902,079 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	33,168,388 - 33,182,706 (-)	NCBI		T2T-CHM13v2.0

A3galt2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	146,385,725 - 146,398,156 (+)	NCBI		GRCr8
mRatBN7.2	5	141,101,329 - 141,113,760 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	141,107,983 - 141,115,641 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	143,797,192 - 143,809,595 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	145,567,021 - 145,579,424 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	145,567,944 - 145,580,207 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	146,933,592 - 146,945,882 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	146,933,592 - 146,945,880 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	150,671,102 - 150,683,392 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	147,981,004 - 147,994,143 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	147,991,042 - 148,004,180 (+)	NCBI
Celera	5	139,585,640 - 139,597,893 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

A3galt2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	11,474,472 - 11,480,849 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	11,476,485 - 11,489,243 (-)	NCBI	ChiLan1.0	ChiLan1.0

A3GALT2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	193,513,103 - 193,526,655 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	192,635,241 - 192,648,166 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	32,592,614 - 32,598,986 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	33,778,059 - 33,792,420 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

A3GALT2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	68,117,648 - 68,138,610 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	68,118,413 - 68,138,095 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	64,695,829 - 64,716,770 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	68,679,761 - 68,700,702 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	68,679,595 - 68,700,717 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	65,492,524 - 65,513,408 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	66,515,072 - 66,535,968 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	67,507,076 - 67,528,016 (+)	NCBI		UU_Cfam_GSD_1.0

A3galt2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	50,310,334 - 50,322,761 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	16,135,644 - 16,145,518 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	16,135,076 - 16,138,930 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

A3GALT2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	89,558,423 - 89,562,490 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	89,557,492 - 89,562,835 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	83,571,441 - 83,573,210 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

A3GALT2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	99,564,275 - 99,573,839 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	99,561,311 - 99,573,752 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	17,119,668 - 17,129,303 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

A3galt2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	16,339,948 - 16,351,846 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	16,340,488 - 16,353,127 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in A3galt2
472 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	898
Count of miRNA genes:	370
Interacting mature miRNAs:	419
Transcripts:	ENSMUST00000030585, ENSMUST00000106077
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4142139	Adip12_m	adiposity 12 (mouse)			Not determined		4	124621281	156860686	Mouse
10047132	Albq19_m	albuminuria QTL 19 (mouse)			Not determined		4	112824389	146824389	Mouse
1301525	Lmb1_m	lupus in MRL and B6 F2 cross (mouse)			Not determined		4	124264957	150676858	Mouse
14746982	Manh56_m	mandible shape 56 (mouse)					4	117815917	151815917	Mouse
4141623	W6q13_m	weight 6 weeks QTL 13 (mouse)			Not determined			88982069	140468203	Mouse
12910797	Pwgrq4_m	pre-weaning growth rate QTL 4 (mouse)					4	105835310	141433838	Mouse
25314312	Syncl2_m	synaptonemal complex length 2 (mouse)					4	65718237	146584457	Mouse
12910794	Pwbwq8_m	post-weaning body weight QTL 8 (mouse)					4	105835310	141433838	Mouse
1300743	Skull6_m	skull morphology 6 (mouse)			Not determined		4	111009051	145009280	Mouse
1301382	Arvm2_m	autoimmune renal vasculitis 2 (mouse)			Not determined		4	107791564	141791756	Mouse
1302149	Tlsr2_m	thymic lymphoma suppressor region 2 (mouse)			Not determined		4	124264957	142230960	Mouse
12910813	Pwbwq4_m	pre-weaning body weight QTL 4 (mouse)					4	105835310	141433838	Mouse
4141093	W3q17_m	weight 3 weeks QTL 17 (mouse)			Not determined			88982069	140468203	Mouse
27226757	Femd1_m	femur midshaft diameter 1, 5 week (mouse)					4	123993793	144326570	Mouse
12910808	Pwbwq9_m	post-weaning body weight QTL 9 (mouse)					4	105835310	141433838	Mouse
1300621	Tpnr1_m	thermal pain response 1 (mouse)			Not determined		4	125230872	156860686	Mouse
11567249	Elorr3_m	ethanol induced loss of righting response 3 (mouse)					4	3722677	156268235	Mouse
4142493	Femwf13_m	femur work to failure 13 (mouse)			Not determined			116154678	150154782	Mouse
1301815	Sles2_m	systemic lupus erythmatosus suppressor 2 (mouse)			Not determined		4	94957579	150676858	Mouse
1300663	Start2_m	startle response 2 (mouse)			Not determined		4	107264957	141265153	Mouse
1300917	Gasa1_m	gastritis type A susceptibility locus 1 (mouse)			Not determined		4	124055093	142438020	Mouse
1301823	Bmd7_m	bone mineral density 7 (mouse)			Not determined		4	88982069	151654550	Mouse
10412210	Cypr6_m	cytokine production 6 (mouse)			Not determined		4	120617848	154617995	Mouse
1302078	Sluc21_m	susceptibility to lung cancer 21 (mouse)			Not determined		4	117401141	151401275	Mouse
10045620	Heal22_m	wound healing/regeneration 22 (mouse)			Not determined		4	125230872	156860686	Mouse
4142481	Gct1_m	granulosa cell tumorigenesis 1 (mouse)			Not determined		4	127784226	156860686	Mouse
10412072	Ssen1_m	suseptibility to Sendai virus 1 (mouse)			Not determined		4	109658132	133154782	Mouse
4141065	Shali2_m	survival time to hyperoxic acute lung injury 2 (mouse)			Not determined			124055093	141572792	Mouse
13503348	Bntq18_m	bone traits QTL 18 (mouse)					4	120617848	154617995	Mouse
13208562	Wght7_m	weight 7 (mouse)					4	90888237	148084457	Mouse
1300655	Nidds_m	non-insulin-dependent diabetes mellitus in SJL (mouse)			Not determined		4	115030777	129465915	Mouse
1300781	Lith8_m	lithogenic gene 8 (mouse)			Not determined		4	107264957	141265153	Mouse
39128212	Lwq21_m	liver weight QTL 21 (mouse)					4	88982069	140468203	Mouse
4141180	Ssic1_m	susceptibility to small intestinal cancer 1 (mouse)			Not determined			120674005	154674151	Mouse
1301847	Fecq2_m	fecundity QTL 2 (mouse)			Not determined		4	100071971	134072206	Mouse
1302102	Bis1_m	beta-carboline-induced seizures 1 (mouse)			Not determined		4	119864433	153864536	Mouse
10043996	Gct5_m	granulosa cell tumorigenesis 5 (mouse)			Not determined		4	127784226	156860686	Mouse
26884445	Sklq7_m	skull length QTL 7, 10 week (mouse)					4	68018237	150884457	Mouse
10043985	Stheal12_m	soft tissue heal 12 (mouse)			Not determined		4	121342649	155342753	Mouse
1301982	Pltiq1_m	phospholipid transfer protein inducibility QTL 1 (mouse)			Not determined		4	124621281	156860686	Mouse
26884437	Sklq13_m	skull length QTL 13, 16 week (mouse)					4	57700000	155684457	Mouse
1300803	Sluc6_m	susceptibility to lung cancer 6 (mouse)			Not determined		4	120674005	154674151	Mouse
4141549	W10q10_m	weight 10 weeks QTL 10 (mouse)			Not determined			88982069	140468203	Mouse
4142061	Chlq16_m	circulating hormone level QTL 16 (mouse)			Not determined		4	121342649	155342753	Mouse
1357895	Ctrcts_m	cataract severity (mouse)			Not determined		4	45709925	138342753	Mouse
1300933	Cdcs9_m	cytokine deficiency colitis susceptibility 9 (mouse)			Not determined		4	125230872	156860686	Mouse
1300809	Ccrs2_m	corpus callosum hemisphere surface size 2 (mouse)			Not determined		4	107264957	141265153	Mouse
1301964	Bw8q2_m	body weight at 8 weeks QTL 2 (mouse)			Not determined		4	119864433	153864536	Mouse
1301452	Elsgp1_m	elevated serum gp70 1 (mouse)			Not determined		4	121342649	155342753	Mouse
1301106	Skts7_m	skin tumor susceptibility 7 (mouse)			Not determined		4	100071971	134072206	Mouse
10755520	Rbc1_m	red blood cell count 1 (mouse)					4	108477692	142477692	Mouse
10755521	Hct1_m	hematocrit 1 (mouse)					4	108477692	142477692	Mouse
10755522	Hgb1_m	hemoglobin 1 (mouse)					4	108477692	142477692	Mouse
27095924	Pglq2_m	pelvic girdle length QTL 2, 5 week (mouse)					4	69118237	130727311	Mouse
1300858	Tafat_m	tally ho associated mesenteric fat pad weight (mouse)			Not determined		4	124621281	156860686	Mouse
10755531	Lymph3_m	lymphocyte differential 3 (mouse)					4	124553483	156860686	Mouse
27095917	Scvln14_m	sacral vertebrae length 2, 16 week (mouse)					4	68018237	130277062	Mouse
1301731	Cafq2_m	caffeine metabolism QTL 2 (mouse)			Not determined		4	94732255	128732454	Mouse
15039382	Ltgq7_m	liver triglyceride QTL 7 (mouse)					4	105705794	139705794	Mouse
11533916	Mts1_m	mammary tumor susceptibility 1 (mouse)					4	125289325	156860686	Mouse
15039377	Bw45_m	body weight QTL 45 (mouse)					4	105705794	139705794	Mouse
1300839	Dyscalc2_m	dystrophic cardiac calcinosis 2 (mouse)			Not determined		4	111009051	145009280	Mouse
12880433	Fgf23lq1_m	FGF23 serum level QTL 1 (mouse)					4	101157197	135157197	Mouse
4141001	Tgq17_m	triglyceride QTL 17 (mouse)			Not determined			112523489	146523489	Mouse
15039378	Adip30_m	adiposity 30 (mouse)					4	105705794	139705794	Mouse
26884449	Sklq2_m	skull length QTL 2, 5 week (mouse)					4	36700000	128993793	Mouse
27095905	Scvln3_m	sacral vertebrae length 2, 5 week (mouse)					4	55600000	128993793	Mouse
1357800	Tgq3_m	triglyceride QTL 3 (mouse)			Not determined		4	107055093	141055180	Mouse
15039385	Mvlq3_m	macrovesicular liver lesion QTL 3 (mouse)					4	112182386	146182386	Mouse

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_001009819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AK132334	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL611983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY491982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466552	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CU467499	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000030585 ⟹ ENSMUSP00000030585

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	128,653,051 - 128,663,091 (+)	Ensembl
GRCm38.p6 Ensembl	4	128,759,258 - 128,769,298 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000106077 ⟹ ENSMUSP00000101687

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	128,649,157 - 128,662,381 (+)	Ensembl
GRCm38.p6 Ensembl	4	128,755,364 - 128,768,588 (+)	Ensembl

RefSeq Acc Id:

NM_001009819 ⟹ NP_001009819

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	4	128,653,051 - 128,663,091 (+)	NCBI
GRCm38	4	128,759,258 - 128,769,298 (+)	NCBI
MGSCv37	4	128,436,502 - 128,446,542 (+)	RGD
Celera	4	127,097,903 - 127,107,951 (+)	RGD
cM Map	4		ENTREZGENE

Sequence:

show sequence

GGCCTGGCTTACAGGTCAGCAACTCCAGGAAGTCTCTGAAAGCCTCCTGCCCACTCCCATTCCCTCCCAGGCTCATTAACCATATTCCTTGTGTGTCGCCTCCTCTTCTGGGTTCACTGTGCAGAGCC
CTGCTCTTACTCCACCTGCCTCAATCTTCACTCCGCATCCTGAAGACAGGTTTTGTCTTTCCATCTCACTTACCTTGATGTCTTGGACCCAGCACAAGGCTTGGTGCCACAATGTGACCAAGAGCAGG
GCCGAACAGACCTTGGCAAGCATCTTGATGTATGGCCATCTTCTATACAAAAAGGCATCTTCTTCCAACGGATGGACAGAGGCTGGGGCTGTTGGACATCAGAGGACAAGTACCGAAAGCTAAGCAGC
TCCCTAAAAGGCCAAGATAGTTCCCAGGAGACGGCTTCTCACACTGTATGCTGGCAACCTGTCTATTTTTGCCATAGCTCTTTTTTTTTTTTAAGGCGATCTTTTTATAAACAAAACCTGCCGGTGGG
TTCTAATTTGTATGTCTTTGCCTACTAGTGAGGTGAACATTTTTCCATTTATTTGCCTACTAAATACATCCCCCCCTCTTCTAGAATTAAGCTTCTGGTTTGCCATAGGCACTGTTAAAGGAGGTTGG
TCTCTTAGGAGATGGCTCTGGGGACAGAGTTGGGAGTGAGCTGGCCAGGGTCACATGGAAGTTGCCGAGAACAAGAAGGACAGAGACAAAGAGGCCCAGGGAAGCCAACCTGGGGACTTTCACGGGCC
AAGAAGAGACTCCTGTGGCGGTTCTTCCTGTCTGCATTTGGTTTCTTAGGCCTGTACCATTACAGGTTCATTATTATCAGGCTCATAGAAGGCTCCATCCCCATGGGCACCTGCCCTACAGCCATAAT
GCCTCTGCCGAGGGACAATTTCACAGGAGTACTGCACCACTGGGCCCGGCCTGAAGTCCTGACCTGTACCTCTTGGGGAGCACCAATTATTTGGGATGGCACTTTCGACCCTCATGTAGCCCAGCAAG
AGGCGAGACGGCGGAACCTCACCATCGGGCTGACTGTGTTTGCTGTAGGCAGGTACCTGGAGAAGTACCTGGAACACTTCCTGGTATCGGCAGAGCAGCACTTCATGGTCGGCCAGAACGTGGTGTAC
TATGTGTTTACGGATCGCCCGGAAGCAGTGCCCTATGTGGCTCTAGGCCAGGGTCGCCTGCTGCGGGCAAAACCCGTGCAGCGAGAGAGGCGCTGGCAGGACGTGTCCATGGCACGCATGCCCACGCT
ACACGAGGCTCTGGGAGGGCAGCTGGGCCAAGAAGCTGACTTTGTGTTCTGCCTGGACGTGGACCAGTACTTCACCGGTAACTTCGGGCCTGAGGTGCTGGCAGATTTGGTGGCACAGCTGCACGCCT
GGCACTACCGCTGGCCGCGGTGGCTGCTGCCCTACGAGAGGGACAAGCGATCGGCTGCTGCGCTGTCGTTAAGCGAAGGCGATTTCTACTACCACGCTGCGGTGTTTGGCGGCAGTGTGGCTGCACTG
CTCAAGCTGACGGCCCACTGTGCGACTGGCCAACAGCTGGACCATAAGCGCGGCATTGAGGCACTCTGGCACGACGAAAGCCACCTTAACAAGTTCTTCTGGCTGAACAAGCCCACCAAGCTGCTGTC
GCCTGAGTTCTGCTGGGCAGAGGAAATTATCTGGAGGAGAGAGATCCATCACCCACGCCTGCTCTGGGCACCCAAGGAATATACGCTGGTGCGAAACTAGCAGCCCTTCCCTGGCCAAGCAGGCGCCA
ACATCTTTGGCACTACCTTAAGTCAGAGCCACTTATAGCGCCTCTGGGAAGGGGGACTTTGGAACTCAGAGATATTGAAAAGAGATCCTGTACCTGGGGCCTGTAGACCCTTTGTCAGCTGACAGGAG
AGCCTTTTTGCTCCAACCAGAAGCAAATTATGGAAAGGCAAGAATTCTGGCAGCTTTTGTATCCCAGGTGCTTGTCAGCAGGGGGGCGTGCAGCAAGTACCACCTACCAGGATTAAAGCTTTTGCAGA
GGCCTTGGGGACAAGGCCTTCCTTAGCCCTTGGCAGTGGCTAGTGTCTCAGCTTCTGAGTGGACCTAGGTATTGGGGTTCCCACACCTTGACAATGACCAGTGTTGCTCCTATTGGAGCCTTTAGTAT
CTGAGGCTTGACAACTGTCTGAAGCCATTCCTGTGACCAGGATCTGCAGTTTCTCATCTCTTGGTCCTCACCGACTTCAGCCTCAGCTCTCCGTCCTGTCTGCCTCTGCTGGCCCTCTTGTTCGTATG
CAGGTCCCTGCCTGCGTTTATTTGTTTGACTGCCTCTTCTTCCACCGTCAAGCAGGCTTCTCCTGTCTGGAGCATGGCTGGCTCCCTGCCCCATGGGCACTTCCCCTTCAATTCCCTTGCCGTTGTTG
TGTGGCCGGCAGGTCACGCGGTTGTCATTGCCTCTGCCACCACCACTGCTATGCTGGCTCTTCCTTCATGTTACCGGACAGCCCTCACTGTTGGCCATTCAAGGGAAGCCTCTCATGGGACCTAACAG
CGCGGTGTCAGGAGAGCAGCAGGAGAGTGTCAGCCCTTCTCCCCTCCGAAACCCCTGCATGCTGGCTCATAAGGGCAGCTGAGCATCCAGTGTAGTAGCCATAAGTGAGATGTTTGAACCGACCGAGC
CTCATCTCTCTGGGATGCTCCCAGGTAGCCCTTCTGCTAGACCTCTTCTCTGTATGGTGATGGGTATGGAGTCTTCTGGAGTTCTCAAAGGCTTTGGCAGCAGAAGGTCTGTTTCAAATAACCATGGT
TTTATGGCTGTGCCTTAAGGAGCTCTGATTGTTGTGTGGGACTCTCAAGGTGTCCATGGGCTGTGCAAGACAAGGGGTGCCAGCATGGGGGTAGTCCAACACCTGCTGGCATGGGAGTCAAGTTGACA
GTGCTTACTTCCAGGACAGTGCGCTCCAGGGGGAATGTTAACAGTAGGGGGTTGAAGGACTTATTGTTAACACGTGTTCTAATTGTGAGAGATTTTCAACACTGCTTAACACCACCCAGGGCCCCAGG
AAGGGATGAGACCCTTCCCCTAGCCCCTTTCACCTCTGACCTTACTGAGTGCTTCTTTTGACGTGATATTTTTAACATGAGGAGACTGGGGCACAAAGAGCGACCAAACTGCCCAGACACAGGACCAT
TTCGAGCCCTTGTGATCATCAGCAGCGGAAGAATGAGAGTTAGATCTTCCTTCCAGCCCAACTCCCTTTAGGAGGGAGCCACTGAGAAAGGCAAGCAGACGTTCCAGTCATATATTATCTCTGCTCTA
TTATCTCCCGTGGCCGCAGCAGCTTGTGCATATTTGAGGAATGCTATAACAAGCAAGTAATT

hide sequence


Protein RefSeqs	NP_001009819	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAS66769	(Get FASTA)	NCBI Sequence Viewer
	BAE21111	(Get FASTA)	NCBI Sequence Viewer
	CAQ52296	(Get FASTA)	NCBI Sequence Viewer
	EDL30228	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000030585
	ENSMUSP00000030585.8
	ENSMUSP00000101687.2
GenBank Protein	Q3V1N9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001009819 ⟸ NM_001009819

- UniProtKB:

B2KGX6 (UniProtKB/Swiss-Prot), B2KGX5 (UniProtKB/Swiss-Prot), M9MMK2 (UniProtKB/Swiss-Prot), Q3V1N9 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MALGTELGVSWPGSHGSCREQEGQRQRGPGKPTWGLSRAKKRLLWRFFLSAFGFLGLYHYRFIIIRLIEGSIPMGTCPTAIMPLPRDNFTGVLHHWARPEVLTCTSWGAPIIWDGTFDPHVAQQEARR
RNLTIGLTVFAVGRYLEKYLEHFLVSAEQHFMVGQNVVYYVFTDRPEAVPYVALGQGRLLRAKPVQRERRWQDVSMARMPTLHEALGGQLGQEADFVFCLDVDQYFTGNFGPEVLADLVAQLHAWHYR
WPRWLLPYERDKRSAAALSLSEGDFYYHAAVFGGSVAALLKLTAHCATGQQLDHKRGIEALWHDESHLNKFFWLNKPTKLLSPEFCWAEEIIWRREIHHPRLLWAPKEYTLVRN

hide sequence

Ensembl Acc Id:

ENSMUSP00000101687 ⟸ ENSMUST00000106077

Ensembl Acc Id:

ENSMUSP00000030585 ⟸ ENSMUST00000030585

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3V1N9-F1-model_v2	AlphaFold	Q3V1N9	1-370	view protein structure

RGD ID:

6834736

Promoter ID:

MM_KWN:39740

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, Kidney, Liver, Lung, MEF_B4, MEF_B6

Transcripts:

ENSMUST00000106077

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	4	128,432,366 - 128,433,097 (+)	MPROMDB

RGD ID:

6834735

Promoter ID:

MM_KWN:39741

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

BoneMarrow_0Hour, BoneMarrow_4Hour, Brain, MEF_B6

Transcripts:

ENSMUST00000030585

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	4	128,435,521 - 128,436,697 (+)	MPROMDB

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000028794	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000030585	ENTREZGENE
	ENSMUST00000030585.8	UniProtKB/Swiss-Prot
	ENSMUST00000106077.8	UniProtKB/Swiss-Prot
Gene3D-CATH	Spore Coat Polysaccharide Biosynthesis Protein SpsA, Chain A	UniProtKB/Swiss-Prot
InterPro	Glyco_trans_6	UniProtKB/Swiss-Prot
	Nucleotide-diphossugar_trans	UniProtKB/Swiss-Prot
KEGG Report	mmu:215493	UniProtKB/Swiss-Prot
MGD	MGI:2685279	ENTREZGENE
NCBI Gene	215493	ENTREZGENE
PANTHER	ALPHA-1,3-GALACTOSYLTRANSFERASE 2	UniProtKB/Swiss-Prot
	PTHR10462	UniProtKB/Swiss-Prot
Pfam	Glyco_transf_6	UniProtKB/Swiss-Prot
PhenoGen	A3galt2	PhenoGen
Superfamily-SCOP	SSF53448	UniProtKB/Swiss-Prot
UniProt	A3LT2_MOUSE	UniProtKB/Swiss-Prot
	B2KGX5	ENTREZGENE
	B2KGX6	ENTREZGENE
	M9MMK2	ENTREZGENE
	Q3V1N9	ENTREZGENE
UniProt Secondary	B2KGX5	UniProtKB/Swiss-Prot
	B2KGX6	UniProtKB/Swiss-Prot
	M9MMK2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-06-27	A3galt2	alpha 1,3-galactosyltransferase 2	A3galt2	alpha 1,3-galactosyltransferase 2 (isoglobotriaosylceramide synthase)	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype