Symbol:
Pld5
Name:
phospholipase D family member 5
RGD ID:
1616447
MGI Page
MGI
Description:
Predicted to enable hydrolase activity, acting on ester bonds. Predicted to be located in endoplasmic reticulum membrane. Orthologous to human PLD5 (phospholipase D family member 5).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
B230365F16Rik; inactive choline phosphatase 5; inactive phosphatidylcholine-hydrolyzing phospholipase D5; inactive phospholipase D5; inactive PLD 5; phospholipase D family, member 5; phospholipase D5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PLD5 (phospholipase D family member 5) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Pld5 (phospholipase D family, member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pld5 (phospholipase D family member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PLD5 (phospholipase D family member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PLD5 (phospholipase D family member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pld5 (phospholipase D family member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PLD5 (phospholipase D family member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PLD5 (phospholipase D family member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pld5 (phospholipase D family member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Pld5 (phospholipase D family, member 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PLD5 (phospholipase D family member 5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
E04F6.4
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG43345
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG9248
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
Y51A2D.13
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Danio rerio (zebrafish):
pld5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 175,789,867 - 176,109,078 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 175,789,872 - 176,102,878 (-) Ensembl GRCm39 Ensembl GRCm38 1 175,962,301 - 176,281,512 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 175,962,306 - 176,275,312 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 177,892,437 - 178,205,443 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 177,798,981 - 178,112,280 (-) NCBI MGSCv36 mm8 Celera 1 183,041,914 - 183,365,812 (-) NCBI Celera Cytogenetic Map 1 H4 NCBI cM Map 1 81.9 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pld5 Mouse 17beta-estradiol increases expression ISO RGD:1603543 6480464 Estradiol results in increased expression of PLD5 mRNA CTD PMID:20106945 Pld5 Mouse 17beta-estradiol multiple interactions ISO RGD:1603543 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of PLD5 mRNA CTD PMID:30165855 Pld5 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1562609 6480464 Tetrachlorodibenzodioxin results in decreased expression of PLD5 mRNA CTD PMID:32109520 Pld5 Mouse 2-methylcholine affects expression ISO RGD:1603543 6480464 beta-methylcholine affects the expression of PLD5 mRNA CTD PMID:21179406 Pld5 Mouse 3,3',5-triiodo-L-thyronine increases expression ISO RGD:1603543 6480464 Triiodothyronine results in increased expression of PLD5 mRNA CTD PMID:23397585 Pld5 Mouse 3,4-dichloroaniline increases expression ISO RGD:1603543 6480464 3,4-dichloroaniline results in increased expression of PLD5 mRNA CTD PMID:24172598 Pld5 Mouse 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1603543 6480464 bisphenol S results in decreased methylation of PLD5 gene CTD PMID:31601247 Pld5 Mouse 6-propyl-2-thiouracil decreases expression ISO RGD:1562609 6480464 Propylthiouracil results in decreased expression of PLD5 mRNA CTD PMID:24780913 Pld5 Mouse aflatoxin B1 affects methylation ISO RGD:1603543 6480464 Aflatoxin B1 affects the methylation of PLD5 intron CTD PMID:30157460 Pld5 Mouse Aflatoxin B2 alpha decreases methylation ISO RGD:1603543 6480464 aflatoxin B2 results in decreased methylation of PLD5 intron CTD PMID:30157460 Pld5 Mouse all-trans-retinoic acid decreases expression ISO RGD:1603543 6480464 Tretinoin results in decreased expression of PLD5 mRNA CTD PMID:23724009 Pld5 Mouse arsane multiple interactions ISO RGD:1603543 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of PLD5 more ... CTD PMID:32525701 Pld5 Mouse arsenic atom multiple interactions ISO RGD:1603543 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of PLD5 more ... CTD PMID:32525701 Pld5 Mouse arsenous acid decreases expression ISO RGD:1603543 6480464 Arsenic Trioxide results in decreased expression of PLD5 mRNA CTD PMID:26705709 Pld5 Mouse belinostat decreases expression ISO RGD:1603543 6480464 belinostat results in decreased expression of PLD5 mRNA CTD PMID:26272509 Pld5 Mouse belinostat multiple interactions ISO RGD:1603543 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Pld5 Mouse benzo[a]pyrene increases mutagenesis ISO RGD:1603543 6480464 Benzo(a)pyrene results in increased mutagenesis of PLD5 gene CTD PMID:25435355 Pld5 Mouse benzo[a]pyrene increases methylation ISO RGD:1603543 6480464 Benzo(a)pyrene results in increased methylation of PLD5 promoter CTD PMID:27901495 Pld5 Mouse benzo[a]pyrene affects methylation ISO RGD:1603543 6480464 Benzo(a)pyrene affects the methylation of PLD5 5' UTR; Benzo(a)pyrene affects the methylation of PLD5 intron CTD PMID:27901495|PMID:30157460 Pld5 Mouse benzo[e]pyrene affects methylation ISO RGD:1603543 6480464 benzo(e)pyrene affects the methylation of PLD5 intron CTD PMID:30157460 Pld5 Mouse bis(2-ethylhexyl) phthalate increases expression ISO RGD:1603543 6480464 Diethylhexyl Phthalate results in increased expression of PLD5 mRNA CTD PMID:31163220 Pld5 Mouse bisphenol A decreases expression ISO RGD:1562609 6480464 bisphenol A results in decreased expression of PLD5 mRNA CTD PMID:25181051|PMID:34947998|PMID:37105472 Pld5 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PLD5 mRNA CTD PMID:32156529 Pld5 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PLD5 mRNA CTD PMID:32365465 Pld5 Mouse bisphenol A multiple interactions ISO RGD:1603543 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PLD5 gene CTD PMID:31601247 Pld5 Mouse butanal decreases expression ISO RGD:1603543 6480464 butyraldehyde results in decreased expression of PLD5 mRNA CTD PMID:26079696 Pld5 Mouse cadmium dichloride increases expression ISO RGD:1603543 6480464 Cadmium Chloride results in increased expression of PLD5 mRNA CTD PMID:38568856 Pld5 Mouse CGP 52608 multiple interactions ISO RGD:1603543 6480464 CGP 52608 promotes the reaction [RORA protein binds to PLD5 gene] CTD PMID:28238834 Pld5 Mouse cisplatin increases expression ISO RGD:1603543 6480464 Cisplatin results in increased expression of PLD5 mRNA CTD PMID:27392435 Pld5 Mouse cisplatin multiple interactions ISO RGD:1603543 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of PLD5 mRNA CTD PMID:27392435 Pld5 Mouse copper(II) chloride increases expression ISO RGD:1603543 6480464 cupric chloride results in increased expression of PLD5 mRNA CTD PMID:38568856 Pld5 Mouse DDE decreases expression ISO RGD:1603543 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of PLD5 mRNA CTD PMID:38568856 Pld5 Mouse diarsenic trioxide decreases expression ISO RGD:1603543 6480464 Arsenic Trioxide results in decreased expression of PLD5 mRNA CTD PMID:26705709 Pld5 Mouse diuron increases expression ISO RGD:1603543 6480464 Diuron metabolite results in increased expression of PLD5 mRNA CTD PMID:24172598 Pld5 Mouse dorsomorphin multiple interactions ISO RGD:1603543 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Pld5 Mouse entinostat decreases expression ISO RGD:1603543 6480464 entinostat results in decreased expression of PLD5 mRNA CTD PMID:26272509 Pld5 Mouse entinostat multiple interactions ISO RGD:1603543 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Pld5 Mouse fulvestrant multiple interactions ISO RGD:1603543 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PLD5 gene CTD PMID:31601247 Pld5 Mouse lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of PLD5 mRNA CTD PMID:22613225 Pld5 Mouse lead diacetate increases expression ISO RGD:1603543 6480464 lead acetate results in increased expression of PLD5 mRNA CTD PMID:38568856 Pld5 Mouse lead(0) affects expression ISO RGD:1603543 6480464 Lead affects the expression of PLD5 mRNA CTD PMID:28903495 Pld5 Mouse methapyrilene affects methylation ISO RGD:1603543 6480464 Methapyrilene affects the methylation of PLD5 intron CTD PMID:30157460 Pld5 Mouse methoxychlor affects methylation ISO RGD:1562609 6480464 Methoxychlor affects the methylation of PLD5 gene CTD PMID:35440735 Pld5 Mouse methylmercury chloride decreases expression ISO RGD:1603543 6480464 methylmercuric chloride results in decreased expression of PLD5 mRNA CTD PMID:28001369 Pld5 Mouse Nutlin-3 increases expression ISO RGD:1603543 6480464 nutlin 3 results in increased expression of PLD5 mRNA CTD PMID:38460933 Pld5 Mouse okadaic acid increases expression ISO RGD:1603543 6480464 Okadaic Acid results in increased expression of PLD5 mRNA CTD PMID:38832940 Pld5 Mouse p-chloromercuribenzoic acid decreases expression ISO RGD:1603543 6480464 p-Chloromercuribenzoic Acid results in decreased expression of PLD5 mRNA CTD PMID:26272509 Pld5 Mouse p-chloromercuribenzoic acid multiple interactions ISO RGD:1603543 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Pld5 Mouse paracetamol increases expression ISO RGD:1603543 6480464 Acetaminophen results in increased expression of PLD5 mRNA CTD PMID:29067470 Pld5 Mouse perfluorononanoic acid decreases expression ISO RGD:1603543 6480464 perfluoro-n-nonanoic acid results in decreased expression of PLD5 mRNA CTD PMID:32588087 Pld5 Mouse resveratrol multiple interactions ISO RGD:1603543 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of PLD5 mRNA CTD PMID:23557933 Pld5 Mouse SB 431542 multiple interactions ISO RGD:1603543 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Pld5 Mouse silicon dioxide decreases expression ISO RGD:1603543 6480464 Silicon Dioxide analog results in decreased expression of PLD5 mRNA CTD PMID:25895662 Pld5 Mouse sodium arsenate multiple interactions ISO RGD:1603543 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of PLD5 more ... CTD PMID:32525701 Pld5 Mouse sodium arsenite increases expression ISO RGD:1603543 6480464 sodium arsenite results in increased expression of PLD5 mRNA CTD PMID:38568856 Pld5 Mouse sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of PLD5 mRNA CTD PMID:36209798 Pld5 Mouse sunitinib decreases expression ISO RGD:1603543 6480464 Sunitinib results in decreased expression of PLD5 mRNA CTD PMID:31533062 Pld5 Mouse thiram increases expression ISO RGD:1603543 6480464 Thiram results in increased expression of PLD5 mRNA CTD PMID:38568856 Pld5 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of PLD5 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Pld5 Mouse trichostatin A decreases expression ISO RGD:1603543 6480464 trichostatin A results in decreased expression of PLD5 mRNA CTD PMID:24935251 Pld5 Mouse triclosan increases expression ISO RGD:1603543 6480464 Triclosan results in increased expression of PLD5 mRNA CTD PMID:30510588 Pld5 Mouse valproic acid increases expression ISO RGD:1603543 6480464 Valproic Acid results in increased expression of PLD5 mRNA CTD PMID:23179753 Pld5 Mouse vorinostat increases expression ISO RGD:1603543 6480464 vorinostat results in increased expression of PLD5 mRNA CTD PMID:27188386 Pld5 Mouse zoledronic acid increases expression ISO RGD:1603543 6480464 zoledronic acid results in increased expression of PLD5 mRNA CTD PMID:24714768
17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-methylcholine (ISO) 3,3',5-triiodo-L-thyronine (ISO) 3,4-dichloroaniline (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) belinostat (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butanal (ISO) cadmium dichloride (ISO) CGP 52608 (ISO) cisplatin (ISO) copper(II) chloride (ISO) DDE (ISO) diarsenic trioxide (ISO) diuron (ISO) dorsomorphin (ISO) entinostat (ISO) fulvestrant (ISO) lead diacetate (EXP,ISO) lead(0) (ISO) methapyrilene (ISO) methoxychlor (ISO) methylmercury chloride (ISO) Nutlin-3 (ISO) okadaic acid (ISO) p-chloromercuribenzoic acid (ISO) paracetamol (ISO) perfluorononanoic acid (ISO) resveratrol (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sunitinib (ISO) thiram (ISO) titanium dioxide (EXP) trichostatin A (ISO) triclosan (ISO) valproic acid (ISO) vorinostat (ISO) zoledronic acid (ISO)
Pld5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 175,789,867 - 176,109,078 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 175,789,872 - 176,102,878 (-) Ensembl GRCm39 Ensembl GRCm38 1 175,962,301 - 176,281,512 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 175,962,306 - 176,275,312 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 177,892,437 - 178,205,443 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 177,798,981 - 178,112,280 (-) NCBI MGSCv36 mm8 Celera 1 183,041,914 - 183,365,812 (-) NCBI Celera Cytogenetic Map 1 H4 NCBI cM Map 1 81.9 NCBI
PLD5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 242,082,986 - 242,530,546 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 242,082,986 - 242,524,697 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 242,246,288 - 242,687,999 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 240,318,895 - 240,754,621 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 215,507,475 - 215,943,236 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI HuRef 1 212,919,621 - 213,122,645 (-) NCBI HuRef HuRef 1 212,711,210 - 212,853,533 (-) NCBI HuRef CHM1_1 1 243,524,434 - 243,960,008 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 241,495,068 - 241,942,534 (-) NCBI T2T-CHM13v2.0
Pld5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 90,426,689 - 90,765,072 (-) NCBI GRCr8 mRatBN7.2 13 87,895,694 - 88,232,868 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 87,896,369 - 88,232,868 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 90,384,330 - 90,737,885 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 91,784,609 - 92,138,157 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 88,966,952 - 89,321,111 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 94,025,696 - 94,355,219 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 94,025,369 - 94,355,219 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 98,486,317 - 98,812,030 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 91,715,000 - 92,058,036 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 13 87,485,947 - 87,815,991 (-) NCBI Celera Cytogenetic Map 13 q24 NCBI
Pld5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 5,816,926 - 6,138,579 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 5,810,286 - 5,994,601 (-) NCBI ChiLan1.0 ChiLan1.0
PLD5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 6,622,753 - 7,069,206 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 6,845,185 - 7,291,289 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 217,640,005 - 218,081,158 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 222,624,198 - 222,798,210 (-) NCBI panpan1.1 PanPan1.1 panPan2
PLD5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 33,422,964 - 33,836,252 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 33,429,409 - 33,836,258 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 32,901,116 - 33,309,816 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 33,249,160 - 33,659,927 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 33,253,065 - 33,659,964 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 33,086,377 - 33,499,628 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 33,106,517 - 33,517,045 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 33,360,227 - 33,774,810 (-) NCBI UU_Cfam_GSD_1.0
Pld5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 46,305,137 - 46,692,149 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936526 8,055,339 - 8,441,030 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936526 8,055,190 - 8,447,854 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PLD5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 15,420,608 - 15,723,479 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 15,420,600 - 15,723,890 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 17,750,621 - 17,841,790 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PLD5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 79,164,501 - 79,584,632 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 79,171,369 - 79,519,763 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 81,338,470 - 81,758,441 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pld5
.
Predicted Target Of
Count of predictions: 1919 Count of miRNA genes: 636 Interacting mature miRNAs: 824 Transcripts: ENSMUST00000065967, ENSMUST00000111166, ENSMUST00000111167, ENSMUST00000125404, ENSMUST00000144340, ENSMUST00000156184 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1558802 Skmw6_m skeletal muscle weight 6 (mouse) Not determined 1 167954584 195154279 Mouse 10412185 Hcs9_m hepatocarcinogenesis susceptibility 9 (mouse) Not determined 1 63854690 189303617 Mouse 12790987 Tgl5_m triglyceride 5 (mouse) 1 160097157 194097157 Mouse 13824984 Twq5_m testis weight QTL 5 (mouse) 1 3069992 184732197 Mouse 1357854 Sle16_m systematic lupus erythematosus susceptibility 16 (mouse) Not determined 1 169038741 177377587 Mouse 4142389 Scfr1_m stem cell frequency regulator 1 (mouse) Not determined 171632048 189303617 Mouse 12790984 Pcho7_m plasma cholesterol 7 (mouse) 1 147219390 181219390 Mouse 12790988 Phdlc5_m plasma HDL cholesterol 5 (mouse) 9 160097157 194097157 Mouse 1301251 Scc3_m colon tumor susceptibility 3 (mouse) Not determined 1 168213823 195154279 Mouse 1302023 Orch4_m autoimmune orchitis resistance 4 (mouse) Not determined 1 175211318 195154279 Mouse 12790996 Aath2_m aortic arch atherosclerosis 2 (mouse) 1 145077630 179077630 Mouse 12791001 Aath6_m aortic arch atherosclerosis 6 (mouse) 1 147219390 181219390 Mouse 1300745 Gvhd1_m graft-versus-host disease 1 (mouse) Not determined 1 157456299 191456436 Mouse 10412162 Nobq3_m New Zealand obese QTL 3 (mouse) Not determined 1 103933405 191225397 Mouse 4141346 Skmw12_m skeletal muscle weight 12 (mouse) Not determined 150756737 184756922 Mouse 1357618 Splq5_m spleen weight QTL 5 (mouse) Not determined 1 150193673 188359312 Mouse 1301301 Sle1_m systemic lupus erythmatosus susceptibility 1 (mouse) Not determined 1 152038741 186038913 Mouse 10045887 Cplaq13_m circadian period of locomotor activity 13 (mouse) Not determined 1 172831765 181400659 Mouse 12904936 Edlmmq1_m extensor digitorum longus muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1301565 Mnotch_m modifier of Notch (mouse) Not determined 1 157456299 191456436 Mouse 1301309 Emo1_m emotionality 1 (mouse) Not determined 1 162977097 185994196 Mouse 1301025 Lbw7_m lupus NZB x NZW 7 (mouse) Not determined 1 152038741 186038913 Mouse 12904944 Tammq1_m tibialis anterior muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 12904957 Gmmq1_m gastrocnemius muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1300777 Chol10_m cholesterol 10 (mouse) Not determined 9 147875502 181875616 Mouse 11532690 Sluc37_m susceptibility to lung cancer 37 (mouse) 1 175468817 194111528 Mouse 1300823 Ath9_m atherosclerosis 9 (mouse) Not determined 1 160112768 194112883 Mouse 1301333 Mop3_m morphine preference 3 (mouse) Not determined 1 167756737 189303617 Mouse 1300571 Opfa_m open field activity (mouse) Not determined 1 144531347 178531592 Mouse 1301339 Hdlq15_m HDL QTL 15 (mouse) Not determined 1 165873675 195154279 Mouse 10043863 Swrl5_m SWR lupus locus 5 (mouse) Not determined 1 172303451 195154279 Mouse 1301596 Elnt_m escape latencies during navigation task (mouse) Not determined 1 162145207 194111528 Mouse 4141165 Bglu3_m blood glucose level 3 (mouse) Not determined 155831765 189831892 Mouse 12792983 Liq1_m limb inflammation QTL 1 (mouse) 1 167586086 191225397 Mouse 1357889 Lprq3_m lipoprotein QTL 3 (mouse) Not determined 1 152038741 186038913 Mouse 4142182 Shali5_m survival time to hyperoxic acute lung injury 5 (mouse) Not determined 155582237 185994196 Mouse 10402498 Lmr20_m leishmaniasis resistance 20 (mouse) Not determined 1 158468817 192468938 Mouse 1301619 Cafq1_m caffeine metabolism QTL 1 (mouse) Not determined 1 155716221 189716369 Mouse 4141149 Hbnr4_m Heligmosomoides bakeri nematode resistance 4 (mouse) Not determined 147125258 188983224 Mouse 10043899 Hdlq99_m HDL QTL 99 (mouse) Not determined 1 147875502 181875616 Mouse 11537365 Cnes4_m C. neoformans susceptibility locus 4 (mouse) 1 144449142 178449142 Mouse 11081167 Tir8_m trypanosome infection response 8 (mouse) 1 155716221 189716369 Mouse 1302132 Pbw1_m pentobarbital withdrawal QTL 1 (mouse) Not determined 1 155831765 189831892 Mouse 4142159 Nba2_m New Zealand Black autoimmunity 2 (mouse) Not determined 151835111 185835280 Mouse 1301602 Bslm4_m basal locomotor activity 4 (mouse) Not determined 1 157456299 191456436 Mouse 1301866 Cplaq3_m circadian period of locomotor activity 3 (mouse) Not determined 1 155721528 189722608 Mouse 1300842 Sle9_m systematic lupus erythematosus susceptibility 9 (mouse) Not determined 1 158468817 192468938 Mouse 1301614 Cgnz1_m chronic glomerulonephritis in NZM 1 (mouse) Not determined 1 152038741 186038913 Mouse 12910521 Scgq1_m spontaneous crescentic glomerulonephritis QTL 1 (mouse) 1 156602037 176262693 Mouse 11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 4141245 Cq2_m cholesterol QTL 2 (mouse) Not determined 1 157456299 191456436 Mouse 4141244 Bmd5c_m bone mineral density 5c (mouse) Not determined 155526796 189526897 Mouse 13464138 Hdlq107_m HDL QTL 107 (mouse) 1 152132744 186132744 Mouse 1301652 Cpfd2_m cerebellum pattern fissures (mouse) Not determined 1 172303451 195154279 Mouse 1300888 Berr1_m berghei resistance locus 1 (mouse) Not determined 1 164143227 190534272 Mouse 1301151 Hdlq14_m HDL QTL 14 (mouse) Not determined 1 142489543 176489734 Mouse 1301122 Cd8mts1_m CD8 T memory cell subset 1 (mouse) Not determined 1 155831765 189831892 Mouse 1301632 Bw8q1_m body weight at 8 weeks QTL 1 (mouse) Not determined 1 161201261 195154279 Mouse 4141483 Femwf7_m femur work to failure 7 (mouse) Not determined 167462514 195154279 Mouse 1301385 Radpf2_m radiation pulmonary fibrosis 2 (mouse) Not determined 1 147125258 182873798 Mouse 1301134 Bmd1_m bone mineral density 1 (mouse) Not determined 1 156602037 189303617 Mouse 1302158 Fembrs5_m femur breaking strength 5 (mouse) Not determined 1 167462514 195154279 Mouse 1301132 Mors1_m modifier of obesity related sterility 1 (mouse) Not determined 1 170379500 195154279 Mouse 1357493 Lgaq3_m late growth adjusted QTL 3 (mouse) Not determined 1 150193673 188359312 Mouse 11251722 Ewc1_m ethanol withdrawal and consumption 1 (mouse) 1 152132744 186132744 Mouse 10043963 Obq25_m obesity QTL 25 (mouse) Not determined 1 154410512 188410512 Mouse 1301431 Pcho1_m plasma cholesterol 1 (mouse) Not determined 1 159262573 193262693 Mouse 1357732 Tbbmd1_m total body bone mineral density 1 (mouse) Not determined 1 171983110 195154279 Mouse 10412074 Nhdlt1_m non-HDL cholesterol and triglyceride levels 1 (mouse) Not determined 1 153675990 187676105 Mouse 1357485 Lgq4_m late growth QTL 4 (mouse) Not determined 1 150193673 188359312 Mouse 1301932 Ssta2_m susceptibility to Salmonella typhimurium antigens 2 (mouse) Not determined 1 155716221 189716369 Mouse 1301202 Yaa4_m Y-linked autoimmune acceleration 4 (mouse) Not determined 1 158468817 192468938 Mouse 10054490 Opefa_m open field activity (mouse) Not determined 1 153712853 187712853 Mouse 1300948 Fglu2_m fasting glucose 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301722 Cia9_m collagen induced arthritis QTL 9 (mouse) Not determined 1 45783900 189303617 Mouse 11059556 Lmr20b_m leishmaniasis resistance 20b (mouse) 1 158468817 192468938 Mouse 4141554 Cfmq1_m cystic fibrosis modifier QTL 1 (mouse) Not determined 1 152038741 186038913 Mouse 11059557 Lmr20a_m leishmaniasis resistance 20a (mouse) 1 158468817 192468938 Mouse 11059558 Lmr20c_m leishmaniasis resistance 20c (mouse) 1 158468817 192468938 Mouse 11049575 Lmr8b_m leishmaniasis resistance 8b (mouse) 1 172303451 195154279 Mouse 1300934 Cfbw1_m cystic fibrosis body weight 1 (mouse) Not determined 1 145145207 179145325 Mouse 1301189 Lmr8_m leishmaniasis resistance 8 (mouse) Not determined 1 156602037 189303617 Mouse 1558720 Bpq8_m blood pressure QTL 8 (mouse) Not determined 1 143284665 177284803 Mouse 13207571 Tcq11_m total cholesterol QTL 11 (mouse) 1 169137569 179647565 Mouse 10766456 Sle21_m systematic lupus erythematosus susceptibility 21 (mouse) 1 155831765 189831892 Mouse 27095935 Ulnl5_m ulna length 5, 10 week (mouse) 1 128727737 181327565 Mouse 1300727 Mptp1_m MPTP sensitivity 1 (mouse) Not determined 1 171632048 192681050 Mouse 10054271 Nba9_m New Zealand Black autoimmunity 9 (mouse) Not determined 1 155525623 189527533 Mouse 10054270 Nba10_m New Zealand Black autoimmunity 10 (mouse) Not determined 1 152794822 186438620 Mouse 1559024 Zit1_m zinc induced tolerance 1 (mouse) Not determined 1 167462514 195154279 Mouse 12880429 V25Dq1_m vitamin D inactive form serum level QTL 1 (mouse) 1 172632197 195154279 Mouse 4142291 Aec2_m autoimmune exocrinopathy 2 (mouse) Not determined 52457737 182250592 Mouse 12880426 V25Dq2_m vitamin D inactive form serum level QTL 2 (mouse) 1 172532197 195154279 Mouse 1300732 Melm2_m melanoma modifier 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301216 Cbm1_m cerebellum weight 1 (mouse) Not determined 1 157456299 191456436 Mouse 1300960 Hpic2_m haloperidol induced catalepsy 2 (mouse) Not determined 1 175468817 181400659 Mouse 27095915 Scvln13_m sacral vertebrae length 2, 16 week (mouse) 1 117527730 179827565 Mouse 26884448 Sklq1_m skull length QTL 1, 5 week (mouse) 1 75976637 181327565 Mouse 1300969 Sluc5_m susceptibility to lung cancer 5 (mouse) Not determined 1 151186243 185186402 Mouse
AA673428
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 96,630,925 - 96,631,545 UniSTS GRCm38 GRCm38 1 175,978,454 - 175,978,645 UniSTS GRCm38 MGSCv37 1 177,908,585 - 177,908,776 UniSTS GRCm37 MGSCv37 3 96,434,848 - 96,435,468 UniSTS GRCm37 Celera 1 183,058,060 - 183,058,251 UniSTS Celera 3 98,037,941 - 98,038,561 UniSTS Cytogenetic Map 3 F2.1 UniSTS Cytogenetic Map 3 H3 UniSTS Cytogenetic Map 1 H4 UniSTS Whitehead/MRC_RH 1 2194.92 UniSTS
Rbm8a
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 96,630,338 - 96,631,873 UniSTS GRCm38 GRCm38 1 175,978,245 - 175,978,806 UniSTS GRCm38 MGSCv37 3 96,434,261 - 96,435,796 UniSTS GRCm37 MGSCv37 1 177,908,376 - 177,908,937 UniSTS GRCm37 Celera 3 98,037,353 - 98,038,889 UniSTS Celera 1 183,057,851 - 183,058,412 UniSTS Cytogenetic Map 3 H3 UniSTS Cytogenetic Map 1 H4 UniSTS cM Map 3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000065967 ⟹ ENSMUSP00000069326
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 175,789,872 - 176,102,864 (-) Ensembl GRCm38.p6 Ensembl 1 175,962,306 - 176,275,298 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000111166 ⟹ ENSMUSP00000106796
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 176,088,306 - 176,102,840 (-) Ensembl GRCm38.p6 Ensembl 1 176,260,740 - 176,275,274 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000111167 ⟹ ENSMUSP00000106797
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 175,791,278 - 176,041,508 (-) Ensembl GRCm38.p6 Ensembl 1 175,963,712 - 176,213,942 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000125404 ⟹ ENSMUSP00000121428
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 175,789,973 - 176,102,878 (-) Ensembl GRCm38.p6 Ensembl 1 175,962,407 - 176,275,312 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000144340
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 175,818,537 - 176,102,841 (-) Ensembl GRCm38.p6 Ensembl 1 175,990,971 - 176,275,275 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000156184
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 175,869,870 - 176,041,407 (-) Ensembl GRCm38.p6 Ensembl 1 176,042,304 - 176,213,841 (-) Ensembl
RefSeq Acc Id:
NM_001195816 ⟹ NP_001182745
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 175,789,872 - 176,041,508 (-) NCBI GRCm38 1 175,962,306 - 176,213,942 (-) NCBI Celera 1 183,041,914 - 183,365,812 (-) ENTREZGENE cM Map 1 ENTREZGENE
Sequence:
GTTCTCAACTGAAGAGGAAAAGCCAAAGAAATGTGATTGAGCTCCGCAGCCCTCCGTGTTTGCTAAAATGCTAAACGAGGGGCCCGTGGCTCTCAGAGCATATTCCATGGGAAATGCCGAGCACAGGA
hide sequence
RefSeq Acc Id:
NM_001357844 ⟹ NP_001344773
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 175,789,872 - 176,102,878 (-) NCBI GRCm38 1 175,962,306 - 176,275,312 (-) NCBI
Sequence:
GGGGCCCGGGTTCCAGTTGGTGCGGAGCAGCCTCGAGCGGAGCTCCCGCTCGGGACCGCAGCGGCAGGCGACGTCGCGGCCACCTCCGCTGCACCCTGACTTCTGCCACTCGGGAGCAGGCATCCACT
hide sequence
RefSeq Acc Id:
NM_001357845 ⟹ NP_001344774
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 175,789,872 - 176,041,508 (-) NCBI GRCm38 1 175,962,306 - 176,213,942 (-) NCBI
Sequence:
GTTCTCAACTGAAGAGGAAAAGCCAAAGAAATGTGATTGAGCTCCGCAGCCCTCCGTGTTTGCTAAAATGCTAAACGAGGGGCCCGTGGCTCTCAGAGCATATTCCATGGGAAATGCCGAGCACAGGA
hide sequence
RefSeq Acc Id:
NM_001357846 ⟹ NP_001344775
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 175,789,872 - 176,102,878 (-) NCBI GRCm38 1 175,962,306 - 176,275,312 (-) NCBI
Sequence:
GGGGCCCGGGTTCCAGTTGGTGCGGAGCAGCCTCGAGCGGAGCTCCCGCTCGGGACCGCAGCGGCAGGCGACGTCGCGGCCACCTCCGCTGCACCCTGACTTCTGCCACTCGGGAGCAGGCATCCACT
hide sequence
RefSeq Acc Id:
NM_001357847 ⟹ NP_001344776
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 175,789,872 - 176,041,508 (-) NCBI GRCm38 1 175,962,306 - 176,213,942 (-) NCBI
Sequence:
GTTCTCAACTGAAGAGGAAAAGCCAAAGAAATGTGATTGAGCTCCGCAGCCCTCCGTGTTTGCT
hide sequence
RefSeq Acc Id:
NM_176916 ⟹ NP_795890
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 175,789,872 - 176,102,878 (-) NCBI GRCm38 1 175,962,306 - 176,275,312 (-) NCBI MGSCv37 1 177,892,437 - 178,205,443 (-) RGD Celera 1 183,041,914 - 183,365,812 (-) RGD cM Map 1 ENTREZGENE
Sequence:
GGGGCCCGGGTTCCAGTTGGTGCGGAGCAGCCTCGAGCGGAGCTCCCGCTCGGGACCGCAGCGGCAGGCGACGTCGCGGCCACCTCCGCTGCACCCTGACTTCTGCCACTCGGGAGCAGGCATCCACT
hide sequence
RefSeq Acc Id:
XM_006496897 ⟹ XP_006496960
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 175,789,867 - 176,109,078 (-) NCBI GRCm38 1 175,962,301 - 176,281,512 (-) NCBI
Sequence:
TCGTCCCATTGGTCCGAAGCAAGCCTGTCCTCCAAGTGGCAGTTCTTGATAGGCTGACATTGTCTGCATCACTAATCTCTAGGCTCTCAGGCAGGCTTCAGTTTGGCCCTCATGTGGAAGTTGCCTCC
hide sequence
RefSeq Acc Id:
XM_006496898 ⟹ XP_006496961
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 175,789,867 - 175,967,664 (-) NCBI GRCm38 1 175,962,301 - 176,140,072 (-) NCBI
Sequence:
TCTCAGCAGAAGTGCATCGTGATCTTCGCTCTGGTCTGCTGCTTCGCCGTTCTGGTCGCTCTCA
hide sequence
RefSeq Acc Id:
XM_006496900 ⟹ XP_006496963
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 175,789,867 - 176,109,078 (-) NCBI GRCm38 1 175,962,301 - 176,275,279 (-) NCBI
Sequence:
TCGTCCCATTGGTCCGAAGCAAGCCTGTCCTCCAAGTGGCAGTTCTTGATAGGCTGACATTGTC
hide sequence
RefSeq Acc Id:
XM_011238827 ⟹ XP_011237129
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 175,789,867 - 175,967,664 (-) NCBI GRCm38 1 175,962,301 - 176,140,073 (-) NCBI
Sequence:
TCTCAGCAGAAGTGCATCGTGATCTTCGCTCTGGTCTGCTGCTTCGCCGTTCTGGTCGCTCTCATCTTTTCAGCGGTGGACATCATGGGAGAGGATGAGGATGGACTCTCAGAGAAGAATTGCCAAAA
hide sequence
RefSeq Acc Id:
XM_030254896 ⟹ XP_030110756
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 175,789,867 - 176,076,534 (-) NCBI GRCm38 1 175,962,301 - 176,252,130 (-) NCBI
Sequence:
AGAAGGCGTGTAATTCAGAGTTCTGAGACACTGTTGTGGTCTGAGAAGCATCCCTGGTTGAATAGCAGGCTAGCAGGCACACTAAAGAAAGCAACTCTTTCCCTGCCAGCGATGGTTGCAAAAACAAA
hide sequence
RefSeq Acc Id:
XM_030254898 ⟹ XP_030110758
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 175,789,867 - 176,076,538 (-) NCBI GRCm38 1 175,962,301 - 176,252,131 (-) NCBI
Sequence:
AATCAGAAGGCGTGTAATTCAGAGTTCTGAGACACTGTTGTGGTCTGAGAAGCATCCCTGGTTG
hide sequence
RefSeq Acc Id:
XM_030254901 ⟹ XP_030110761
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 175,789,867 - 176,041,638 (-) NCBI GRCm38 1 175,962,301 - 176,140,083 (-) NCBI
Sequence:
TAGGAAGCAGTCGGTTTCTTTTGCTCAGGTTGGTGGCGTGTGGCCATCTACACACTGAGTGCCCGCATCTTCCATCTCCAGGGTCAGTGTGAGCCTGTGCTGTAATTTCACTCCAGGAAGCCGCACGG
hide sequence
RefSeq Acc Id:
XM_030254909 ⟹ XP_030110769
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 175,789,867 - 176,102,865 (-) NCBI GRCm38 1 175,962,301 - 176,275,299 (-) NCBI
Sequence:
CAGTTGGTGCGGAGCAGCCTCGAGCGGAGCTCCCGCTCGGGACCGCAGCGGCAGGCGACGTCGC
hide sequence
RefSeq Acc Id:
XM_036165683 ⟹ XP_036021576
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 175,789,867 - 176,041,654 (-) NCBI
Sequence:
TGTCTGTTTCTCTGATTAGGAAGCAGTCGGTTTCTTTTGCTCAGGTTGGTGGCGTGTGGCCATC
hide sequence
RefSeq Acc Id:
NP_795890 ⟸ NM_176916
- Peptide Label:
isoform 1
- UniProtKB:
Q3UVW3 (UniProtKB/Swiss-Prot), Q497Q7 (UniProtKB/Swiss-Prot), Q3UNN8 (UniProtKB/Swiss-Prot)
- Sequence:
MEIRQHEWLSASPHEGFEQMRLKSRPKEPSPSLTRVGANFYSSVKQQDYSASVWLRRKDKLEHSQQKCIVIFALVCCFAVLVALIFSAVDIMGEDEDGLSEKNCQNKCRIALVENIPEGLNYSEDAPF
hide sequence
RefSeq Acc Id:
NP_001182745 ⟸ NM_001195816
- Peptide Label:
isoform 2 precursor
- UniProtKB:
D3YYN6 (UniProtKB/TrEMBL)
- Sequence:
MSQQKCIVIFALVCCFAVLVALIFSAVDIMGEDEDGLSEKNCQNKCRIALVENIPEGLNYSEDA
hide sequence
RefSeq Acc Id:
XP_006496960 ⟸ XM_006496897
- Peptide Label:
isoform X1
- Sequence:
MEIRQHEWLSASPHEGFEQMRLKSRPKEPSPSLTRVGANFYSSVKQQDYSASVWLRRKDKLEHS
hide sequence
RefSeq Acc Id:
XP_006496963 ⟸ XM_006496900
- Peptide Label:
isoform X7
- UniProtKB:
Q3UNN8 (UniProtKB/Swiss-Prot)
- Sequence:
MNMTAYNKGRLQSSFWIVDKQHVYIGSAGLDWRSLGQMKELGVIFYNCSCLVLDLQRIFALYSS
hide sequence
RefSeq Acc Id:
XP_006496961 ⟸ XM_006496898
- Peptide Label:
isoform X5
- Sequence:
MSGQRLFEKLLQLTSQNIEVKLVSDVTADSKVLEALKLKGAEVTYMNMTAYNKGRLQSSFWIVD
hide sequence
RefSeq Acc Id:
XP_011237129 ⟸ XM_011238827
- Peptide Label:
isoform X6
- Sequence:
MSVRGAEVTYMNMTAYNKGRLQSSFWIVDKQHVYIGSAGLDWRSLGQMKELGVIFYNCSCLVLD
hide sequence
RefSeq Acc Id:
XP_030110769 ⟸ XM_030254909
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_030110758 ⟸ XM_030254898
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_030110756 ⟸ XM_030254896
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_030110761 ⟸ XM_030254901
- Peptide Label:
isoform X4
RefSeq Acc Id:
NP_001344775 ⟸ NM_001357846
- Peptide Label:
isoform 4
RefSeq Acc Id:
NP_001344773 ⟸ NM_001357844
- Peptide Label:
isoform 3
RefSeq Acc Id:
NP_001344776 ⟸ NM_001357847
- Peptide Label:
isoform 4
RefSeq Acc Id:
NP_001344774 ⟸ NM_001357845
- Peptide Label:
isoform 3
Ensembl Acc Id:
ENSMUSP00000106796 ⟸ ENSMUST00000111166
Ensembl Acc Id:
ENSMUSP00000106797 ⟸ ENSMUST00000111167
Ensembl Acc Id:
ENSMUSP00000121428 ⟸ ENSMUST00000125404
Ensembl Acc Id:
ENSMUSP00000069326 ⟸ ENSMUST00000065967
RefSeq Acc Id:
XP_036021576 ⟸ XM_036165683
- Peptide Label:
isoform X7
RGD ID: 6875852 Promoter ID: EPDNEW_M1377 Type: initiation region Name: Pld5_1 Description: Mus musculus phospholipase D family, member 5 , transcript variant2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 176,275,265 - 176,275,325 EPDNEW
RGD ID: 6818250 Promoter ID: MM_KWN:3025 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: OTTMUST00000059165, UC007DTV.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 178,143,671 - 178,144,171 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2023-09-13
Pld5
phospholipase D family member 5
Pld5
phospholipase D family, member 5
Symbol and/or name change
5135510 APPROVED
