Symbol:
Syne2
Name:
spectrin repeat containing, nuclear envelope 2
RGD ID:
1615570
MGI Page
MGI
Description:
Enables actin binding activity. Involved in several processes, including centrosome localization; nuclear migration; and regulation of cilium assembly. Located in Z disc and nuclear membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; integumental system; and sensory organ. Human ortholog(s) of this gene implicated in autosomal dominant Emery-Dreifuss muscular dystrophy 5. Orthologous to human SYNE2 (spectrin repeat containing nuclear envelope protein 2).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
6820443O06Rik; AW546258; Cpf; Cpfl8; D12Ertd777; D12Ertd777e; dic; dice; diminished cone electroretinogram; KASH domain-containing protein 2; KASH2; MGC96690; mKIAA1011; nes; Nesp2g; nesprin 2; nesprin-2; NUA; nuance; nuclear envelope spectrin repeat protein 2; nucleus and actin connecting element protein; synaptic nuclear envelope 2; synaptic nuclear envelope protein 2; syne; syne-2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SYNE2 (spectrin repeat containing nuclear envelope protein 2) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Syne2 (spectrin repeat containing nuclear envelope protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Syne2 (spectrin repeat containing nuclear envelope protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SYNE2 (spectrin repeat containing nuclear envelope protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SYNE2 (spectrin repeat containing nuclear envelope protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Syne2 (spectrin repeat containing nuclear envelope protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SYNE2 (spectrin repeat containing nuclear envelope protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SYNE2 (spectrin repeat containing nuclear envelope protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Syne2 (spectrin repeat containing nuclear envelope protein 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SYNE1 (spectrin repeat containing nuclear envelope protein 1) HGNC
OrthoMCL
Alliance orthologs 3
Homo sapiens (human):
SYNE2 (spectrin repeat containing nuclear envelope protein 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
syne2a (spectrin repeat containing, nuclear envelope 2a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
syne2b (spectrin repeat containing, nuclear envelope 2b)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PhylomeDB|ZFIN)
Caenorhabditis elegans (roundworm):
anc-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA)
Drosophila melanogaster (fruit fly):
Msp300
Alliance
DIOPT (Hieranoid|OrthoFinder)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 75,865,092 - 76,157,702 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 75,864,908 - 76,157,700 (+) Ensembl GRCm39 Ensembl GRCm38 12 75,818,318 - 76,110,928 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 75,818,134 - 76,110,926 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 76,919,305 - 77,211,915 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 76,772,909 - 77,029,768 (+) NCBI MGSCv36 mm8 Celera 12 76,923,010 - 77,205,661 (+) NCBI Celera Cytogenetic Map 12 C3 NCBI cM Map 12 33.11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Syne2 Mouse (-)-demecolcine decreases expression ISO SYNE2 (Homo sapiens) 6480464 Demecolcine results in decreased expression of SYNE2 mRNA CTD PMID:23649840 Syne2 Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SYNE2 mRNA CTD PMID:22079256 Syne2 Mouse (-)-epigallocatechin 3-gallate increases expression ISO SYNE2 (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of SYNE2 mRNA CTD PMID:22079256 Syne2 Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of SYNE2 mRNA CTD PMID:28960355 Syne2 Mouse 1,2-dimethylhydrazine affects expression EXP 6480464 1 and 2-Dimethylhydrazine affects the expression of SYNE2 mRNA CTD PMID:22206623 Syne2 Mouse 1,3-benzothiazole-2-thiol decreases expression ISO SYNE2 (Homo sapiens) 6480464 captax results in decreased expression of SYNE2 mRNA CTD PMID:24211530 Syne2 Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of SYNE2 mRNA CTD PMID:17555576 Syne2 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of SYNE2 mRNA CTD PMID:39298647 Syne2 Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Syne2 Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO SYNE2 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Syne2 Mouse 2,2',5,5'-tetrachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Syne2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SYNE2 mRNA CTD PMID:19933214 Syne2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SYNE2 mRNA CTD PMID:33956508 Syne2 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2 more ... CTD PMID:38648751 Syne2 Mouse 2-methylcholine affects expression ISO SYNE2 (Homo sapiens) 6480464 beta-methylcholine affects the expression of SYNE2 mRNA CTD PMID:21179406 Syne2 Mouse 2-palmitoylglycerol increases expression ISO SYNE2 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of SYNE2 mRNA CTD PMID:37199045 Syne2 Mouse 3,3',5,5'-tetrabromobisphenol A decreases expression ISO SYNE2 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of SYNE2 protein CTD PMID:31675489 Syne2 Mouse 3-phenylprop-2-enal decreases expression ISO SYNE2 (Homo sapiens) 6480464 cinnamaldehyde results in decreased expression of SYNE2 mRNA CTD PMID:24211530 Syne2 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of SYNE2 mRNA CTD PMID:39298647 Syne2 Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of SYNE2 gene CTD PMID:31683443 Syne2 Mouse 4,4'-sulfonyldiphenol decreases methylation ISO SYNE2 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of SYNE2 gene CTD PMID:31601247 Syne2 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of SYNE2 mRNA CTD PMID:28973697 Syne2 Mouse 6-propyl-2-thiouracil increases expression ISO Syne2 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of SYNE2 mRNA CTD PMID:24780913 Syne2 Mouse 6-propyl-2-thiouracil decreases expression ISO Syne2 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of SYNE2 mRNA CTD PMID:30047161 Syne2 Mouse 7beta-aminocephalosporanic acid decreases expression ISO SYNE2 (Homo sapiens) 6480464 7-aminocephalosporanic acid results in decreased expression of SYNE2 mRNA CTD PMID:24211530 Syne2 Mouse acrolein decreases expression ISO SYNE2 (Homo sapiens) 6480464 Acrolein results in decreased expression of SYNE2 mRNA CTD PMID:24211530 Syne2 Mouse acrolein multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of SYNE2 mRNA more ... CTD PMID:32699268 and PMID:32845096 Syne2 Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of SYNE2 mRNA CTD PMID:19770486 Syne2 Mouse aflatoxin B1 increases methylation ISO SYNE2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of SYNE2 intron CTD PMID:30157460 Syne2 Mouse Aflatoxin B2 alpha increases methylation ISO SYNE2 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of SYNE2 intron CTD PMID:30157460 Syne2 Mouse alpha-pinene multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of SYNE2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of SYNE2 mRNA CTD PMID:32699268 Syne2 Mouse ammonium hexachloroplatinate decreases expression ISO SYNE2 (Homo sapiens) 6480464 ammonium hexachloroplatinate results in decreased expression of SYNE2 mRNA CTD PMID:24211530 Syne2 Mouse aristolochic acid A decreases expression ISO SYNE2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SYNE2 mRNA and aristolochic acid I results in decreased expression of SYNE2 protein CTD PMID:33212167 Syne2 Mouse arsane multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SYNE2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SYNE2 mRNA CTD PMID:39836092 Syne2 Mouse arsenic atom multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SYNE2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SYNE2 mRNA CTD PMID:39836092 Syne2 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of SYNE2 mRNA CTD PMID:21715664 Syne2 Mouse benzo[a]pyrene increases methylation ISO SYNE2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SYNE2 5' UTR and Benzo(a)pyrene results in increased methylation of SYNE2 exon CTD PMID:27901495 Syne2 Mouse benzo[a]pyrene affects methylation ISO SYNE2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SYNE2 3' UTR and Benzo(a)pyrene affects the methylation of SYNE2 intron CTD PMID:27901495 and PMID:30157460 Syne2 Mouse benzo[a]pyrene decreases methylation EXP 6480464 Benzo(a)pyrene results in decreased methylation of SYNE2 exon and Benzo(a)pyrene results in decreased methylation of SYNE2 intron CTD PMID:27901495 Syne2 Mouse benzo[a]pyrene decreases methylation ISO SYNE2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of SYNE2 promoter CTD PMID:27901495 Syne2 Mouse benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of SYNE2 mRNA CTD PMID:27858113 Syne2 Mouse benzo[a]pyrene decreases expression ISO SYNE2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SYNE2 mRNA CTD PMID:22316170 and PMID:26238291 Syne2 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO SYNE2 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:26238291 Syne2 Mouse benzo[b]fluoranthene decreases expression EXP 6480464 benzo(b)fluoranthene results in decreased expression of SYNE2 mRNA CTD PMID:26377693 Syne2 Mouse benzo[b]fluoranthene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of SYNE2 mRNA CTD PMID:27858113 Syne2 Mouse benzo[e]pyrene decreases methylation ISO SYNE2 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of SYNE2 intron CTD PMID:30157460 Syne2 Mouse beta-lapachone decreases expression ISO SYNE2 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of SYNE2 mRNA CTD PMID:38218311 Syne2 Mouse bis(2-ethylhexyl) phthalate multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of SYNE2 gene CTD PMID:33872906 Syne2 Mouse bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of SYNE2 mRNA CTD PMID:33754040 Syne2 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of SYNE2 mRNA CTD PMID:34319233 Syne2 Mouse bisphenol A affects expression ISO Syne2 (Rattus norvegicus) 6480464 bisphenol A affects the expression of SYNE2 mRNA CTD PMID:25181051 Syne2 Mouse bisphenol A increases methylation ISO SYNE2 (Homo sapiens) 6480464 bisphenol A results in increased methylation of SYNE2 gene CTD PMID:31601247 Syne2 Mouse bisphenol A multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of SYNE2 gene CTD PMID:31601247 Syne2 Mouse bisphenol A decreases expression ISO SYNE2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SYNE2 protein CTD PMID:33376534 and PMID:37567409 Syne2 Mouse bisphenol A decreases expression ISO Syne2 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of SYNE2 mRNA CTD PMID:30816183 and PMID:34947998 Syne2 Mouse butanal decreases expression ISO SYNE2 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of SYNE2 mRNA CTD PMID:26079696 Syne2 Mouse cadmium dichloride decreases expression ISO SYNE2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SYNE2 mRNA CTD PMID:38568856 Syne2 Mouse caffeine decreases phosphorylation ISO SYNE2 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of SYNE2 protein CTD PMID:35688186 Syne2 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Syne2 Mouse cefaloridine decreases expression ISO Syne2 (Rattus norvegicus) 6480464 Cephaloridine results in decreased expression of SYNE2 mRNA CTD PMID:18500788 Syne2 Mouse CGP 52608 multiple interactions ISO SYNE2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SYNE2 gene] CTD PMID:28238834 Syne2 Mouse chloropicrin decreases expression ISO SYNE2 (Homo sapiens) 6480464 chloropicrin results in decreased expression of SYNE2 mRNA CTD PMID:24211530 Syne2 Mouse chrysene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of SYNE2 mRNA CTD PMID:27858113 Syne2 Mouse cisplatin multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of SYNE2 mRNA CTD PMID:27392435 Syne2 Mouse cisplatin increases expression ISO SYNE2 (Homo sapiens) 6480464 Cisplatin results in increased expression of SYNE2 mRNA CTD PMID:27392435 Syne2 Mouse clobetasol decreases expression EXP 6480464 Clobetasol results in decreased expression of SYNE2 mRNA CTD PMID:27462272 Syne2 Mouse clotrimazole decreases expression ISO Syne2 (Rattus norvegicus) 6480464 Clotrimazole results in decreased expression of SYNE2 mRNA CTD PMID:30047161 Syne2 Mouse copper(II) chloride decreases expression ISO SYNE2 (Homo sapiens) 6480464 cupric chloride results in decreased expression of SYNE2 mRNA CTD PMID:38568856 Syne2 Mouse coumestrol increases expression ISO SYNE2 (Homo sapiens) 6480464 Coumestrol results in increased expression of SYNE2 mRNA CTD PMID:19167446 Syne2 Mouse Cuprizon increases expression ISO Syne2 (Rattus norvegicus) 6480464 Cuprizone results in increased expression of SYNE2 mRNA CTD PMID:26577399 Syne2 Mouse DDE decreases expression ISO SYNE2 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of SYNE2 mRNA CTD PMID:38568856 Syne2 Mouse DDT decreases expression ISO Syne2 (Rattus norvegicus) 6480464 DDT results in decreased expression of SYNE2 mRNA CTD PMID:30207508 Syne2 Mouse decabromodiphenyl ether decreases expression ISO SYNE2 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of SYNE2 protein CTD PMID:31675489 Syne2 Mouse dextran sulfate multiple interactions EXP 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of SYNE2 protein] CTD PMID:35362542 Syne2 Mouse dextran sulfate increases expression EXP 6480464 Dextran Sulfate results in increased expression of SYNE2 protein CTD PMID:35362542 Syne2 Mouse diallyl trisulfide decreases expression ISO SYNE2 (Homo sapiens) 6480464 diallyl trisulfide results in decreased expression of SYNE2 mRNA CTD PMID:34995734 Syne2 Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of SYNE2 mRNA CTD PMID:30529165 Syne2 Mouse diuron decreases expression ISO SYNE2 (Homo sapiens) 6480464 Diuron results in decreased expression of SYNE2 mRNA CTD PMID:35967413 Syne2 Mouse dorsomorphin multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SYNE2 mRNA CTD PMID:27188386 Syne2 Mouse doxorubicin decreases expression ISO SYNE2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SYNE2 mRNA CTD PMID:29803840 Syne2 Mouse epichlorohydrin decreases expression ISO SYNE2 (Homo sapiens) 6480464 Epichlorohydrin results in decreased expression of SYNE2 mRNA CTD PMID:24211530 Syne2 Mouse ethyl methanesulfonate increases expression ISO SYNE2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of SYNE2 mRNA CTD PMID:23649840 Syne2 Mouse Evodiamine multiple interactions EXP 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of SYNE2 protein] CTD PMID:35362542 Syne2 Mouse finasteride increases expression ISO Syne2 (Rattus norvegicus) 6480464 Finasteride results in increased expression of SYNE2 mRNA CTD PMID:24136188 Syne2 Mouse flutamide decreases expression ISO Syne2 (Rattus norvegicus) 6480464 Flutamide results in decreased expression of SYNE2 mRNA CTD PMID:24136188 Syne2 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of SYNE2 mRNA CTD PMID:25629700 Syne2 Mouse formaldehyde increases expression ISO SYNE2 (Homo sapiens) 6480464 Formaldehyde results in increased expression of SYNE2 mRNA CTD PMID:27664576 Syne2 Mouse FR900359 increases phosphorylation ISO SYNE2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of SYNE2 protein CTD PMID:37730182 Syne2 Mouse fulvestrant multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of SYNE2 gene CTD PMID:31601247 Syne2 Mouse glafenine decreases expression ISO Syne2 (Rattus norvegicus) 6480464 Glafenine results in decreased expression of SYNE2 mRNA CTD PMID:24136188 Syne2 Mouse glycidol decreases expression ISO Syne2 (Rattus norvegicus) 6480464 glycidol results in decreased expression of SYNE2 mRNA CTD PMID:24395379 Syne2 Mouse hexamethylene diisocyanate decreases expression ISO SYNE2 (Homo sapiens) 6480464 1 and 6-hexamethylene diisocyanate results in decreased expression of SYNE2 mRNA CTD PMID:24211530 Syne2 Mouse hydrogen peroxide multiple interactions EXP 6480464 [Hydrogen Peroxide co-treated with N-(oxo-5 more ... CTD PMID:31494107 Syne2 Mouse ivermectin decreases expression ISO SYNE2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SYNE2 protein CTD PMID:32959892 Syne2 Mouse lead(0) affects splicing ISO SYNE2 (Homo sapiens) 6480464 Lead affects the splicing of SYNE2 mRNA CTD PMID:28903495 Syne2 Mouse manganese atom multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SYNE2 mRNA CTD PMID:39836092 Syne2 Mouse manganese(0) multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SYNE2 mRNA CTD PMID:39836092 Syne2 Mouse manganese(II) chloride multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SYNE2 mRNA CTD PMID:39836092 Syne2 Mouse methapyrilene decreases methylation ISO SYNE2 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of SYNE2 intron CTD PMID:30157460 Syne2 Mouse methimazole decreases expression ISO Syne2 (Rattus norvegicus) 6480464 Methimazole results in decreased expression of SYNE2 mRNA CTD PMID:30047161 Syne2 Mouse methoxychlor affects methylation ISO Syne2 (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of SYNE2 gene CTD PMID:35440735 Syne2 Mouse methyl methanesulfonate increases expression ISO SYNE2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of SYNE2 mRNA CTD PMID:23649840 Syne2 Mouse methylmercury chloride decreases expression ISO SYNE2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of SYNE2 mRNA CTD PMID:28001369 Syne2 Mouse mono(2-ethylhexyl) phthalate multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of SYNE2 gene CTD PMID:33872906 Syne2 Mouse N-ethyl-N-nitrosourea increases mutagenesis EXP 6480464 Ethylnitrosourea results in increased mutagenesis of SYNE2 intron CTD PMID:27776689 Syne2 Mouse N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of SYNE2 protein CTD PMID:26558463 Syne2 Mouse nefazodone decreases expression ISO Syne2 (Rattus norvegicus) 6480464 nefazodone results in decreased expression of SYNE2 mRNA CTD PMID:24136188 Syne2 Mouse ozone multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of SYNE2 mRNA more ... CTD PMID:32699268 and PMID:32845096 Syne2 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of SYNE2 mRNA CTD PMID:27106289 Syne2 Mouse paracetamol decreases expression ISO SYNE2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SYNE2 mRNA CTD PMID:21420995 Syne2 Mouse PCB138 multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Syne2 Mouse picoxystrobin decreases expression ISO SYNE2 (Homo sapiens) 6480464 picoxystrobin results in decreased expression of SYNE2 mRNA CTD PMID:33512557 Syne2 Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of SYNE2 mRNA CTD PMID:18445702 Syne2 Mouse potassium chromate decreases expression ISO SYNE2 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of SYNE2 mRNA CTD PMID:22079256 Syne2 Mouse potassium chromate multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SYNE2 mRNA CTD PMID:22079256 Syne2 Mouse propylparaben decreases expression ISO SYNE2 (Homo sapiens) 6480464 propylparaben results in decreased expression of SYNE2 mRNA CTD PMID:38568856 Syne2 Mouse quercetin increases phosphorylation ISO SYNE2 (Homo sapiens) 6480464 Quercetin results in increased phosphorylation of SYNE2 protein CTD PMID:35688186 Syne2 Mouse rotenone decreases expression ISO Syne2 (Rattus norvegicus) 6480464 Rotenone results in decreased expression of SYNE2 mRNA CTD PMID:28374803 Syne2 Mouse rotenone decreases expression ISO SYNE2 (Homo sapiens) 6480464 Rotenone results in decreased expression of SYNE2 mRNA CTD PMID:33512557 Syne2 Mouse SB 431542 multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Syne2 Mouse sodium arsenite decreases expression ISO SYNE2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SYNE2 mRNA CTD PMID:38568856 Syne2 Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of SYNE2 mRNA CTD PMID:36209798 Syne2 Mouse sodium arsenite multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of SYNE2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SYNE2 mRNA CTD PMID:39836092 Syne2 Mouse sulfadimethoxine decreases expression ISO Syne2 (Rattus norvegicus) 6480464 Sulfadimethoxine results in decreased expression of SYNE2 mRNA CTD PMID:30047161 Syne2 Mouse sunitinib decreases expression ISO SYNE2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of SYNE2 mRNA CTD PMID:31533062 Syne2 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of SYNE2 mRNA CTD PMID:20937368 Syne2 Mouse tebufenpyrad decreases expression ISO SYNE2 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of SYNE2 mRNA CTD PMID:33512557 Syne2 Mouse tetrachloromethane decreases expression ISO Syne2 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of SYNE2 mRNA CTD PMID:30723492 Syne2 Mouse tetraphene decreases expression EXP 6480464 benz(a)anthracene results in decreased expression of SYNE2 mRNA CTD PMID:26377693 Syne2 Mouse tetraphene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of SYNE2 mRNA CTD PMID:27858113 Syne2 Mouse thimerosal decreases expression ISO SYNE2 (Homo sapiens) 6480464 Thimerosal results in decreased expression of SYNE2 mRNA CTD PMID:27188386 Syne2 Mouse thiram decreases expression ISO SYNE2 (Homo sapiens) 6480464 Thiram results in decreased expression of SYNE2 mRNA CTD PMID:24211530 Syne2 Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of SYNE2 mRNA CTD PMID:29264374 Syne2 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of SYNE2 gene CTD PMID:35295148 Syne2 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of SYNE2 gene CTD PMID:35295148 Syne2 Mouse trichostatin A decreases expression ISO SYNE2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of SYNE2 mRNA CTD PMID:24935251 Syne2 Mouse trichostatin A multiple interactions ISO SYNE2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SYNE2 mRNA CTD PMID:27188386 Syne2 Mouse triphenyl phosphate affects expression ISO SYNE2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SYNE2 mRNA CTD PMID:37042841 Syne2 Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of SYNE2 mRNA CTD PMID:33045310 Syne2 Mouse troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of SYNE2 mRNA CTD PMID:28973697 Syne2 Mouse trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of SYNE2 mRNA CTD PMID:35537566 Syne2 Mouse valproic acid decreases expression ISO SYNE2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SYNE2 mRNA CTD PMID:23179753 and PMID:28001369 Syne2 Mouse valproic acid decreases expression ISO Syne2 (Rattus norvegicus) 6480464 Valproic Acid results in decreased expression of SYNE2 mRNA CTD PMID:29427782 Syne2 Mouse vincristine decreases expression ISO SYNE2 (Homo sapiens) 6480464 Vincristine results in decreased expression of SYNE2 mRNA CTD PMID:23649840 Syne2 Mouse vorinostat decreases expression ISO SYNE2 (Homo sapiens) 6480464 vorinostat results in decreased expression of SYNE2 mRNA CTD PMID:27188386
(-)-demecolcine (ISO) (-)-epigallocatechin 3-gallate (ISO) 1,2-dichloroethane (EXP) 1,2-dimethylhydrazine (EXP) 1,3-benzothiazole-2-thiol (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2-methylcholine (ISO) 2-palmitoylglycerol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-phenylprop-2-enal (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (EXP) 6-propyl-2-thiouracil (ISO) 7beta-aminocephalosporanic acid (ISO) acrolein (ISO) aflatoxin B1 (EXP,ISO) Aflatoxin B2 alpha (ISO) alpha-pinene (ISO) ammonium hexachloroplatinate (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (EXP) benzo[e]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (ISO) butanal (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (EXP) cefaloridine (ISO) CGP 52608 (ISO) chloropicrin (ISO) chrysene (EXP) cisplatin (ISO) clobetasol (EXP) clotrimazole (ISO) copper(II) chloride (ISO) coumestrol (ISO) Cuprizon (ISO) DDE (ISO) DDT (ISO) decabromodiphenyl ether (ISO) dextran sulfate (EXP) diallyl trisulfide (ISO) dioxygen (EXP) diuron (ISO) dorsomorphin (ISO) doxorubicin (ISO) epichlorohydrin (ISO) ethyl methanesulfonate (ISO) Evodiamine (EXP) finasteride (ISO) flutamide (ISO) folic acid (EXP) formaldehyde (ISO) FR900359 (ISO) fulvestrant (ISO) glafenine (ISO) glycidol (ISO) hexamethylene diisocyanate (ISO) hydrogen peroxide (EXP) ivermectin (ISO) lead(0) (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methimazole (ISO) methoxychlor (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) N-ethyl-N-nitrosourea (EXP) N-methyl-4-phenylpyridinium (EXP) nefazodone (ISO) ozone (EXP,ISO) paracetamol (ISO) PCB138 (EXP) picoxystrobin (ISO) pirinixic acid (EXP) potassium chromate (ISO) propylparaben (ISO) quercetin (ISO) rotenone (ISO) SB 431542 (ISO) sodium arsenite (EXP,ISO) sulfadimethoxine (ISO) sunitinib (ISO) tamoxifen (EXP) tebufenpyrad (ISO) tetrachloromethane (ISO) tetraphene (EXP) thimerosal (ISO) thiram (ISO) titanium dioxide (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (EXP) troglitazone (EXP) trovafloxacin (EXP) valproic acid (ISO) vincristine (ISO) vorinostat (ISO)
Cellular Component
cilium (IEA) cytoplasm (ISO) fibrillar center (IEA) filopodium membrane (IEA,ISO) focal adhesion (IEA,ISO) intermediate filament cytoskeleton (IEA,ISO) lamellipodium membrane (IEA,ISO) meiotic nuclear membrane microtubule tethering complex (IEA,ISO) mitochondrion (IEA,ISO) myofibril (IDA) nuclear envelope (IDA,ISO,TAS) nuclear lumen (ISO) nuclear membrane (IDA,ISO) nuclear outer membrane (IEA) nucleoplasm (IEA) nucleus (ISO) sarcoplasmic reticulum (ISO) sarcoplasmic reticulum membrane (IEA) Z disc (IDA,ISO)
Syne2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 75,865,092 - 76,157,702 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 75,864,908 - 76,157,700 (+) Ensembl GRCm39 Ensembl GRCm38 12 75,818,318 - 76,110,928 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 75,818,134 - 76,110,926 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 76,919,305 - 77,211,915 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 76,772,909 - 77,029,768 (+) NCBI MGSCv36 mm8 Celera 12 76,923,010 - 77,205,661 (+) NCBI Celera Cytogenetic Map 12 C3 NCBI cM Map 12 33.11 NCBI
SYNE2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 63,761,596 - 64,226,449 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 63,761,899 - 64,226,433 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 64,319,722 - 64,693,167 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 63,389,436 - 63,762,920 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 63,612,085 - 63,762,903 NCBI Celera 14 44,377,022 - 44,750,869 (+) NCBI Celera Cytogenetic Map 14 q23.2 NCBI HuRef 14 44,548,587 - 44,865,749 (+) NCBI HuRef CHM1_1 14 64,258,594 - 64,632,989 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 57,969,282 - 58,434,164 (+) NCBI T2T-CHM13v2.0
Syne2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 100,272,729 - 100,586,364 (+) NCBI GRCr8 mRatBN7.2 6 94,537,088 - 94,848,085 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 94,537,088 - 94,848,064 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 6 98,884,269 - 99,153,551 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 98,844,926 - 99,153,551 (+) NCBI Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 108,300,643 - 108,565,625 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 98,457,147 - 98,601,686 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 98,460,902 - 98,605,226 (+) NCBI Celera 6 93,001,776 - 93,273,770 (+) NCBI Celera Cytogenetic Map 6 q24 NCBI
Syne2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955466 5,646,516 - 5,926,382 (-) NCBI ChiLan1.0 ChiLan1.0
SYNE2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 64,969,228 - 65,338,128 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 64,185,749 - 64,554,042 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 44,438,851 - 44,807,710 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 62,694,928 - 63,064,136 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 62,751,560 - 63,064,136 (+) Ensembl panpan1.1 panPan2
SYNE2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 38,373,900 - 38,643,544 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 38,373,964 - 38,643,240 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 38,066,748 - 38,335,928 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 38,601,180 - 38,866,632 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 38,550,295 - 38,866,628 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 38,217,742 - 38,486,813 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 38,289,976 - 38,558,948 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 38,650,638 - 38,919,080 (+) NCBI UU_Cfam_GSD_1.0
Syne2
SYNE2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 193,911,965 - 194,264,354 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 193,909,563 - 194,352,550 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 215,795,839 - 216,243,192 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SYNE2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 41,054,609 - 41,443,067 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 41,054,621 - 41,443,436 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 29,245,733 - 29,619,251 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Syne2
.
Predicted Target Of
Count of predictions: 2913 Count of miRNA genes: 756 Interacting mature miRNAs: 1009 Transcripts: ENSMUST00000044217, ENSMUST00000085280, ENSMUST00000124685, ENSMUST00000126903, ENSMUST00000131480, ENSMUST00000132161, ENSMUST00000133623, ENSMUST00000139204, ENSMUST00000142864, ENSMUST00000143031, ENSMUST00000148324, ENSMUST00000148825, ENSMUST00000150317, ENSMUST00000151286, ENSMUST00000154509, ENSMUST00000154762, ENSMUST00000157033 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
14746976 Manh73_m mandible shape 73 (mouse) 12 65857131 99857131 Mouse 27226776 Tibl6_m tibia length 6, 5 week (mouse) 12 60646786 92666774 Mouse 1301337 Cdcs8_m cytokine deficiency colitis susceptibility 8 (mouse) Not determined 12 64689083 98689229 Mouse 1300633 Cdcs7_m cytokine deficiency colitis susceptibility 7 (mouse) Not determined 12 64689083 98689229 Mouse 27226771 Tibl14_m tibia length 14, 10 week (mouse) 12 68346774 98766259 Mouse 4142002 Tbqt3_m tibia bone quality traits 3 (mouse) Not determined 12 35285496 109936243 Mouse 12832727 Ahrq1_m airway hyperresponsiveness QTL 1 (mouse) 12 54695910 82665939 Mouse 1558978 Cplaq10_m circadian period of locomotor activity 10 (mouse) Not determined 12 15341026 79040364 Mouse 1301574 Lmblgq5_m limb length QTL 5 (mouse) Not determined 12 17596447 80956883 Mouse 4141738 Tgq23_m triglyceride QTL 23 (mouse) Not determined 72112877 106112877 Mouse 13207568 Tcq14_m total cholesterol QTL 14 (mouse) 12 11660001 97176774 Mouse 27226753 Femd7_m femur midshaft diameter 7, 10 week (mouse) 12 9550000 84146774 Mouse 1357749 Vtbt13_m vertebral trabecular bone trait 13 (mouse) Not determined 12 53132002 87132145 Mouse 4142234 Tmc1m3_m Tmc1 modifier 3 (mouse) Not determined 12 5418440 77031203 Mouse 1301046 Par3_m pulmonary adenoma resistance 3 (mouse) Not determined 12 63956708 97956883 Mouse 1357757 Lnopy2_m lens opacity 2 (mouse) Not determined 12 52846626 86846796 Mouse 1301689 Skull18_m skull morphology 18 (mouse) Not determined 12 73887422 107887526 Mouse 10043895 Bw20_m body weight QTL 20 (mouse) Not determined 12 62308252 96308252 Mouse 27226797 Scvln19_m sacral vertebrae length 2, 16 week (mouse) 12 62146786 99466259 Mouse 1357479 Splwt1_m spleen weight 1 (mouse) Not determined 12 41693175 90887526 Mouse 10043948 Pbft6_m percent body fat 6 (mouse) Not determined 12 61205427 95205427 Mouse 1301926 Adip6_m adiposity 6 (mouse) Not determined 12 73887422 107887526 Mouse 27226793 Feml10_m femur length 10, 5 week (mouse) 12 68346774 113363620 Mouse 27226728 Tibl20_m tibia length 20, 16 week (mouse) 12 59146786 93866774 Mouse 1301476 Pbwg12_m postnatal body weight growth 12 (mouse) Not determined 12 62040164 96040364 Mouse
AW546258
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 12 76,110,447 - 76,110,567 UniSTS GRCm38 MGSCv37 12 77,211,434 - 77,211,554 UniSTS GRCm37 Celera 12 77,205,183 - 77,205,303 UniSTS Cytogenetic Map 12 C3 UniSTS cM Map 12 33.0 UniSTS Whitehead/MRC_RH 12 712.16 UniSTS
D12Mit128
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 12 76,051,661 - 76,051,774 UniSTS GRCm38 MGSCv37 12 77,152,648 - 77,152,761 UniSTS GRCm37 Celera 12 79,315,305 - 79,315,414 UniSTS Cytogenetic Map 12 C3 UniSTS cM Map 12 32.0 UniSTS Whitehead Genetic 12 27.3 UniSTS Whitehead/MRC_RH 12 702.51 UniSTS Whitehead_YAC 12 UniSTS
D12Mit192
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 12 76,048,091 - 76,048,206 UniSTS GRCm38 MGSCv37 12 77,149,078 - 77,149,193 UniSTS GRCm37 Celera 12 79,318,868 - 79,318,983 UniSTS Cytogenetic Map 12 C3 UniSTS cM Map 12 32.0 UniSTS Whitehead Genetic 12 27.3 UniSTS Whitehead/MRC_RH 12 702.51 UniSTS Whitehead_YAC 12 UniSTS
D12Mit252
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 12 75,976,038 - 75,976,122 UniSTS GRCm38 MGSCv37 12 77,077,025 - 77,077,109 UniSTS GRCm37 Celera 12 77,080,953 - 77,081,037 UniSTS Cytogenetic Map 12 C3 UniSTS cM Map 12 32.0 UniSTS Whitehead Genetic 12 27.3 UniSTS Whitehead_YAC 12 UniSTS
Syne2
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 C3 UniSTS cM Map 12 33.0 UniSTS
BI301410
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 12 76,012,168 - 76,012,324 UniSTS GRCm38 MGSCv37 12 77,113,155 - 77,113,311 UniSTS GRCm37 Celera 12 77,117,035 - 77,117,191 UniSTS Cytogenetic Map 12 C3 UniSTS cM Map 12 33.0 UniSTS
D12Ertd777e
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 12 76,110,580 - 76,110,780 UniSTS GRCm38 MGSCv37 12 77,211,567 - 77,211,767 UniSTS GRCm37 Celera 12 77,205,316 - 77,205,516 UniSTS Cytogenetic Map 12 C3 UniSTS cM Map 12 33.0 UniSTS
D12Mit3
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 12 75,980,519 - 75,980,640 UniSTS GRCm38 MGSCv37 12 77,081,506 - 77,081,627 UniSTS GRCm37 Celera 12 77,085,434 - 77,085,555 UniSTS Cytogenetic Map 12 C3 UniSTS cM Map 12 32.0 UniSTS Whitehead Genetic 12 27.3 UniSTS Whitehead_YAC 12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000044217 ⟹ ENSMUSP00000047697
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 75,865,092 - 76,157,674 (+) Ensembl GRCm38.p6 Ensembl 12 75,818,318 - 76,110,900 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000085280 ⟹ ENSMUSP00000082383
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 76,078,388 - 76,157,694 (+) Ensembl GRCm38.p6 Ensembl 12 76,031,614 - 76,110,920 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000124685
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 75,955,992 - 75,960,661 (+) Ensembl GRCm38.p6 Ensembl 12 75,909,218 - 75,913,887 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000126903 ⟹ ENSMUSP00000115053
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 76,128,713 - 76,144,755 (+) Ensembl GRCm38.p6 Ensembl 12 76,081,939 - 76,097,981 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000131480 ⟹ ENSMUSP00000114364
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 76,118,790 - 76,141,210 (+) Ensembl GRCm38.p6 Ensembl 12 76,072,016 - 76,094,436 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000132161 ⟹ ENSMUSP00000122781
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 76,134,534 - 76,157,700 (+) Ensembl GRCm38.p6 Ensembl 12 76,087,760 - 76,110,926 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000133623
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 75,865,097 - 75,937,823 (+) Ensembl GRCm38.p6 Ensembl 12 75,818,323 - 75,891,049 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000139204 ⟹ ENSMUSP00000118921
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 76,095,352 - 76,157,674 (+) Ensembl GRCm38.p6 Ensembl 12 76,048,578 - 76,110,900 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000142864 ⟹ ENSMUSP00000119268
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 75,864,908 - 75,927,280 (+) Ensembl GRCm38.p6 Ensembl 12 75,818,134 - 75,880,506 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000143031 ⟹ ENSMUSP00000119120
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 75,865,092 - 76,157,700 (+) Ensembl GRCm38.p6 Ensembl 12 75,818,318 - 76,110,926 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000148324 ⟹ ENSMUSP00000121517
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 75,899,504 - 75,927,102 (+) Ensembl GRCm38.p6 Ensembl 12 75,852,730 - 75,880,328 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000148825 ⟹ ENSMUSP00000120371
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 76,069,074 - 76,074,589 (+) Ensembl GRCm38.p6 Ensembl 12 76,022,300 - 76,027,815 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000150317 ⟹ ENSMUSP00000118142
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 75,865,103 - 75,955,651 (+) Ensembl GRCm38.p6 Ensembl 12 75,818,329 - 75,908,877 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000151286
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 76,147,675 - 76,152,766 (+) Ensembl GRCm38.p6 Ensembl 12 76,100,901 - 76,105,992 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000154509 ⟹ ENSMUSP00000116718
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 76,128,430 - 76,141,820 (+) Ensembl GRCm38.p6 Ensembl 12 76,081,656 - 76,095,046 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000154762
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 76,106,448 - 76,113,290 (+) Ensembl GRCm38.p6 Ensembl 12 76,059,674 - 76,066,516 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000157033
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 12 75,865,124 - 75,952,677 (+) Ensembl GRCm38.p6 Ensembl 12 75,818,350 - 75,905,903 (+) Ensembl
RefSeq Acc Id:
NM_001005510 ⟹ NP_001005510
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 12 75,865,092 - 76,157,702 (+) NCBI GRCm38 12 75,818,318 - 76,110,928 (+) ENTREZGENE MGSCv37 12 76,919,305 - 77,211,915 (+) RGD Celera 12 79,314,213 - 79,337,041 (-) NCBI Celera 12 76,923,010 - 77,205,661 (+) RGD cM Map 12 ENTREZGENE
Sequence:
AGTCCAGAGCGGAGCGCGCTCGGCTGCGCCGCAAGCCTTCGGCCGCACGGAAGAGCGAGCGGGAGAGCGATCGAGGGGCGCCATCGAGGCAGCGAGGCGAGGGGGGCGCGGAGTAGGTCGGGTCGAAC
hide sequence
RefSeq Acc Id:
NP_001005510 ⟸ NM_001005510
- UniProtKB:
Q6ZWQ0 (UniProtKB/Swiss-Prot), Q640M5 (UniProtKB/Swiss-Prot), E9QP46 (UniProtKB/TrEMBL)
- Sequence:
MAASPVLPTEDGEGFLGIDDLHFSLQAEQEDTQKKTFTCWINSQLAKHTPPSVVSDLFADIKKGHVLLDLLEVLSGQQLPRDKGSNTFQCRINIEHALTFLKNRSIKLINIHVADIVEGNPSIILGLI
hide sequence
Ensembl Acc Id:
ENSMUSP00000118142 ⟸ ENSMUST00000150317
Ensembl Acc Id:
ENSMUSP00000118921 ⟸ ENSMUST00000139204
Ensembl Acc Id:
ENSMUSP00000082383 ⟸ ENSMUST00000085280
Ensembl Acc Id:
ENSMUSP00000119120 ⟸ ENSMUST00000143031
Ensembl Acc Id:
ENSMUSP00000115053 ⟸ ENSMUST00000126903
Ensembl Acc Id:
ENSMUSP00000122781 ⟸ ENSMUST00000132161
Ensembl Acc Id:
ENSMUSP00000114364 ⟸ ENSMUST00000131480
Ensembl Acc Id:
ENSMUSP00000116718 ⟸ ENSMUST00000154509
Ensembl Acc Id:
ENSMUSP00000121517 ⟸ ENSMUST00000148324
Ensembl Acc Id:
ENSMUSP00000120371 ⟸ ENSMUST00000148825
Ensembl Acc Id:
ENSMUSP00000047697 ⟸ ENSMUST00000044217
Ensembl Acc Id:
ENSMUSP00000119268 ⟸ ENSMUST00000142864
RGD ID: 8678550 Promoter ID: EPDNEW_M17306 Type: initiation region Name: Syne2_1 Description: Mus musculus spectrin repeat containing, nuclear envelope 2 ,mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M17307 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 12 75,818,323 - 75,818,383 EPDNEW
RGD ID: 8678554 Promoter ID: EPDNEW_M17307 Type: multiple initiation site Name: Syne2_2 Description: Mus musculus spectrin repeat containing, nuclear envelope 2 ,mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M17306 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 12 76,081,905 - 76,081,965 EPDNEW
RGD ID: 6823484 Promoter ID: MM_KWN:11954 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day3, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, Kidney, Liver, Lung Transcripts: NM_001005510, OTTMUST00000082377, OTTMUST00000082456, OTTMUST00000082562, UC007NXM.1, UC007NXN.1, UC007NXO.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 12 76,919,131 - 76,919,631 (+) MPROMDB
RGD ID: 6823455 Promoter ID: MM_KWN:11956 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney, Liver Transcripts: OTTMUST00000082563 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 12 76,953,399 - 76,953,899 (+) MPROMDB
RGD ID: 6823460 Promoter ID: MM_KWN:11958 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney Transcripts: OTTMUST00000082569 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 12 77,123,161 - 77,123,661 (+) MPROMDB
RGD ID: 6823463 Promoter ID: MM_KWN:11959 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney Transcripts: ENSMUST00000044217, UC007NXR.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 12 77,131,661 - 77,132,412 (+) MPROMDB
RGD ID: 6823464 Promoter ID: MM_KWN:11963 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lung Transcripts: UC007NXT.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 12 77,162,156 - 77,162,656 (+) MPROMDB
RGD ID: 6823459 Promoter ID: MM_KWN:11964 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: ES_Cell, Lung Transcripts: OTTMUST00000082567 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 12 77,173,026 - 77,173,526 (+) MPROMDB
RGD ID: 6823458 Promoter ID: MM_KWN:11965 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Kidney Transcripts: OTTMUST00000082565, OTTMUST00000082566 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 12 77,181,961 - 77,183,007 (+) MPROMDB
RGD ID: 6823453 Promoter ID: MM_KWN:11966 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney, Lung, Spleen Transcripts: OTTMUST00000082543 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 12 77,187,791 - 77,188,577 (+) MPROMDB
RGD ID: 6823457 Promoter ID: MM_KWN:11967 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney, Lung Transcripts: OTTMUST00000082564 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 12 77,201,594 - 77,202,094 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-21
Syne2
spectrin repeat containing, nuclear envelope 2
Syne2
synaptic nuclear envelope 2
Symbol and/or name change
5135510 APPROVED
2024-08-21
Syne2
synaptic nuclear envelope 2
Syne2
spectrin repeat containing, nuclear envelope 2
Symbol and/or name change
5135510 APPROVED
2012-11-27
Syne2
spectrin repeat containing, nuclear envelope 2
synaptic nuclear envelope 2
Symbol and/or name change
5135510 APPROVED
