Symbol:
Cep44
Name:
centrosomal protein 44
RGD ID:
1614782
MGI Page
MGI
Description:
Predicted to enable microtubule binding activity. Predicted to be involved in centriole replication and centriole-centriole cohesion. Predicted to be located in centriole. Predicted to be active in centrosome and spindle pole. Orthologous to human CEP44 (centrosomal protein 44).
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
4933440G23Rik; centrosomal protein of 44 kDa; hypothetical protein LOC382010; KIAA1712; MGC113766; mKIAA1712
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CEP44 (centrosomal protein 44) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Cep44 (centrosomal protein 44) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cep44 (centrosomal protein 44) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CEP44 (centrosomal protein 44) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CEP44 (centrosomal protein 44) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cep44 (centrosomal protein 44) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CEP44 (centrosomal protein 44) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CEP44 (centrosomal protein 44) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cep44 (centrosomal protein 44) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Cep44 (centrosomal protein 44)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CEP44 (centrosomal protein 44)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cep44 (centrosomal protein 44)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Xenopus tropicalis (tropical clawed frog):
cep44
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 56,983,516 - 57,010,052 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 56,984,557 - 57,004,082 (-) Ensembl GRCm39 Ensembl GRCm38 8 56,531,516 - 56,550,876 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 56,531,522 - 56,551,047 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 59,010,319 - 59,029,363 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 59,423,664 - 59,442,708 (-) NCBI MGSCv36 mm8 Celera 8 59,187,121 - 59,207,308 (-) NCBI Celera Cytogenetic Map 8 B2 NCBI cM Map 8 29.7 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cep44 Mouse 2,3,7,8-Tetrachlorodibenzofuran increases expression ISO RGD:1308517 6480464 2,3,7,8-tetrachlorodibenzofuran results in increased expression of CEP44 mRNA CTD PMID:32109520 Cep44 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of CEP44 mRNA CTD PMID:28973697 Cep44 Mouse aflatoxin B1 decreases methylation ISO RGD:1318333 6480464 Aflatoxin B1 results in decreased methylation of CEP44 gene CTD PMID:27153756 Cep44 Mouse all-trans-retinoic acid decreases expression ISO RGD:1318333 6480464 Tretinoin results in decreased expression of CEP44 mRNA CTD PMID:23724009|PMID:33167477 Cep44 Mouse aristolochic acid A decreases expression ISO RGD:1318333 6480464 aristolochic acid I results in decreased expression of CEP44 mRNA CTD PMID:33212167 Cep44 Mouse arsane multiple interactions ISO RGD:1318333 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Cep44 Mouse arsenic atom multiple interactions ISO RGD:1318333 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Cep44 Mouse arsenite(3-) multiple interactions ISO RGD:1318333 6480464 arsenite inhibits the reaction [G3BP1 protein binds to CEP44 mRNA] CTD PMID:32406909 Cep44 Mouse atrazine decreases expression ISO RGD:1318333 6480464 Atrazine results in decreased expression of CEP44 mRNA CTD PMID:22378314 Cep44 Mouse benzo[a]pyrene decreases expression ISO RGD:1318333 6480464 Benzo(a)pyrene results in decreased expression of CEP44 mRNA CTD PMID:21632981|PMID:22316170 Cep44 Mouse benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of CEP44 intron CTD PMID:27901495 Cep44 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of CEP44 mRNA CTD PMID:34319233 Cep44 Mouse bisphenol A affects expression ISO RGD:1308517 6480464 bisphenol A affects the expression of CEP44 mRNA CTD PMID:25181051 Cep44 Mouse bisphenol A increases expression ISO RGD:1318333 6480464 bisphenol A results in increased expression of CEP44 mRNA CTD PMID:36232920 Cep44 Mouse bisphenol A decreases expression ISO RGD:1318333 6480464 bisphenol A results in decreased expression of CEP44 mRNA CTD PMID:29275510 Cep44 Mouse butanal decreases expression ISO RGD:1318333 6480464 butyraldehyde results in decreased expression of CEP44 mRNA CTD PMID:26079696 Cep44 Mouse dibutyl phthalate increases expression ISO RGD:1308517 6480464 Dibutyl Phthalate results in increased expression of CEP44 mRNA CTD PMID:21266533 Cep44 Mouse dorsomorphin multiple interactions ISO RGD:1318333 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Cep44 Mouse enzyme inhibitor multiple interactions ISO RGD:1318333 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Cep44 Mouse fipronil decreases expression ISO RGD:1308517 6480464 fipronil results in decreased expression of CEP44 mRNA CTD PMID:34044035 Cep44 Mouse folic acid decreases expression ISO RGD:1318333 6480464 Folic Acid results in decreased expression of CEP44 mRNA CTD PMID:21867686 Cep44 Mouse genistein increases expression ISO RGD:1318333 6480464 Genistein results in increased expression of CEP44 mRNA CTD PMID:26865667 Cep44 Mouse manganese atom multiple interactions ISO RGD:1318333 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Cep44 Mouse manganese(0) multiple interactions ISO RGD:1318333 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Cep44 Mouse manganese(II) chloride multiple interactions ISO RGD:1318333 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Cep44 Mouse N-acetyl-1,4-benzoquinone imine affects response to substance ISO RGD:1318333 6480464 CEP44 gene SNP affects the susceptibility to N-acetyl-4-benzoquinoneimine CTD PMID:21177773 Cep44 Mouse pentanal decreases expression ISO RGD:1318333 6480464 pentanal results in decreased expression of CEP44 mRNA CTD PMID:26079696 Cep44 Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of CEP44 mRNA CTD PMID:23091169 Cep44 Mouse potassium chromate decreases expression ISO RGD:1318333 6480464 potassium chromate(VI) results in decreased expression of CEP44 mRNA CTD PMID:22714537 Cep44 Mouse SB 431542 multiple interactions ISO RGD:1318333 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Cep44 Mouse silicon dioxide decreases expression ISO RGD:1318333 6480464 Silicon Dioxide analog results in decreased expression of CEP44 mRNA CTD PMID:25895662 Cep44 Mouse sodium arsenite multiple interactions ISO RGD:1318333 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Cep44 Mouse sunitinib increases expression ISO RGD:1318333 6480464 Sunitinib results in increased expression of CEP44 mRNA CTD PMID:31533062 Cep44 Mouse temozolomide decreases expression ISO RGD:1318333 6480464 Temozolomide results in decreased expression of CEP44 mRNA CTD PMID:31758290 Cep44 Mouse testosterone decreases expression ISO RGD:1318333 6480464 Testosterone results in decreased expression of CEP44 mRNA CTD PMID:33359661 Cep44 Mouse triphenyl phosphate affects expression ISO RGD:1318333 6480464 triphenyl phosphate affects the expression of CEP44 mRNA CTD PMID:37042841 Cep44 Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of CEP44 mRNA CTD PMID:33045310 Cep44 Mouse tungsten increases expression EXP 6480464 Tungsten results in increased expression of CEP44 mRNA CTD PMID:30912803 Cep44 Mouse tunicamycin decreases expression ISO RGD:1318333 6480464 Tunicamycin results in decreased expression of CEP44 mRNA CTD PMID:22378314 Cep44 Mouse urethane increases expression ISO RGD:1318333 6480464 Urethane results in increased expression of CEP44 mRNA CTD PMID:28818685 Cep44 Mouse valproic acid decreases expression ISO RGD:1318333 6480464 Valproic Acid results in decreased expression of CEP44 mRNA CTD PMID:23179753 Cep44 Mouse valproic acid decreases methylation ISO RGD:1318333 6480464 Valproic Acid results in decreased methylation of CEP44 gene CTD PMID:29154799 Cep44 Mouse valproic acid increases expression ISO RGD:1318333 6480464 Valproic Acid results in increased expression of CEP44 mRNA CTD PMID:23179753|PMID:26272509 Cep44 Mouse valproic acid multiple interactions ISO RGD:1318333 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Cep44 Mouse vorinostat increases expression ISO RGD:1318333 6480464 vorinostat results in increased expression of CEP44 mRNA CTD PMID:27188386
Cep44 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 56,983,516 - 57,010,052 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 56,984,557 - 57,004,082 (-) Ensembl GRCm39 Ensembl GRCm38 8 56,531,516 - 56,550,876 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 56,531,522 - 56,551,047 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 59,010,319 - 59,029,363 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 59,423,664 - 59,442,708 (-) NCBI MGSCv36 mm8 Celera 8 59,187,121 - 59,207,308 (-) NCBI Celera Cytogenetic Map 8 B2 NCBI cM Map 8 29.7 NCBI
CEP44 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 174,283,706 - 174,333,381 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 174,283,730 - 174,333,380 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 175,205,062 - 175,254,532 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 175,441,435 - 175,478,057 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 175,579,785 - 175,628,174 NCBI Celera 4 172,530,576 - 172,583,267 (+) NCBI Celera Cytogenetic Map 4 q34.1 NCBI HuRef 4 170,951,226 - 171,003,683 (+) NCBI HuRef CHM1_1 4 175,181,283 - 175,230,994 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 177,623,203 - 177,673,220 (+) NCBI T2T-CHM13v2.0
Cep44 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 38,722,259 - 38,741,603 (+) NCBI GRCr8 mRatBN7.2 16 33,711,548 - 33,733,226 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 33,711,559 - 33,733,225 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 37,321,017 - 37,340,601 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 40,732,376 - 40,751,960 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 36,966,075 - 36,985,383 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 37,177,379 - 37,199,043 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 37,177,443 - 37,196,784 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 36,981,816 - 37,003,656 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 37,139,513 - 37,159,628 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 37,139,490 - 37,159,706 (+) NCBI Celera 16 33,644,164 - 33,663,973 (+) NCBI Celera Cytogenetic Map 16 p11 NCBI
Cep44 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 32,778,717 - 32,795,144 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 32,780,077 - 32,799,015 (-) NCBI ChiLan1.0 ChiLan1.0
CEP44 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 172,042,910 - 172,101,154 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 172,423,679 - 172,474,512 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 166,509,937 - 166,561,606 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 178,744,308 - 178,794,302 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 178,744,596 - 178,794,302 (+) Ensembl panpan1.1 panPan2
CEP44 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 24,797,449 - 24,831,898 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 24,797,309 - 24,848,320 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 25,450,100 - 25,485,400 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 24,960,291 - 24,984,630 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 24,960,835 - 24,999,557 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 24,908,420 - 24,944,250 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 24,800,042 - 24,833,230 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 24,949,359 - 24,985,209 (+) NCBI UU_Cfam_GSD_1.0
Cep44 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404943 24,920,041 - 24,961,584 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936516 5,333,595 - 5,377,848 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936516 5,334,015 - 5,377,009 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CEP44
CEP44 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 120,374,383 - 120,411,172 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 120,387,359 - 120,415,774 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 100,423,827 - 100,467,573 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cep44
.
Predicted Target Of
Count of predictions: 375 Count of miRNA genes: 277 Interacting mature miRNAs: 304 Transcripts: ENSMUST00000040330, ENSMUST00000123493, ENSMUST00000126830, ENSMUST00000127877, ENSMUST00000130930, ENSMUST00000134162, ENSMUST00000135337, ENSMUST00000140107 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301139 Lmr10_m leishmaniasis resistance 10 (mouse) Not determined 8 35321097 57797633 Mouse 1558870 Eae36_m experimental allergic encephalomyelitis susceptibility 36 (mouse) Not determined 8 14773160 71498244 Mouse 11049577 Lmr10b_m leishmaniasis resistance 10b (mouse) 8 35321097 57797633 Mouse 4141437 W10q14_m weight 10 weeks QTL 14 (mouse) Not determined 32506572 71740637 Mouse 11049578 Lmr10c_m leishmaniasis resistance 10c (mouse) 8 35321097 57797633 Mouse 11041902 Lmr10a_m leishmaniasis resistance 10a (mouse) 8 35321097 57797633 Mouse 1301013 Capsq4_m capsaicin sensitivity related QTL 4 (mouse) Not determined 8 36630154 93455280 Mouse 1301717 Adip4_m adiposity 4 (mouse) Not determined 8 48090064 82090180 Mouse 1357715 Alaa3_m alopecia areata 3 (mouse) Not determined 8 49245591 83245673 Mouse 14746987 Manh64_m mandible shape 64 (mouse) 8 50505958 84505958 Mouse 4141172 W6q9_m weight 6 weeks QTL 9 (mouse) Not determined 32506572 71740637 Mouse 1558875 Eae31_m experimental allergic encephalomyelitis susceptibility 31 (mouse) Not determined 8 35109930 115563747 Mouse 10766453 Char11_m P. chabaudi malaria resistance QTL 11 (mouse) 8 48090064 82090180 Mouse 1301506 Aevm1_m autoimmune extremity vasculitis in MRL mice 1 (mouse) Not determined 8 54740461 88740637 Mouse 1301441 Skull11_m skull morphology 11 (mouse) Not determined 8 48190168 82190288 Mouse 1301952 Im3_m immunoregulatory 3 (mouse) Not determined 8 55159258 89159407 Mouse 4140967 Bmd39_m bone mineral density 39 (mouse) Not determined 8 32506572 117965439 Mouse 4140966 Egq12_m early growth QTL 12 (mouse) Not determined 32506572 71740637 Mouse 14747005 Mancz7_m mandible centroid size 7 (mouse) 8 50505958 84505958 Mouse 27226754 Femd6_m femur midshaft diameter 6, 10 week (mouse) 8 37867154 110326632 Mouse 10043974 Obq30_m obesity QTL 30 (mouse) Not determined 8 26583322 60583322 Mouse 10412287 Carg3_m Candida albicans resistance gene 3 (mouse) Not determined 8 56298872 90298872 Mouse 1301936 Trigq2_m triglyceride QTL 2 (mouse) Not determined 8 34290397 68290537 Mouse 1357811 Orq3_m ovulation rate QTL 3 (mouse) Not determined 8 32506572 71740637 Mouse 12904744 Carcdq1_m cardiac collagen deposition QTL 1 (mouse) 8 40162297 95416226 Mouse 14700686 Civq3_m cerebral infarct volume QTL 3 (mouse) 8 52334843 86334843 Mouse 1301544 Iba3_m induction of brown adipocytes 3 (mouse) Not determined 8 44747914 78748059 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000040330 ⟹ ENSMUSP00000042586
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 56,984,557 - 57,003,892 (-) Ensembl GRCm38.p6 Ensembl 8 56,531,522 - 56,550,857 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000123493 ⟹ ENSMUSP00000116884
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 56,984,557 - 56,998,500 (-) Ensembl GRCm38.p6 Ensembl 8 56,531,522 - 56,545,465 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000126830
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 57,002,364 - 57,003,838 (-) Ensembl GRCm38.p6 Ensembl 8 56,549,329 - 56,550,803 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000127877
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 57,002,016 - 57,003,292 (-) Ensembl GRCm38.p6 Ensembl 8 56,548,981 - 56,550,257 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000130930 ⟹ ENSMUSP00000118959
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 56,998,487 - 57,004,082 (-) Ensembl GRCm38.p6 Ensembl 8 56,545,452 - 56,551,047 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000134162 ⟹ ENSMUSP00000117526
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 56,997,229 - 57,003,834 (-) Ensembl GRCm38.p6 Ensembl 8 56,544,194 - 56,550,799 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000135337 ⟹ ENSMUSP00000122835
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 56,997,296 - 57,003,907 (-) Ensembl GRCm38.p6 Ensembl 8 56,544,261 - 56,550,872 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000140107 ⟹ ENSMUSP00000114502
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 56,995,941 - 57,003,878 (-) Ensembl GRCm38.p6 Ensembl 8 56,542,906 - 56,550,843 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000210545
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 56,990,252 - 56,991,702 (-) Ensembl GRCm38.p6 Ensembl 8 56,537,217 - 56,538,667 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000211049
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 56,985,528 - 56,987,610 (-) Ensembl GRCm38.p6 Ensembl 8 56,532,493 - 56,534,575 (-) Ensembl
RefSeq Acc Id:
NM_001009951 ⟹ NP_001009951
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 56,984,557 - 57,003,601 (-) NCBI GRCm38 8 56,531,522 - 56,550,566 (-) NCBI MGSCv37 8 59,010,319 - 59,029,363 (-) RGD Celera 8 59,187,121 - 59,207,308 (-) RGD cM Map 8 ENTREZGENE
Sequence:
TGGGTTGTAGGCGAATGATCAGATGAGAGGCTGTAAGATTATTTGAGAGTTGGAGCTGAATCGGAATATAATGGCAACAGGTGACTTAAAGAGAAGCTTGCGGAAGCTAGAACAAGTGCTTCGGTCAC
hide sequence
RefSeq Acc Id:
XM_006509445 ⟹ XP_006509508
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 56,984,551 - 57,003,911 (-) NCBI GRCm38 8 56,531,516 - 56,550,634 (-) NCBI
Sequence:
AGCATTTGGGGCAGCCTCTGGCTCGGAATGTTTAGCCGCTGTTCGAACTCTCGGCTCGAACTCT
hide sequence
RefSeq Acc Id:
XM_006509446 ⟹ XP_006509509
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 56,984,551 - 57,003,896 (-) NCBI GRCm38 8 56,531,516 - 56,550,861 (-) NCBI
Sequence:
CTCTGGCTCGGAATGTTTAGCCGCTGTTCGAACTCTCGGCTCGAACTCTGAGTTCTAAAAACAAACCGTCGGCACGAGGGGCGACCCGAGGCGCGGGCGTAAGGCTCTGGGGCTGCAGACCCGGTTCC
hide sequence
RefSeq Acc Id:
XM_006509447 ⟹ XP_006509510
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 56,984,551 - 57,003,914 (-) NCBI GRCm38 8 56,531,516 - 56,550,857 (-) NCBI
Sequence:
GCCAGCATTTGGGGCAGCCTCTGGCTCGGAATGTTTAGCCGCTGTTCGAACTCTCGGCTCGAACTCTGAGTTCTAAAAACAAACCGTCGGCACGAGGGGCGACCCGAGGCGCGGGCGTAAGGCTCTGG
hide sequence
RefSeq Acc Id:
XM_006509448 ⟹ XP_006509511
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 56,983,516 - 57,010,052 (-) NCBI GRCm38 8 56,531,516 - 56,550,876 (-) NCBI
Sequence:
GAGATTTAAATTTTATTAAATTTTAAGCAATTATTAAAGAAAATTCACATATTGGGTTTTTTTTTTTTAAAGAGAGCTTTTCTCAAACAGACCATAACAACTTCATGTTTCACTATTTTAGGTCTTAA
hide sequence
RefSeq Acc Id:
XM_006509449 ⟹ XP_006509512
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 56,984,551 - 57,003,812 (-) NCBI GRCm38 8 56,531,516 - 56,550,777 (-) NCBI
Sequence:
CCCGAGGCGCGGGCGTAAGGCTCTGGGGCTGCAGACCCGGTTCCCGCCACGTTCTCGGGTTTCT
hide sequence
RefSeq Acc Id:
XM_006509450 ⟹ XP_006509513
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 56,984,551 - 57,003,894 (-) NCBI GRCm38 8 56,531,516 - 56,550,859 (-) NCBI
Sequence:
CTGGCTCGGAATGTTTAGCCGCTGTTCGAACTCTCGGCTCGAACTCTGAGTTCTAAAAACAAACCGTCGGCACGAGGGGCGACCCGAGGCGCGGGCGTAAGGCTCTGGGGCTGCAGACCCGGTTCCCG
hide sequence
RefSeq Acc Id:
XM_006509451 ⟹ XP_006509514
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 56,984,551 - 57,003,847 (-) NCBI GRCm38 8 56,531,516 - 56,550,777 (-) NCBI
Sequence:
GAGTTCTAAAAACAAACCGTCGGCACGAGGGGCGACCCGAGGCGCGGGCGTAAGGCTCTGGGGC
hide sequence
RefSeq Acc Id:
XM_006509452 ⟹ XP_006509515
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 56,984,551 - 57,003,669 (-) NCBI GRCm38 8 56,531,516 - 56,550,634 (-) NCBI
Sequence:
GAGCTCGTGGACCTGCTGTGCTCTGGCTTGGACGAAGGTGGCCCTTCTGCTGTCCTCACCGAGGTTCCTGGGTTGTAGGCGAATGATCAGCGGTTCCCTCATCGGATCTTACAACAGCATTTTCCTAG
hide sequence
RefSeq Acc Id:
XM_017312870 ⟹ XP_017168359
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 56,984,551 - 57,003,669 (-) NCBI GRCm38 8 56,531,516 - 56,550,634 (-) NCBI
Sequence:
GAGCTCGTGGACCTGCTGTGCTCTGGCTTGGACGAAGGTGGCCCTTCTGCTGTCCTCACCGAGGTTCCTGGGTTGTAGGCGAATGATCAGCGGTTCCCTCATCGGATCTTACAACAGCATTTTCCTAG
hide sequence
RefSeq Acc Id:
XM_036154140 ⟹ XP_036010033
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 56,984,551 - 57,003,808 (-) NCBI
Sequence:
AGGCGCGGGCGTAAGGCTCTGGGGCTGCAGACCCGGTTCCCGCCACGTTCTCGGGTTTCTAGTGCTCCCTTCTTCTTTCTGTGTTGACTTACTGCTACACTAGACTGTTTTACAGAATTATTTGCAAG
hide sequence
RefSeq Acc Id:
XR_004934848
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 56,985,513 - 57,010,052 (-) NCBI
Sequence:
GAGATTTAAATTTTATTAAATTTTAAGCAATTATTAAAGAAAATTCACATATTGGGTTTTTTTTTTTTAAAGAGAGCTTTTCTCAAACAGACCATAACAACTTCATGTTTCACTATTTTAGGTCTTAA
hide sequence
RefSeq Acc Id:
XR_004934849
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 56,983,516 - 57,010,052 (-) NCBI
Sequence:
GAGATTTAAATTTTATTAAATTTTAAGCAATTATTAAAGAAAATTCACATATTGGGTTTTTTTTTTTTAAAGAGAGCTTTTCTCAAACAGACCATAACAACTTCATGTTTCACTATTTTAGGTCTTAA
hide sequence
RefSeq Acc Id:
NP_001009951 ⟸ NM_001009951
- UniProtKB:
Q5DTV5 (UniProtKB/Swiss-Prot), Q5HZK1 (UniProtKB/Swiss-Prot), F7BA57 (UniProtKB/TrEMBL)
- Sequence:
MATGDLKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSIELIAKNDVRFTDTVYKLLRDQFDYKPILTKKQFIQSGFAEWKIEIVCDILNCVMKKHKELIGLDK
hide sequence
RefSeq Acc Id:
XP_006509511 ⟸ XM_006509448
- Peptide Label:
isoform X1
- UniProtKB:
Q5DTV5 (UniProtKB/Swiss-Prot), Q5HZK1 (UniProtKB/Swiss-Prot), F7BA57 (UniProtKB/TrEMBL)
- Sequence:
MATGDLKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSIE
hide sequence
RefSeq Acc Id:
XP_006509513 ⟸ XM_006509450
- Peptide Label:
isoform X1
- UniProtKB:
Q5DTV5 (UniProtKB/Swiss-Prot), Q5HZK1 (UniProtKB/Swiss-Prot), F7BA57 (UniProtKB/TrEMBL)
- Sequence:
MATGDLKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSIELIAKNDVRFTDTVYKLLRDQFDYKPILTKKQFIQSGFAEWKIEIVCDILNCVMKKHKELIGLDK
hide sequence
RefSeq Acc Id:
XP_006509514 ⟸ XM_006509451
- Peptide Label:
isoform X1
- UniProtKB:
Q5DTV5 (UniProtKB/Swiss-Prot), Q5HZK1 (UniProtKB/Swiss-Prot), F7BA57 (UniProtKB/TrEMBL)
- Sequence:
MATGDLKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSIE
hide sequence
RefSeq Acc Id:
XP_006509512 ⟸ XM_006509449
- Peptide Label:
isoform X1
- UniProtKB:
Q5DTV5 (UniProtKB/Swiss-Prot), Q5HZK1 (UniProtKB/Swiss-Prot), F7BA57 (UniProtKB/TrEMBL)
- Sequence:
MATGDLKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSIELIAKNDVRFTDTVYKLLRDQFDYKPILTKKQFIQSGFAEWKIEIVCDILNCVMKKHKELIGLDK
hide sequence
RefSeq Acc Id:
XP_006509509 ⟸ XM_006509446
- Peptide Label:
isoform X1
- UniProtKB:
Q5DTV5 (UniProtKB/Swiss-Prot), Q5HZK1 (UniProtKB/Swiss-Prot), F7BA57 (UniProtKB/TrEMBL)
- Sequence:
MATGDLKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSIE
hide sequence
RefSeq Acc Id:
XP_006509510 ⟸ XM_006509447
- Peptide Label:
isoform X1
- UniProtKB:
Q5DTV5 (UniProtKB/Swiss-Prot), Q5HZK1 (UniProtKB/Swiss-Prot), F7BA57 (UniProtKB/TrEMBL)
- Sequence:
MATGDLKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSIELIAKNDVRFTDTVYKLLRDQFDYKPILTKKQFIQSGFAEWKIEIVCDILNCVMKKHKELIGLDK
hide sequence
RefSeq Acc Id:
XP_006509508 ⟸ XM_006509445
- Peptide Label:
isoform X1
- UniProtKB:
Q5DTV5 (UniProtKB/Swiss-Prot), Q5HZK1 (UniProtKB/Swiss-Prot), F7BA57 (UniProtKB/TrEMBL)
- Sequence:
MATGDLKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSIE
hide sequence
RefSeq Acc Id:
XP_006509515 ⟸ XM_006509452
- Peptide Label:
isoform X1
- UniProtKB:
Q5DTV5 (UniProtKB/Swiss-Prot), Q5HZK1 (UniProtKB/Swiss-Prot), F7BA57 (UniProtKB/TrEMBL)
- Sequence:
MATGDLKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSIELIAKNDVRFTDTVYKLLRDQFDYKPILTKKQFIQSGFAEWKIEIVCDILNCVMKKHKELIGLDK
hide sequence
RefSeq Acc Id:
XP_017168359 ⟸ XM_017312870
- Peptide Label:
isoform X1
- UniProtKB:
Q5DTV5 (UniProtKB/Swiss-Prot), Q5HZK1 (UniProtKB/Swiss-Prot), F7BA57 (UniProtKB/TrEMBL)
- Sequence:
MATGDLKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSIE
hide sequence
Ensembl Acc Id:
ENSMUSP00000118959 ⟸ ENSMUST00000130930
Ensembl Acc Id:
ENSMUSP00000042586 ⟸ ENSMUST00000040330
Ensembl Acc Id:
ENSMUSP00000122835 ⟸ ENSMUST00000135337
Ensembl Acc Id:
ENSMUSP00000114502 ⟸ ENSMUST00000140107
Ensembl Acc Id:
ENSMUSP00000117526 ⟸ ENSMUST00000134162
Ensembl Acc Id:
ENSMUSP00000116884 ⟸ ENSMUST00000123493
RefSeq Acc Id:
XP_036010033 ⟸ XM_036154140
- Peptide Label:
isoform X1
- UniProtKB:
Q5HZK1 (UniProtKB/Swiss-Prot), Q5DTV5 (UniProtKB/Swiss-Prot), F7BA57 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-02-06
Cep44
centrosomal protein 44
BC088983
cDNA sequence BC088983
Symbol and/or name change
5135510 APPROVED
