Symbol:
Ccdc28b
Name:
coiled coil domain containing 28B
RGD ID:
1614371
MGI Page
MGI
Description:
Predicted to be involved in cilium assembly. Predicted to be located in cytoplasm. Predicted to be active in centrosome. Is expressed in central nervous system; foregut; ganglia; and olfactory epithelium. Human ortholog(s) of this gene implicated in Bardet-Biedl syndrome and Bardet-Biedl syndrome 1. Orthologous to human CCDC28B (coiled-coil domain containing 28B).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1110002E08Rik; 1810010N17Rik; coiled-coil domain-containing protein 28B
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CCDC28B (coiled-coil domain containing 28B) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Ccdc28b (coiled coil domain containing 28B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ccdc28b (coiled-coil domain containing 28B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CCDC28B (coiled-coil domain containing 28B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CCDC28B (coiled-coil domain containing 28B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ccdc28b (coiled-coil domain containing 28B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CCDC28B (coiled-coil domain containing 28B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CCDC28B (coiled-coil domain containing 28B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ccdc28b (coiled-coil domain containing 28B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Ccdc28b (coiled coil domain containing 28B)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CCDC28B (coiled-coil domain containing 28B)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ccdc28b (coiled-coil domain containing 28B)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
CG10874
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ccdc28b
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 129,513,067 - 129,517,820 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 129,513,067 - 129,517,740 (-) Ensembl GRCm39 Ensembl GRCm38 4 129,619,274 - 129,623,908 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 129,619,274 - 129,623,947 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 129,296,518 - 129,301,152 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 129,121,578 - 129,126,212 (-) NCBI MGSCv36 mm8 Celera 4 127,952,595 - 127,957,032 (-) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 63.26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Ccdc28b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 129,513,067 - 129,517,820 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 129,513,067 - 129,517,740 (-) Ensembl GRCm39 Ensembl GRCm38 4 129,619,274 - 129,623,908 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 129,619,274 - 129,623,947 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 129,296,518 - 129,301,152 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 129,121,578 - 129,126,212 (-) NCBI MGSCv36 mm8 Celera 4 127,952,595 - 127,957,032 (-) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 63.26 NCBI
CCDC28B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 32,196,011 - 32,205,387 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 32,200,595 - 32,205,453 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 32,666,196 - 32,670,988 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 32,438,789 - 32,443,578 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 30,936,104 - 30,940,893 (+) NCBI Celera Cytogenetic Map 1 p35.2 NCBI HuRef 1 30,782,655 - 30,787,444 (+) NCBI HuRef CHM1_1 1 32,781,780 - 32,786,569 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 32,058,497 - 32,063,289 (+) NCBI T2T-CHM13v2.0
Ccdc28b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 147,246,627 - 147,251,629 (-) NCBI GRCr8 mRatBN7.2 5 141,962,275 - 141,967,278 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 141,962,276 - 141,967,382 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 144,663,031 - 144,668,025 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 146,432,857 - 146,437,851 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 146,429,490 - 146,434,485 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 147,823,446 - 147,828,449 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 147,823,447 - 147,828,449 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 151,552,469 - 151,557,472 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 5 140,436,783 - 140,441,786 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
Ccdc28b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 10,568,992 - 10,573,793 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 10,568,992 - 10,573,811 (+) NCBI ChiLan1.0 ChiLan1.0
CCDC28B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 194,621,668 - 194,625,108 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 193,743,085 - 193,747,891 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 31,486,637 - 31,491,586 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 32,497,364 - 32,502,354 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 32,497,364 - 32,502,354 (+) Ensembl panpan1.1 panPan2
CCDC28B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 69,000,384 - 69,004,764 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 69,000,522 - 69,003,442 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 65,581,169 - 65,585,551 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 69,567,264 - 69,571,646 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 69,564,085 - 69,570,322 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 66,403,671 - 66,408,049 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 67,399,375 - 67,403,755 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 68,398,772 - 68,403,154 (-) NCBI UU_Cfam_GSD_1.0
Ccdc28b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 49,428,585 - 49,433,537 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 15,253,345 - 15,260,627 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 15,253,614 - 15,258,319 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CCDC28B
CCDC28B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 100,666,059 - 100,671,821 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 100,666,070 - 100,669,491 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 16,014,209 - 16,020,121 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ccdc28b
.
Predicted Target Of
Count of predictions: 1983 Count of miRNA genes: 662 Interacting mature miRNAs: 812 Transcripts: ENSMUST00000030586, ENSMUST00000106035, ENSMUST00000123943, ENSMUST00000124630, ENSMUST00000126777, ENSMUST00000141361, ENSMUST00000150357, ENSMUST00000151838, ENSMUST00000152290, ENSMUST00000152708 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142139 Adip12_m adiposity 12 (mouse) Not determined 4 124621281 156860686 Mouse 10047132 Albq19_m albuminuria QTL 19 (mouse) Not determined 4 112824389 146824389 Mouse 1301525 Lmb1_m lupus in MRL and B6 F2 cross (mouse) Not determined 4 124264957 150676858 Mouse 14746982 Manh56_m mandible shape 56 (mouse) 4 117815917 151815917 Mouse 4141623 W6q13_m weight 6 weeks QTL 13 (mouse) Not determined 88982069 140468203 Mouse 12910797 Pwgrq4_m pre-weaning growth rate QTL 4 (mouse) 4 105835310 141433838 Mouse 25314312 Syncl2_m synaptonemal complex length 2 (mouse) 4 65718237 146584457 Mouse 12910794 Pwbwq8_m post-weaning body weight QTL 8 (mouse) 4 105835310 141433838 Mouse 1300743 Skull6_m skull morphology 6 (mouse) Not determined 4 111009051 145009280 Mouse 1301382 Arvm2_m autoimmune renal vasculitis 2 (mouse) Not determined 4 107791564 141791756 Mouse 1302149 Tlsr2_m thymic lymphoma suppressor region 2 (mouse) Not determined 4 124264957 142230960 Mouse 12910813 Pwbwq4_m pre-weaning body weight QTL 4 (mouse) 4 105835310 141433838 Mouse 4141093 W3q17_m weight 3 weeks QTL 17 (mouse) Not determined 88982069 140468203 Mouse 27226757 Femd1_m femur midshaft diameter 1, 5 week (mouse) 4 123993793 144326570 Mouse 12910808 Pwbwq9_m post-weaning body weight QTL 9 (mouse) 4 105835310 141433838 Mouse 1300621 Tpnr1_m thermal pain response 1 (mouse) Not determined 4 125230872 156860686 Mouse 11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 4142493 Femwf13_m femur work to failure 13 (mouse) Not determined 116154678 150154782 Mouse 1301815 Sles2_m systemic lupus erythmatosus suppressor 2 (mouse) Not determined 4 94957579 150676858 Mouse 1300663 Start2_m startle response 2 (mouse) Not determined 4 107264957 141265153 Mouse 1300917 Gasa1_m gastritis type A susceptibility locus 1 (mouse) Not determined 4 124055093 142438020 Mouse 1301823 Bmd7_m bone mineral density 7 (mouse) Not determined 4 88982069 151654550 Mouse 10412210 Cypr6_m cytokine production 6 (mouse) Not determined 4 120617848 154617995 Mouse 1302078 Sluc21_m susceptibility to lung cancer 21 (mouse) Not determined 4 117401141 151401275 Mouse 10045620 Heal22_m wound healing/regeneration 22 (mouse) Not determined 4 125230872 156860686 Mouse 4142481 Gct1_m granulosa cell tumorigenesis 1 (mouse) Not determined 4 127784226 156860686 Mouse 1301793 Tlsr3_m thymic lymphoma suppressor region 3 (mouse) Not determined 4 129465811 136864536 Mouse 10412072 Ssen1_m suseptibility to Sendai virus 1 (mouse) Not determined 4 109658132 133154782 Mouse 4141065 Shali2_m survival time to hyperoxic acute lung injury 2 (mouse) Not determined 124055093 141572792 Mouse 13503348 Bntq18_m bone traits QTL 18 (mouse) 4 120617848 154617995 Mouse 13208562 Wght7_m weight 7 (mouse) 4 90888237 148084457 Mouse 1300781 Lith8_m lithogenic gene 8 (mouse) Not determined 4 107264957 141265153 Mouse 39128212 Lwq21_m liver weight QTL 21 (mouse) 4 88982069 140468203 Mouse 4141180 Ssic1_m susceptibility to small intestinal cancer 1 (mouse) Not determined 120674005 154674151 Mouse 1301584 Lrdg2_m light induced retinal degeneration 2 (mouse) Not determined 4 129465811 151654550 Mouse 1301847 Fecq2_m fecundity QTL 2 (mouse) Not determined 4 100071971 134072206 Mouse 1302102 Bis1_m beta-carboline-induced seizures 1 (mouse) Not determined 4 119864433 153864536 Mouse 10043996 Gct5_m granulosa cell tumorigenesis 5 (mouse) Not determined 4 127784226 156860686 Mouse 26884445 Sklq7_m skull length QTL 7, 10 week (mouse) 4 68018237 150884457 Mouse 10043985 Stheal12_m soft tissue heal 12 (mouse) Not determined 4 121342649 155342753 Mouse 1301982 Pltiq1_m phospholipid transfer protein inducibility QTL 1 (mouse) Not determined 4 124621281 156860686 Mouse 26884437 Sklq13_m skull length QTL 13, 16 week (mouse) 4 57700000 155684457 Mouse 1300803 Sluc6_m susceptibility to lung cancer 6 (mouse) Not determined 4 120674005 154674151 Mouse 4141549 W10q10_m weight 10 weeks QTL 10 (mouse) Not determined 88982069 140468203 Mouse 4142061 Chlq16_m circulating hormone level QTL 16 (mouse) Not determined 4 121342649 155342753 Mouse 1357895 Ctrcts_m cataract severity (mouse) Not determined 4 45709925 138342753 Mouse 1300933 Cdcs9_m cytokine deficiency colitis susceptibility 9 (mouse) Not determined 4 125230872 156860686 Mouse 1300809 Ccrs2_m corpus callosum hemisphere surface size 2 (mouse) Not determined 4 107264957 141265153 Mouse 1301964 Bw8q2_m body weight at 8 weeks QTL 2 (mouse) Not determined 4 119864433 153864536 Mouse 1301452 Elsgp1_m elevated serum gp70 1 (mouse) Not determined 4 121342649 155342753 Mouse 1301106 Skts7_m skin tumor susceptibility 7 (mouse) Not determined 4 100071971 134072206 Mouse 10755520 Rbc1_m red blood cell count 1 (mouse) 4 108477692 142477692 Mouse 10755521 Hct1_m hematocrit 1 (mouse) 4 108477692 142477692 Mouse 10755522 Hgb1_m hemoglobin 1 (mouse) 4 108477692 142477692 Mouse 27095924 Pglq2_m pelvic girdle length QTL 2, 5 week (mouse) 4 69118237 130727311 Mouse 1300858 Tafat_m tally ho associated mesenteric fat pad weight (mouse) Not determined 4 124621281 156860686 Mouse 10755531 Lymph3_m lymphocyte differential 3 (mouse) 4 124553483 156860686 Mouse 27095917 Scvln14_m sacral vertebrae length 2, 16 week (mouse) 4 68018237 130277062 Mouse 15039382 Ltgq7_m liver triglyceride QTL 7 (mouse) 4 105705794 139705794 Mouse 11533916 Mts1_m mammary tumor susceptibility 1 (mouse) 4 125289325 156860686 Mouse 15039377 Bw45_m body weight QTL 45 (mouse) 4 105705794 139705794 Mouse 1300839 Dyscalc2_m dystrophic cardiac calcinosis 2 (mouse) Not determined 4 111009051 145009280 Mouse 12880433 Fgf23lq1_m FGF23 serum level QTL 1 (mouse) 4 101157197 135157197 Mouse 4141001 Tgq17_m triglyceride QTL 17 (mouse) Not determined 112523489 146523489 Mouse 15039378 Adip30_m adiposity 30 (mouse) 4 105705794 139705794 Mouse 1357800 Tgq3_m triglyceride QTL 3 (mouse) Not determined 4 107055093 141055180 Mouse 15039385 Mvlq3_m macrovesicular liver lesion QTL 3 (mouse) 4 112182386 146182386 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000030586 ⟹ ENSMUSP00000030586
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,513,067 - 129,517,740 (-) Ensembl GRCm38.p6 Ensembl 4 129,619,274 - 129,623,947 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000106035 ⟹ ENSMUSP00000101652
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,514,269 - 129,517,671 (-) Ensembl GRCm38.p6 Ensembl 4 129,620,476 - 129,623,878 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000123943
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,514,542 - 129,516,518 (-) Ensembl GRCm38.p6 Ensembl 4 129,620,749 - 129,622,725 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000124630
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,513,069 - 129,515,214 (-) Ensembl GRCm38.p6 Ensembl 4 129,619,276 - 129,621,421 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000126777
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,513,067 - 129,514,385 (-) Ensembl GRCm38.p6 Ensembl 4 129,619,274 - 129,620,592 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000141361
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,513,068 - 129,514,708 (-) Ensembl GRCm38.p6 Ensembl 4 129,619,275 - 129,620,915 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000150357 ⟹ ENSMUSP00000118241
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,514,796 - 129,517,679 (-) Ensembl GRCm38.p6 Ensembl 4 129,621,003 - 129,623,886 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000151838 ⟹ ENSMUSP00000122229
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,513,069 - 129,517,630 (-) Ensembl GRCm38.p6 Ensembl 4 129,619,276 - 129,623,837 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000152290
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,517,091 - 129,517,692 (-) Ensembl GRCm38.p6 Ensembl 4 129,623,298 - 129,623,899 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000152708
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 129,515,955 - 129,517,637 (-) Ensembl GRCm38.p6 Ensembl 4 129,622,162 - 129,623,844 (-) Ensembl
RefSeq Acc Id:
NM_025455 ⟹ NP_079731
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,513,067 - 129,517,701 (-) NCBI GRCm38 4 129,619,274 - 129,623,908 (-) ENTREZGENE MGSCv37 4 129,296,518 - 129,301,152 (-) RGD Celera 4 127,952,595 - 127,957,032 (-) RGD cM Map 4 ENTREZGENE
Sequence:
TCCCTCCAGCTCCAGTTCCCCTGAGGAGAGAGAAAGCAGGGTGAAGGGAGATTGCAAAGAAGCACTGTTTCACACTCCAGACCCCAAACTTCCAGACCTGAGGTCCAACACACCACCCAATGGAAGAC
hide sequence
RefSeq Acc Id:
XM_030253696 ⟹ XP_030109556
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,513,067 - 129,515,508 (-) NCBI GRCm38 4 129,619,274 - 129,621,720 (-) NCBI
Sequence:
CCATACCATCTGCCTGGCCAGCATGTACTGGCATGGCCATAGTAGATTTTATCCGGAGCTCAGGGCTGGCTCTTTGAGAATGGTAGGAAATGCAGTCGGAGAGGAAGGAAAGCCCAACTGGCTGCTGT
hide sequence
RefSeq Acc Id:
XM_036164307 ⟹ XP_036020200
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 129,513,067 - 129,517,820 (-) NCBI
Sequence:
GGGAGGTAGGGAAGGGGAACTGTTAAATCGACGGAAGTACTCTCCTCCGGCTCCGCTCCCAGGG
hide sequence
RefSeq Acc Id:
NP_079731 ⟸ NM_025455
- UniProtKB:
A2ADZ9 (UniProtKB/Swiss-Prot), Q8K132 (UniProtKB/Swiss-Prot), Q8CEG5 (UniProtKB/Swiss-Prot), Q9D1N8 (UniProtKB/TrEMBL)
- Sequence:
MEDKKKKRSPKPCLTQPAQAPGTLRRVPVPTSHSGSLALGLPHLPSPKQRAKFKRAGKEKCRPVLAGGGGGSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEK
hide sequence
RefSeq Acc Id:
XP_030109556 ⟸ XM_030253696
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSMUSP00000118241 ⟸ ENSMUST00000150357
Ensembl Acc Id:
ENSMUSP00000122229 ⟸ ENSMUST00000151838
Ensembl Acc Id:
ENSMUSP00000101652 ⟸ ENSMUST00000106035
Ensembl Acc Id:
ENSMUSP00000030586 ⟸ ENSMUST00000030586
RefSeq Acc Id:
XP_036020200 ⟸ XM_036164307
- Peptide Label:
isoform X2
- UniProtKB:
Q8CEG5 (UniProtKB/Swiss-Prot), A2ADZ9 (UniProtKB/Swiss-Prot), Q8K132 (UniProtKB/Swiss-Prot), Q9D1N8 (UniProtKB/TrEMBL)
RGD ID: 6835024 Promoter ID: MM_KWN:39810 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, Brain, Lung Transcripts: OTTMUST00000021803, OTTMUST00000068942, UC008UXT.1, UC008UXV.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 129,298,001 - 129,298,727 (-) MPROMDB
RGD ID: 6835022 Promoter ID: MM_KWN:39811 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: OTTMUST00000068944 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 129,299,676 - 129,300,176 (-) MPROMDB
RGD ID: 6835020 Promoter ID: MM_KWN:39813 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000021797, OTTMUST00000021800, OTTMUST00000021801, OTTMUST00000021802, OTTMUST00000068941, OTTMUST00000068943, UC008UXW.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 129,301,051 - 129,301,727 (-) MPROMDB
RGD ID: 6884788 Promoter ID: EPDNEW_M5845 Type: multiple initiation site Name: Ccdc28b_2 Description: Mus musculus coiled coil domain containing 28B , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5846 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 129,621,417 - 129,621,477 EPDNEW
RGD ID: 6884790 Promoter ID: EPDNEW_M5846 Type: initiation region Name: Ccdc28b_1 Description: Mus musculus coiled coil domain containing 28B , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5845 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 129,623,895 - 129,623,955 EPDNEW
