Advanced Search (OLGA)

Gene: LURAP1 (leucine rich adaptor protein 1) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

LURAP1

Name:

leucine rich adaptor protein 1

RGD ID:

1605156

HGNC Page

HGNC:32327

Description:

Involved in positive regulation of canonical NF-kappaB signal transduction and positive regulation of cytokine production. Located in cytosol and intracellular membrane-bounded organelle.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

C1orf190; FLJ25163; hypothetical protein LOC541468; leucine repeat adapter protein 35A; leucine repeat adaptor protein 35a; LRAP35a; LRP35A; NF-kappa-B activator C1orf190

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Lurap1 (leucine rich adaptor protein 1)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Lurap1 (leucine rich adaptor protein 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Lurap1 (leucine rich adaptor protein 1)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	LURAP1 (leucine rich adaptor protein 1)	NCBI	Ortholog
Canis lupus familiaris (dog):	LURAP1 (leucine rich adaptor protein 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Lurap1 (leucine rich adaptor protein 1)	NCBI	Ortholog
Sus scrofa (pig):	LURAP1 (leucine rich adaptor protein 1)	HGNC	EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):	LURAP1 (leucine rich adaptor protein 1)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Lurap1 (leucine rich adaptor protein 1)	NCBI	Ortholog
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Lurap1 (leucine rich adaptor protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Lurap1 (leucine rich adaptor protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	lurap1 (leucine rich adaptor protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid\|ZFIN)
Xenopus laevis (African clawed frog):	lurap1.S	Alliance	DIOPT (Xenbase)
Xenopus laevis (African clawed frog):	lurap1.L	Alliance	DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):	lurap1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	46,203,334 - 46,221,256 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	46,203,334 - 46,221,256 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	46,669,006 - 46,686,928 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	46,441,593 - 46,459,746 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	44,956,745 - 44,974,672 (+)	NCBI		Celera
Cytogenetic Map	1	p34.1	NCBI
HuRef	1	44,783,996 - 44,802,228 (+)	NCBI		HuRef
CHM1_1	1	46,786,144 - 46,804,069 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	46,075,666 - 46,098,473 (+)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
LURAP1	Human	autosomal recessive limb-girdle muscular dystrophy type 2O		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Autosomal recessive limb-girdle muscular dystrophy type 2O	ClinVar	PMID:19299310 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
LURAP1	Human	(1->4)-beta-D-glucan	multiple interactions	ISO	Lurap1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of LURAP1 mRNA	CTD	PMID:36331819
LURAP1	Human	1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene	multiple interactions	ISO	Lurap1 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
LURAP1	Human	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	Lurap1 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
LURAP1	Human	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	Lurap1 (Rattus norvegicus)	6480464	2 more ...	CTD	PMID:27291303
LURAP1	Human	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	ISO	Lurap1 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
LURAP1	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Lurap1 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of LURAP1 mRNA	CTD	PMID:33387578
LURAP1	Human	2,4,4'-trichlorobiphenyl	multiple interactions	ISO	Lurap1 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
LURAP1	Human	acrylamide	affects expression	ISO	Lurap1 (Rattus norvegicus)	6480464	Acrylamide affects the expression of LURAP1 mRNA	CTD	PMID:28959563
LURAP1	Human	arsane	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of LURAP1 mRNA	CTD	PMID:39836092
LURAP1	Human	arsenic atom	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of LURAP1 mRNA	CTD	PMID:39836092
LURAP1	Human	benzo[a]pyrene	increases methylation	EXP		6480464	Benzo(a)pyrene results in increased methylation of LURAP1 exon and Benzo(a)pyrene results in increased methylation of LURAP1 promoter	CTD	PMID:27901495
LURAP1	Human	bisphenol A	decreases expression	ISO	Lurap1 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of LURAP1 mRNA	CTD	PMID:30816183 more ...
LURAP1	Human	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of LURAP1 mRNA	CTD	PMID:38568856
LURAP1	Human	doxorubicin	decreases expression	EXP		6480464	Doxorubicin results in decreased expression of LURAP1 mRNA	CTD	PMID:29803840
LURAP1	Human	furan	decreases expression	ISO	Lurap1 (Rattus norvegicus)	6480464	furan results in decreased expression of LURAP1 mRNA	CTD	PMID:26194646
LURAP1	Human	gentamycin	decreases expression	ISO	Lurap1 (Rattus norvegicus)	6480464	Gentamicins results in decreased expression of LURAP1 mRNA	CTD	PMID:33387578
LURAP1	Human	manganese atom	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of LURAP1 mRNA	CTD	PMID:39836092
LURAP1	Human	manganese(0)	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of LURAP1 mRNA	CTD	PMID:39836092
LURAP1	Human	manganese(II) chloride	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of LURAP1 mRNA	CTD	PMID:39836092
LURAP1	Human	melphalan	decreases expression	EXP		6480464	Melphalan results in decreased expression of LURAP1 mRNA	CTD	PMID:22363485
LURAP1	Human	methamphetamine	multiple interactions	ISO	Lurap1 (Rattus norvegicus)	6480464	[Methamphetamine co-treated with SCH 23390] results in decreased expression of LURAP1 mRNA	CTD	PMID:19564919
LURAP1	Human	methamphetamine	decreases expression	ISO	Lurap1 (Rattus norvegicus)	6480464	Methamphetamine results in decreased expression of LURAP1 mRNA	CTD	PMID:19564919
LURAP1	Human	nitrofen	decreases expression	ISO	Lurap1 (Rattus norvegicus)	6480464	nitrofen results in decreased expression of LURAP1 mRNA	CTD	PMID:33484710
LURAP1	Human	okadaic acid	decreases expression	EXP		6480464	Okadaic Acid results in decreased expression of LURAP1 mRNA	CTD	PMID:38832940
LURAP1	Human	p-chloromercuribenzoic acid	increases expression	EXP		6480464	p-Chloromercuribenzoic Acid results in increased expression of LURAP1 mRNA	CTD	PMID:27188386
LURAP1	Human	paracetamol	decreases expression	ISO	Lurap1 (Rattus norvegicus)	6480464	Acetaminophen results in decreased expression of LURAP1 mRNA	CTD	PMID:33387578
LURAP1	Human	PCB138	multiple interactions	ISO	Lurap1 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
LURAP1	Human	pentanal	decreases expression	EXP		6480464	pentanal results in decreased expression of LURAP1 mRNA	CTD	PMID:26079696
LURAP1	Human	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Lurap1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of LURAP1 mRNA	CTD	PMID:36331819
LURAP1	Human	SCH 23390	decreases expression	ISO	Lurap1 (Rattus norvegicus)	6480464	SCH 23390 results in decreased expression of LURAP1 mRNA	CTD	PMID:19564919
LURAP1	Human	SCH 23390	multiple interactions	ISO	Lurap1 (Rattus norvegicus)	6480464	[Methamphetamine co-treated with SCH 23390] results in decreased expression of LURAP1 mRNA	CTD	PMID:19564919
LURAP1	Human	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of LURAP1 mRNA	CTD	PMID:38568856
LURAP1	Human	sodium arsenite	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of LURAP1 mRNA	CTD	PMID:39836092
LURAP1	Human	sunitinib	decreases expression	EXP		6480464	Sunitinib results in decreased expression of LURAP1 mRNA	CTD	PMID:31533062
LURAP1	Human	thiram	decreases expression	EXP		6480464	Thiram results in decreased expression of LURAP1 mRNA	CTD	PMID:38568856
LURAP1	Human	titanium dioxide	decreases expression	ISO	Lurap1 (Mus musculus)	6480464	titanium dioxide results in decreased expression of LURAP1 mRNA	CTD	PMID:29264374
LURAP1	Human	triclosan	decreases expression	EXP		6480464	Triclosan results in decreased expression of LURAP1 mRNA	CTD	PMID:30510588
LURAP1	Human	vinclozolin	decreases methylation	ISO	Lurap1 (Rattus norvegicus)	6480464	vinclozolin results in decreased methylation of LURAP1 gene	CTD	PMID:31682807

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
LURAP1	Human	actomyosin structure organization	involved_in	ISO	Lurap1 (Rattus norvegicus)	9068941	PMID:18854160	UniProt	PMID:18854160 and REF_RGD_ID:8553532
LURAP1	Human	cell migration	involved_in	ISO	Lurap1 (Rattus norvegicus)	9068941	PMID:18854160	UniProt	PMID:18854160 and REF_RGD_ID:8553532
LURAP1	Human	positive regulation of canonical NF-kappaB signal transduction	involved_in	IEA	InterPro:IPR037443	150520179		InterPro	GO_REF:0000002
LURAP1	Human	positive regulation of canonical NF-kappaB signal transduction	involved_in	IBA	PANTHER:PTN002853007 and UniProtKB:Q96LR2	150520179		GO_Central	GO_REF:0000033
LURAP1	Human	positive regulation of canonical NF-kappaB signal transduction	involved_in	IDA		150520179	PMID:21048106	UniProt	PMID:21048106
LURAP1	Human	positive regulation of cytokine production	involved_in	IDA		150520179	PMID:21048106	UniProt	PMID:21048106
LURAP1	Human	positive regulation of cytokine production	involved_in	IBA	PANTHER:PTN002853007 and UniProtKB:Q96LR2	150520179		GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
LURAP1	Human	actomyosin	located_in	ISO	Lurap1 (Rattus norvegicus)	9068941	PMID:18854160	UniProt	PMID:18854160 and REF_RGD_ID:8553532
LURAP1	Human	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	150520179		UniProt	GO_REF:0000044
LURAP1	Human	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	150520179		UniProt	GO_REF:0000043
LURAP1	Human	cytoplasm	located_in	IDA		150520179	PMID:21048106	UniProt	PMID:21048106
LURAP1	Human	cytosol	located_in	IDA		150520179		HPA	GO_REF:0000052

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
LURAP1	Human	protein binding	enables	IPI	UniProtKB:Q8N3L3	150520179	PMID:33961781	IntAct	PMID:33961781
LURAP1	Human	protein binding	enables	IPI	UniProtKB:A2BDD9 more ...	150520179	PMID:32296183	IntAct	PMID:32296183
LURAP1	Human	protein binding	enables	IPI	UniProtKB:O14964	150520179	PMID:16189514	IntAct	PMID:16189514
LURAP1	Human	protein binding	enables	IPI	UniProtKB:O14901 more ...	150520179	PMID:32814053	IntAct	PMID:32814053
LURAP1	Human	protein binding	enables	IPI	UniProtKB:P06753 more ...	150520179	PMID:25416956	IntAct	PMID:25416956
LURAP1	Human	protein binding	enables	IPI	UniProtKB:P06753 more ...	150520179	PMID:31515488	IntAct	PMID:31515488
LURAP1	Human	protein binding	enables	IPI	UniProtKB:Q8WWY3	150520179	PMID:25910212	IntAct	PMID:25910212

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:14702039	PMID:15489334	PMID:16189514	PMID:16710414	PMID:18854160	PMID:21048106	PMID:21873635	PMID:25416956	PMID:25910212	PMID:28514442	PMID:30021884
PMID:31515488	PMID:32296183	PMID:32814053	PMID:33660365	PMID:33961781	PMID:34525355	PMID:35914814

LURAP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	46,203,334 - 46,221,256 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	46,203,334 - 46,221,256 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	46,669,006 - 46,686,928 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	46,441,593 - 46,459,746 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	44,956,745 - 44,974,672 (+)	NCBI		Celera
Cytogenetic Map	1	p34.1	NCBI
HuRef	1	44,783,996 - 44,802,228 (+)	NCBI		HuRef
CHM1_1	1	46,786,144 - 46,804,069 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	46,075,666 - 46,098,473 (+)	NCBI		T2T-CHM13v2.0

Lurap1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	115,993,925 - 116,001,813 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	115,989,603 - 116,008,535 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	116,136,728 - 116,144,616 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	116,132,406 - 116,151,338 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	115,809,333 - 115,817,221 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	115,634,623 - 115,642,548 (-)	NCBI		MGSCv36	mm8
Celera	4	114,874,876 - 114,882,764 (-)	NCBI		Celera
Cytogenetic Map	4	D1	NCBI
cM Map	4	53.1	NCBI

Lurap1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	134,855,643 - 134,865,366 (-)	NCBI		GRCr8
mRatBN7.2	5	129,618,926 - 129,628,651 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	129,614,137 - 129,628,766 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	132,235,108 - 132,244,946 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	133,989,695 - 133,999,533 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	134,012,131 - 134,021,969 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	134,991,997 - 135,001,720 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	134,991,997 - 135,001,720 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	138,775,907 - 138,785,616 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	136,414,033 - 136,423,756 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	128,147,570 - 128,157,166 (-)	NCBI		Celera
Cytogenetic Map	5	q35	NCBI

Lurap1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955464	12,056,588 - 12,072,266 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955464	12,056,588 - 12,072,266 (-)	NCBI	ChiLan1.0	ChiLan1.0

LURAP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	180,577,178 - 180,602,346 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	179,718,777 - 179,743,933 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	45,508,798 - 45,527,340 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	46,864,060 - 46,881,670 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	46,864,060 - 46,881,670 (+)	Ensembl	panpan1.1		panPan2

LURAP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	14,156,338 - 14,178,882 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	14,162,087 - 14,173,488 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	14,279,120 - 14,300,752 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	14,309,418 - 14,331,200 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	14,312,749 - 14,325,887 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	14,110,679 - 14,132,274 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	14,179,166 - 14,200,756 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	14,248,643 - 14,270,390 (-)	NCBI		UU_Cfam_GSD_1.0

Lurap1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	61,417,344 - 61,432,579 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	27,242,077 - 27,252,695 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	27,241,666 - 27,254,405 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LURAP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	165,188,925 - 165,207,730 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	165,187,707 - 165,208,191 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	152,674,047 - 152,687,490 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LURAP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	86,566,427 - 86,583,741 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	86,566,551 - 86,583,175 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	30,403,324 - 30,421,671 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lurap1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624906	2,133,747 - 2,150,860 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in LURAP1
22 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 1p34.3-33(chr1:39479787-47688131)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051817]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051817]\|See cases [RCV000051817]	Chr1:39479787..47688131 [GRCh38] Chr1:39945459..48153803 [GRCh37] Chr1:39718046..47926390 [NCBI36] Chr1:1p34.3-33	pathogenic
GRCh38/hg38 1p34.1(chr1:45488251-46220805)x3	copy number gain	See cases [RCV000137659]	Chr1:45488251..46220805 [GRCh38] Chr1:45953923..46686477 [GRCh37] Chr1:45726510..46459064 [NCBI36] Chr1:1p34.1	uncertain significance
GRCh38/hg38 1p34.1(chr1:45469848-46220805)x3	copy number gain	See cases [RCV000141255]	Chr1:45469848..46220805 [GRCh38] Chr1:45935520..46686477 [GRCh37] Chr1:45708107..46459064 [NCBI36] Chr1:1p34.1	likely benign\|uncertain significance
GRCh37/hg19 1p36.12-12(chr1:20608823-120546301)x3	copy number loss	not provided [RCV000762767]	Chr1:20608823..120546301 [GRCh37] Chr1:1p36.12-12	likely benign
GRCh37/hg19 1p34.1(chr1:46078097-46725770)x3	copy number gain	See cases [RCV000448110]	Chr1:46078097..46725770 [GRCh37] Chr1:1p34.1	uncertain significance
GRCh37/hg19 1p34.1-32.3(chr1:45303358-52157856)x1	copy number loss	See cases [RCV000448358]	Chr1:45303358..52157856 [GRCh37] Chr1:1p34.1-32.3	likely pathogenic
NM_001013615.3(LURAP1):c.620A>G (p.Gln207Arg)	single nucleotide variant	not provided [RCV004715215]\|not specified [RCV000455955]	Chr1:46220120 [GRCh38] Chr1:46685792 [GRCh37] Chr1:1p34.1	benign
GRCh37/hg19 1p36.33-q44(chr1:849467-249224684)x3	copy number gain	See cases [RCV000510383]	Chr1:849467..249224684 [GRCh37] Chr1:1p36.33-q44	pathogenic
GRCh37/hg19 1p34.1-33(chr1:46541307-47088882)x3	copy number gain	See cases [RCV000511609]	Chr1:46541307..47088882 [GRCh37] Chr1:1p34.1-33	uncertain significance
GRCh37/hg19 1p36.33-q44(chr1:849467-249224684)	copy number gain	See cases [RCV000510926]	Chr1:849467..249224684 [GRCh37] Chr1:1p36.33-q44	pathogenic
GRCh37/hg19 1p36.33-q44(chr1:82154-249218992)x3	copy number gain	not provided [RCV000736305]	Chr1:82154..249218992 [GRCh37] Chr1:1p36.33-q44	pathogenic
GRCh37/hg19 1p36.33-q44(chr1:47851-249228449)x3	copy number gain	not provided [RCV000736295]	Chr1:47851..249228449 [GRCh37] Chr1:1p36.33-q44	pathogenic
GRCh37/hg19 1p34.1-33(chr1:46372688-47188150)x3	copy number gain	not provided [RCV000736482]	Chr1:46372688..47188150 [GRCh37] Chr1:1p34.1-33	uncertain significance
GRCh37/hg19 1p36.22-21.1(chr1:103343285-103455144)x3	copy number gain	Global developmental delay [RCV000787285]	Chr1:103343285..103455144 [GRCh37] Chr1:1p36.22-21.1	uncertain significance
GRCh37/hg19 1p34.1-33(chr1:46501759-46898503)x3	copy number gain	not provided [RCV001005084]	Chr1:46501759..46898503 [GRCh37] Chr1:1p34.1-33	uncertain significance
NM_001013615.3(LURAP1):c.463G>A (p.Glu155Lys)	single nucleotide variant	not specified [RCV004302417]	Chr1:46219963 [GRCh38] Chr1:46685635 [GRCh37] Chr1:1p34.1	uncertain significance
GRCh37/hg19 1p34.1(chr1:46083531-46738006)	copy number gain	not specified [RCV002053292]	Chr1:46083531..46738006 [GRCh37] Chr1:1p34.1	uncertain significance
GRCh37/hg19 1p35.1-33(chr1:33285582-47891811)	copy number gain	not specified [RCV002052781]	Chr1:33285582..47891811 [GRCh37] Chr1:1p35.1-33	pathogenic
GRCh37/hg19 1p34.1-32.3(chr1:45303358-52157856)	copy number loss	not specified [RCV002053281]	Chr1:45303358..52157856 [GRCh37] Chr1:1p34.1-32.3	likely pathogenic
NC_000001.10:g.(?_46662483)_(46671639_?)del	deletion	Autosomal recessive limb-girdle muscular dystrophy type 2O [RCV001959106]	Chr1:46662483..46671639 [GRCh37] Chr1:1p34.1	pathogenic
NM_001013615.3(LURAP1):c.143C>T (p.Ala48Val)	single nucleotide variant	not specified [RCV004216040]	Chr1:46203569 [GRCh38] Chr1:46669241 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.221T>G (p.Val74Gly)	single nucleotide variant	not specified [RCV004218619]	Chr1:46219721 [GRCh38] Chr1:46685393 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.460A>G (p.Ser154Gly)	single nucleotide variant	not specified [RCV004163962]	Chr1:46219960 [GRCh38] Chr1:46685632 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.413G>A (p.Arg138Gln)	single nucleotide variant	not specified [RCV004226227]	Chr1:46219913 [GRCh38] Chr1:46685585 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.355C>T (p.Pro119Ser)	single nucleotide variant	not specified [RCV004253796]	Chr1:46219855 [GRCh38] Chr1:46685527 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.430A>C (p.Ile144Leu)	single nucleotide variant	not specified [RCV004350852]	Chr1:46219930 [GRCh38] Chr1:46685602 [GRCh37] Chr1:1p34.1	uncertain significance
Single allele	inversion	Bilateral polymicrogyria [RCV003459046]	Chr1:33246132..61045156 [GRCh38] Chr1:1p35.1-31.3	likely pathogenic
NM_001013615.3(LURAP1):c.669C>T (p.Phe223=)	single nucleotide variant	not provided [RCV003406472]	Chr1:46220169 [GRCh38] Chr1:46685841 [GRCh37] Chr1:1p34.1	likely benign
NM_001013615.3(LURAP1):c.127C>A (p.Leu43Met)	single nucleotide variant	not specified [RCV004410885]	Chr1:46203553 [GRCh38] Chr1:46669225 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.199G>T (p.Ala67Ser)	single nucleotide variant	not specified [RCV004410886]	Chr1:46219699 [GRCh38] Chr1:46685371 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.289C>T (p.Arg97Trp)	single nucleotide variant	not specified [RCV004410887]	Chr1:46219789 [GRCh38] Chr1:46685461 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.349G>A (p.Gly117Arg)	single nucleotide variant	not specified [RCV004410888]	Chr1:46219849 [GRCh38] Chr1:46685521 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.661C>G (p.Leu221Val)	single nucleotide variant	not specified [RCV004410891]	Chr1:46220161 [GRCh38] Chr1:46685833 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.412C>T (p.Arg138Trp)	single nucleotide variant	not specified [RCV004640276]	Chr1:46219912 [GRCh38] Chr1:46685584 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.262G>A (p.Glu88Lys)	single nucleotide variant	not specified [RCV004636329]	Chr1:46219762 [GRCh38] Chr1:46685434 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.38G>T (p.Arg13Leu)	single nucleotide variant	not specified [RCV004636330]	Chr1:46203464 [GRCh38] Chr1:46669136 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.607G>A (p.Gly203Arg)	single nucleotide variant	not specified [RCV004942197]	Chr1:46220107 [GRCh38] Chr1:46685779 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.152C>G (p.Thr51Ser)	single nucleotide variant	not specified [RCV004942198]	Chr1:46203578 [GRCh38] Chr1:46669250 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.251A>G (p.Asn84Ser)	single nucleotide variant	not specified [RCV004942196]	Chr1:46219751 [GRCh38] Chr1:46685423 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.398C>A (p.Thr133Asn)	single nucleotide variant	not specified [RCV004942194]	Chr1:46219898 [GRCh38] Chr1:46685570 [GRCh37] Chr1:1p34.1	uncertain significance
NM_001013615.3(LURAP1):c.133C>T (p.Leu45Phe)	single nucleotide variant	not specified [RCV004942195]	Chr1:46203559 [GRCh38] Chr1:46669231 [GRCh37] Chr1:1p34.1	uncertain significance
GRCh37/hg19 1p34.1-22.2(chr1:44475302-89585894)x3	copy number gain	not provided [RCV004819297]	Chr1:44475302..89585894 [GRCh37] Chr1:1p34.1-22.2	pathogenic

Predicted Target Of

	Summary Value
Count of predictions:	563
Count of miRNA genes:	427
Interacting mature miRNAs:	445
Transcripts:	ENST00000371980
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2314561	GLUCO47_H	Glucose level QTL 47 (human)	1.1		Glucose level		1	44773360	70773360	Human
597322524	GWAS1418598_H	lipid measurement QTL GWAS1418598 (human)		3e-103	lipid measurement	blood lipid measurement (CMO:0000050)	1	46206590	46206591	Human

L30021

Human Assembly	Chr	Position (strand)	Source
Cytogenetic Map	19	p13.11	UniSTS
Cytogenetic Map	17	q21.31	UniSTS
Cytogenetic Map	X	q26.3	UniSTS
Cytogenetic Map	4	p16.3	UniSTS
Cytogenetic Map	17	q11.2	UniSTS
Cytogenetic Map	2	q33.2	UniSTS
Cytogenetic Map	1	p34	UniSTS
Cytogenetic Map	12	q13.1	UniSTS
Cytogenetic Map	2	q31.2	UniSTS
Cytogenetic Map	8	q24.3	UniSTS
Cytogenetic Map	19	q13.12	UniSTS
Cytogenetic Map	12	q24.13	UniSTS
Cytogenetic Map	8	q22.1	UniSTS
Cytogenetic Map	16	p13.3	UniSTS
Cytogenetic Map	16	p12.3	UniSTS
Cytogenetic Map	6	q21	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2403	2783	2245	4972	1684	2261	6	582	1474	423	2268	6753	5998	51	3734	1	844	1736	1571	174	1


RefSeq Transcripts	NG_009205	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001013615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054337100	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AI077554	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK057892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL672043	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC034422	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX370151	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471059	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068277	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR746264	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000371980 ⟹ ENSP00000361048

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	1	46,203,334 - 46,221,256 (+)	Ensembl

RefSeq Acc Id:

NM_001013615 ⟹ NP_001013633

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	1	46,203,334 - 46,221,256 (+)	NCBI
GRCh37	1	46,669,006 - 46,686,928 (+)	RGD
Build 36	1	46,441,593 - 46,459,746 (+)	NCBI Archive
Celera	1	44,956,745 - 44,974,672 (+)	RGD
HuRef	1	44,783,996 - 44,802,228 (+)	ENTREZGENE
CHM1_1	1	46,786,144 - 46,804,069 (+)	NCBI
T2T-CHM13v2.0	1	46,080,552 - 46,098,473 (+)	NCBI

Sequence:

show sequence

GGTTTTGCTCCGCTTTAGCAGCGGCGAAGGGAGGACCCCCGGGAGCCGGTCCCCGGCGTCCGGTCGCCCAGCCCTTTTCAGGCTTGGGCCCGCATGGAGGGGACCGTGGAGTCCCAGACGCCTGACCT
GCGGGATGTGGAGGGTAAGGTGGGCAGGAAGACCCCTGAAGGGCTGCTCCGCGGGCTGCGAGGCGAGTGTGAGCTGGGAACCTCTGGCGCCCTGCTGCTCCCAGGGGCGTCTAGCACCGGCCACGACT
TGGGGGACAAGATCATGGCGCTGAAGATGGAGCTGGCTTACCTGCGAGCCATCGATGTGAAGATCCTGCAGCAGCTGGTGACCTTGAATGAGGGCATCGAGGCAGTGCGCTGGCTGTTGGAGGAGCGG
GGGACGTTGACCAGTCATTGCAGCAGCCTCACCAGCAGTCAATATAGCCTGACAGGCGGGAGCCCAGGCCGCTCAAGGCGAGGCAGCTGGGACAGCCTGCCAGACACCAGCACCACCGACCGGCTGGA
CAGTGTCTCTATTGGCAGCTTCCTGGACACAGTGGCCCCCAGCGAGCTGGATGAACAGGGCCCACCTGGGGCTCCACGTTCCGAGATGGACTGGGCAAAAGTTATAGCTGGTGGAGAGAGGGCCAGGA
CTGAGGTGGATGTGGCAGCCACCAGGCTAGGGAGCTTGAGAGCTGTGTGGAAGCCCCCAGGGGAGAGGCTTCAAGGTGGACCACCTGAGTCACCAGAGGATGAGAGTGCCAAGCTGGGCTTCGAGGCC
CACTGGTTCTGGGAGCAGTGCCAGGATGATGTGACCTTCTTGTAACAACTATTCCACCCTTTTGTAATCCTGTGGCTCTTTTATCCATTAGATGTGGTCTCCCCCAAAATTGATTCTCCCTCAGTCTG
AGACTAGGAAGAGGCTGCACTGAAATCAGTTACCATGGAAACCTGGCTCATCATTTCTCTAGTCCCTAGGGAGTCTCTGCCTTTATCCCTCAATTATTGGGTCCCTAGAGCTAGCTTGCTCTTTCTTT
CTTTCTTTCTTTTTTTGAGACAGGGTCTTATGCTGTTACCCAAGATAGAGAGCAGTGGCATGATCACAGCTCACTGCAGCCTTGACCTCCTGGGCTCAAGCGATCCTCCTATTTCAGCCTCCCCCATA
GTTAGGACCACAGGCATGCACCACCATGCCCAGCTAATTGTTTATTTATTTATTTTTTTTTTGTAGAGATAGGGTTTCCCTGTGTTGCCCAGGCTGGTCTCAAACTCCTGGGCTCAAGGGATCCTCCC
GCCTCAGCCTCCCAAAGTGCTGGGATTATGCCCAGCCCCTAGAGATACTTCTATAGAGATATTGACTCTAAAGGATTGACCTATGGCTTTTGGTATTTAGTATCTCTCACTACTCCCCCCAGCTAAGT
AAGGATTTAAGGAATTTAGGACTCCCTGGAGTTAACAGATGAAGAGATGGGGGCATAATTACTTCACCCAAAGTCTAGAAGCCTTGGCCTCTCTCTTGGCCAAGATGGAGGATTGAGGAGGGACATGG
ACCTTCAGGACTAACCCTCTATGGATTGGCCCTCCCAGAAGCGTTTGGGCTGGTAGACCCACCCCTTCCTACCTGCTGAGTGATGTCATTTCCTGCCAGGATGGGTAGCCCTTTGTACGGGTCCTTGG
ATGGTAGTAGGTCATATAGGGGCATCTGAGCCCCTGCTGCTAAGTGAGATCACATTATTTATCGTCCATACCATTACTTCTTGTGAACAGTAACATGTCACTCCTCCTGGCAGGAAAGTTTCTCATTG
TCAGATGTTTGTGCTTCTTTTCAGGTCTTACTTTTTAAATAGAGTGTTCTCATTTTA

hide sequence

RefSeq Acc Id:

XM_054337100 ⟹ XP_054193075

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
T2T-CHM13v2.0	1	46,075,666 - 46,098,473 (+)	NCBI


Protein RefSeqs	NP_001013633	(Get FASTA)	NCBI Sequence Viewer
	XP_054193075	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH34422	(Get FASTA)	NCBI Sequence Viewer
	BAB71608	(Get FASTA)	NCBI Sequence Viewer
	EAX06931	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000361048
	ENSP00000361048.3
GenBank Protein	Q96LR2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001013633 ⟸ NM_001013615

- UniProtKB:

Q96LR2 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MEGTVESQTPDLRDVEGKVGRKTPEGLLRGLRGECELGTSGALLLPGASSTGHDLGDKIMALKMELAYLRAIDVKILQQLVTLNEGIEAVRWLLEERGTLTSHCSSLTSSQYSLTGGSPGRSRRGSWD
SLPDTSTTDRLDSVSIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRLGSLRAVWKPPGERLQGGPPESPEDESAKLGFEAHWFWEQCQDDVTFL

hide sequence

Ensembl Acc Id:

ENSP00000361048 ⟸ ENST00000371980

RefSeq Acc Id:	XP_054193075 ⟸ XM_054337100
- Peptide Label:	isoform X1
- UniProtKB:	Q96LR2 (UniProtKB/Swiss-Prot)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q96LR2-F1-model_v2	AlphaFold	Q96LR2	1-239	view protein structure

RGD ID:

6855398

Promoter ID:

EPDNEW_H864

Type:

initiation region

Name:

LURAP1_2

Description:

leucine rich adaptor protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H865

Experiment Methods:

Single-end sequencing.; Paired-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	1	46,202,915 - 46,202,975	EPDNEW

RGD ID:

6855400

Promoter ID:

EPDNEW_H865

Type:

initiation region

Name:

LURAP1_1

Description:

leucine rich adaptor protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H864

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	1	46,203,334 - 46,203,394	EPDNEW

RGD ID:

6784774

Promoter ID:

HG_KWN:2548

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

K562, Lymphoblastoid

Transcripts:

ENST00000307185, ENST00000371980, UC001CPK.1

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	1	46,441,331 - 46,441,831 (+)	MPROMDB

Database	Acc Id	Source(s)
COSMIC	LURAP1	COSMIC
Ensembl Genes	ENSG00000171357	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000371980	ENTREZGENE
	ENST00000371980.4	UniProtKB/Swiss-Prot
GTEx	ENSG00000171357	GTEx
HGNC ID	HGNC:32327	ENTREZGENE
Human Proteome Map	LURAP1	Human Proteome Map
InterPro	LURA1/LRA25	UniProtKB/Swiss-Prot
	LURAP1	UniProtKB/Swiss-Prot
KEGG Report	hsa:541468	UniProtKB/Swiss-Prot
NCBI Gene	541468	ENTREZGENE
OMIM	616129	OMIM
PANTHER	LEUCINE RICH ADAPTOR PROTEIN 1	UniProtKB/Swiss-Prot
	PTHR33767	UniProtKB/Swiss-Prot
Pfam	LURAP	UniProtKB/Swiss-Prot
PharmGKB	PA142672401	PharmGKB
UniProt	LURA1_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-02-07	LURAP1	leucine rich adaptor protein 1	C1orf190	chromosome 1 open reading frame 190	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar