Symbol:
RNF39
Name:
ring finger protein 39
RGD ID:
1604283
HGNC Page
HGNC:18064
Description:
Enables ubiquitin protein ligase activity. Involved in negative regulation of cytoplasmic pattern recognition receptor signaling pathway; positive regulation of cGAS/STING signaling pathway; and protein K63-linked ubiquitination. Is active in cytoplasm. Biomarker of cholangiocarcinoma.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
FAP216; HZF; HZFW; LIRF; LTP (long-term potentiation) induced RING finger protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Rnf39 (ring finger protein 39) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Rnf39 (ring finger protein 39) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Rnf39 (ring finger protein 39) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
RNF39 (ring finger protein 39) NCBI
Ortholog
Canis lupus familiaris (dog):
RNF39 (ring finger protein 39) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rnf39 (ring finger protein 39) NCBI
Ortholog
Sus scrofa (pig):
RNF39 (ring finger protein 39) HGNC
Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
RNF39 (ring finger protein 39) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Rnf39 (ring finger protein 39) NCBI
Ortholog
Other homologs 2
Mus musculus (house mouse):
Trim7 (tripartite motif-containing 7) HGNC
Treefam
Rattus norvegicus (Norway rat):
Utp14a (UTP14A small subunit processome component) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Rnf39 (ring finger protein 39)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Rnf39 (ring finger protein 39)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
B0281.8
Alliance
DIOPT (Ensembl Compara|InParanoid)
Caenorhabditis elegans (roundworm):
C28G1.5
Alliance
DIOPT (Ensembl Compara|InParanoid)
Caenorhabditis elegans (roundworm):
F43C11.7
Alliance
DIOPT (Ensembl Compara|InParanoid)
Caenorhabditis elegans (roundworm):
ZK1240.5
Alliance
DIOPT (Ensembl Compara|InParanoid)
Caenorhabditis elegans (roundworm):
ZK1240.8
Alliance
DIOPT (Ensembl Compara|InParanoid)
Caenorhabditis elegans (roundworm):
ZK1240.3
Alliance
DIOPT (Ensembl Compara|InParanoid)
Caenorhabditis elegans (roundworm):
C28G1.6
Alliance
DIOPT (Ensembl Compara|InParanoid)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 30,070,270 - 30,075,769 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 30,070,266 - 30,075,849 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 30,038,047 - 30,043,546 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 30,146,022 - 30,151,607 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 6 31,636,296 - 31,641,881 (-) NCBI Celera Cytogenetic Map 6 p22.1 NCBI HuRef 6 29,836,215 - 29,841,800 (-) NCBI HuRef CHM1_1 6 30,040,092 - 30,045,677 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 29,934,544 - 29,940,043 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
RNF39 Human 1,2-dichloroethane decreases expression ISO RGD:1621175 6480464 ethylene dichloride results in decreased expression of RNF39 mRNA CTD PMID:28960355 RNF39 Human 1-naphthyl isothiocyanate decreases expression ISO RGD:628854 6480464 1-Naphthylisothiocyanate results in decreased expression of RNF39 mRNA CTD PMID:25380136 RNF39 Human 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of RNF39 mRNA CTD PMID:30165855 RNF39 Human 17beta-estradiol decreases expression ISO RGD:1621175 6480464 Estradiol results in decreased expression of RNF39 mRNA CTD PMID:39298647 RNF39 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:628854 6480464 Tetrachlorodibenzodioxin results in decreased expression of RNF39 mRNA CTD PMID:19490992|PMID:21215274 RNF39 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:628854 6480464 Tetrachlorodibenzodioxin results in increased expression of RNF39 mRNA CTD PMID:33387578 RNF39 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1621175 6480464 [Tetrachlorodibenzodioxin affects the methylation of RNF39 intron] which results in decreased expression of RNF39 mRNA CTD PMID:33017471 RNF39 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1621175 6480464 Tetrachlorodibenzodioxin results in increased expression of RNF39 mRNA CTD PMID:28922406 RNF39 Human 2,4-dinitrotoluene affects expression ISO RGD:628854 6480464 2,4-dinitrotoluene affects the expression of RNF39 mRNA CTD PMID:21346803 RNF39 Human 4,4'-diaminodiphenylmethane decreases expression ISO RGD:628854 6480464 4,4'-diaminodiphenylmethane results in decreased expression of RNF39 mRNA CTD PMID:25380136 RNF39 Human 4,4'-sulfonyldiphenol decreases expression ISO RGD:1621175 6480464 bisphenol S results in decreased expression of RNF39 mRNA CTD PMID:39298647 RNF39 Human 5-aza-2'-deoxycytidine affects expression EXP 6480464 Decitabine affects the expression of RNF39 mRNA CTD PMID:23300844 RNF39 Human 6-propyl-2-thiouracil decreases expression ISO RGD:628854 6480464 Propylthiouracil results in decreased expression of RNF39 mRNA CTD PMID:24780913 RNF39 Human acetamide decreases expression ISO RGD:628854 6480464 acetamide results in decreased expression of RNF39 mRNA CTD PMID:31881176 RNF39 Human aflatoxin B1 increases expression ISO RGD:628854 6480464 Aflatoxin B1 results in increased expression of RNF39 mRNA CTD PMID:33354967 RNF39 Human all-trans-retinoic acid decreases expression ISO RGD:628854 6480464 Tretinoin results in decreased expression of RNF39 mRNA CTD PMID:20488242 RNF39 Human ammonium chloride affects expression ISO RGD:628854 6480464 Ammonium Chloride affects the expression of RNF39 mRNA CTD PMID:16483693 RNF39 Human aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of RNF39 mRNA CTD PMID:33212167 RNF39 Human atrazine increases expression EXP 6480464 Atrazine results in increased expression of RNF39 mRNA CTD PMID:22378314 RNF39 Human benzo[a]pyrene decreases methylation EXP 6480464 Benzo(a)pyrene results in decreased methylation of RNF39 3' UTR; Benzo(a)pyrene results in decreased methylation of more ... CTD PMID:27901495 RNF39 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of RNF39 promoter CTD PMID:27901495 RNF39 Human benzo[b]fluoranthene increases expression ISO RGD:1621175 6480464 benzo(b)fluoranthene results in increased expression of RNF39 mRNA CTD PMID:26377693 RNF39 Human bisphenol A decreases expression ISO RGD:628854 6480464 bisphenol A results in decreased expression of RNF39 mRNA CTD PMID:25181051|PMID:34947998 RNF39 Human bisphenol A increases expression ISO RGD:1621175 6480464 bisphenol A results in increased expression of RNF39 mRNA CTD PMID:32156529|PMID:34585602 RNF39 Human bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of RNF39 gene CTD PMID:31601247 RNF39 Human bisphenol A multiple interactions ISO RGD:628854 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of RNF39 mRNA CTD PMID:31129395 RNF39 Human cadmium atom decreases expression EXP 6480464 Cadmium results in decreased expression of RNF39 mRNA CTD PMID:24376830 RNF39 Human cadmium atom multiple interactions ISO RGD:1621175 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RNF39 more ... CTD PMID:37325564 RNF39 Human cadmium dichloride decreases methylation ISO RGD:628854 6480464 Cadmium Chloride results in decreased methylation of RNF39 promoter CTD PMID:22457795 RNF39 Human cadmium dichloride multiple interactions ISO RGD:1621175 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RNF39 more ... CTD PMID:37325564 RNF39 Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of RNF39 mRNA CTD PMID:38568856 RNF39 Human calcitriol increases expression EXP 6480464 Calcitriol results in increased expression of RNF39 mRNA CTD PMID:16002434 RNF39 Human carbon nanotube affects expression ISO RGD:1621175 6480464 Nanotubes, Carbon affects the expression of RNF39 mRNA CTD PMID:25554681 RNF39 Human carbon nanotube decreases expression ISO RGD:1621175 6480464 Nanotubes, Carbon results in decreased expression of RNF39 mRNA CTD PMID:25620056 RNF39 Human carbon nanotube increases expression ISO RGD:1621175 6480464 Nanotubes, Carbon analog results in increased expression of RNF39 mRNA CTD PMID:25554681 RNF39 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to RNF39 gene] CTD PMID:28238834 RNF39 Human chloroprene increases expression ISO RGD:1621175 6480464 Chloroprene results in increased expression of RNF39 mRNA CTD PMID:23125180 RNF39 Human cisplatin affects expression EXP 6480464 Cisplatin affects the expression of RNF39 mRNA CTD PMID:23300844 RNF39 Human crocidolite asbestos increases expression EXP 6480464 Asbestos, Crocidolite results in increased expression of RNF39 mRNA CTD PMID:25351596 RNF39 Human Cuprizon decreases expression ISO RGD:628854 6480464 Cuprizone results in decreased expression of RNF39 mRNA CTD PMID:26577399 RNF39 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of RNF39 mRNA CTD PMID:37042841 RNF39 Human dibutyl phthalate decreases expression ISO RGD:628854 6480464 Dibutyl Phthalate results in decreased expression of RNF39 mRNA CTD PMID:32028152 RNF39 Human dicrotophos increases expression EXP 6480464 dicrotophos results in increased expression of RNF39 mRNA CTD PMID:28302478 RNF39 Human diuron decreases expression ISO RGD:628854 6480464 Diuron results in decreased expression of RNF39 mRNA CTD PMID:21551480 RNF39 Human doxorubicin increases expression ISO RGD:1621175 6480464 Doxorubicin results in increased expression of RNF39 mRNA CTD PMID:25896364 RNF39 Human endosulfan decreases expression ISO RGD:628854 6480464 Endosulfan results in decreased expression of RNF39 mRNA CTD PMID:29391264 RNF39 Human epoxiconazole decreases expression ISO RGD:1621175 6480464 epoxiconazole results in decreased expression of RNF39 mRNA CTD PMID:35436446 RNF39 Human fulvestrant multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of RNF39 gene CTD PMID:31601247 RNF39 Human furan decreases expression ISO RGD:628854 6480464 furan results in decreased expression of RNF39 mRNA CTD PMID:25539665 RNF39 Human gentamycin increases expression ISO RGD:628854 6480464 Gentamicins results in increased expression of RNF39 mRNA CTD PMID:33387578 RNF39 Human glyphosate multiple interactions EXP 6480464 [Glyphosate results in increased abundance of aminomethylphosphonic acid (AMPA)] which affects the methylation of RNF39 more ... CTD PMID:35377194 RNF39 Human inulin multiple interactions ISO RGD:1621175 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of RNF39 mRNA CTD PMID:36331819 RNF39 Human N-nitrosodiethylamine increases expression ISO RGD:1621175 6480464 Diethylnitrosamine results in increased expression of RNF39 mRNA CTD PMID:24535843 RNF39 Human N-nitrosodimethylamine decreases expression ISO RGD:628854 6480464 Dimethylnitrosamine results in decreased expression of RNF39 mRNA CTD PMID:25380136 RNF39 Human nefazodone decreases expression ISO RGD:628854 6480464 nefazodone results in decreased expression of RNF39 mRNA CTD PMID:24136188 RNF39 Human nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of RNF39 mRNA CTD PMID:24768652 RNF39 Human okadaic acid decreases expression EXP 6480464 Okadaic Acid results in decreased expression of RNF39 mRNA CTD PMID:38832940 RNF39 Human ozone multiple interactions ISO RGD:1621175 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 RNF39 Human paracetamol decreases expression ISO RGD:628854 6480464 Acetaminophen results in decreased expression of RNF39 mRNA CTD PMID:33387578 RNF39 Human perfluorohexanesulfonic acid increases expression ISO RGD:1621175 6480464 perfluorohexanesulfonic acid results in increased expression of RNF39 mRNA CTD PMID:37995155 RNF39 Human perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1621175 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of RNF39 mRNA CTD PMID:36331819 RNF39 Human phenethyl isothiocyanate increases expression ISO RGD:628854 6480464 phenethyl isothiocyanate results in increased expression of RNF39 mRNA CTD PMID:17616710 RNF39 Human phenylephrine increases expression ISO RGD:628854 6480464 Phenylephrine results in increased expression of RNF39 mRNA CTD PMID:18158353 RNF39 Human pregnenolone 16alpha-carbonitrile decreases expression ISO RGD:1621175 6480464 Pregnenolone Carbonitrile results in decreased expression of RNF39 mRNA CTD PMID:28903501 RNF39 Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of RNF39 mRNA CTD PMID:22300531|PMID:25351596 RNF39 Human sodium dodecyl sulfate increases expression EXP 6480464 Sodium Dodecyl Sulfate results in increased expression of RNF39 mRNA CTD PMID:31734321 RNF39 Human succimer multiple interactions ISO RGD:1621175 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of RNF39 mRNA CTD PMID:26378955 RNF39 Human thioacetamide increases expression ISO RGD:628854 6480464 Thioacetamide results in increased expression of RNF39 mRNA CTD PMID:34492290 RNF39 Human titanium dioxide decreases methylation ISO RGD:1621175 6480464 titanium dioxide results in decreased methylation of RNF39 gene CTD PMID:35295148 RNF39 Human tributylstannane multiple interactions ISO RGD:628854 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of RNF39 mRNA CTD PMID:31129395 RNF39 Human triphenyl phosphate increases expression ISO RGD:628854 6480464 triphenyl phosphate results in increased expression of RNF39 mRNA CTD PMID:30589522 RNF39 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of RNF39 mRNA CTD PMID:37042841 RNF39 Human triptonide increases expression ISO RGD:1621175 6480464 triptonide results in increased expression of RNF39 mRNA CTD PMID:33045310 RNF39 Human trovafloxacin increases expression ISO RGD:628854 6480464 trovafloxacin results in increased expression of RNF39 mRNA CTD PMID:24136188
1,2-dichloroethane (ISO) 1-naphthyl isothiocyanate (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (EXP) 6-propyl-2-thiouracil (ISO) acetamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (ISO) aristolochic acid A (EXP) atrazine (EXP) benzo[a]pyrene (EXP) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) cadmium atom (EXP,ISO) cadmium dichloride (EXP,ISO) calcitriol (EXP) carbon nanotube (ISO) CGP 52608 (EXP) chloroprene (ISO) cisplatin (EXP) crocidolite asbestos (EXP) Cuprizon (ISO) Dibutyl phosphate (EXP) dibutyl phthalate (ISO) dicrotophos (EXP) diuron (ISO) doxorubicin (ISO) endosulfan (ISO) epoxiconazole (ISO) fulvestrant (EXP) furan (ISO) gentamycin (ISO) glyphosate (EXP) inulin (ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (ISO) nefazodone (ISO) nickel atom (EXP) okadaic acid (EXP) ozone (ISO) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenethyl isothiocyanate (ISO) phenylephrine (ISO) pregnenolone 16alpha-carbonitrile (ISO) silicon dioxide (EXP) sodium dodecyl sulfate (EXP) succimer (ISO) thioacetamide (ISO) titanium dioxide (ISO) tributylstannane (ISO) triphenyl phosphate (EXP,ISO) triptonide (ISO) trovafloxacin (ISO)
RNF39 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 30,070,270 - 30,075,769 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 30,070,266 - 30,075,849 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 30,038,047 - 30,043,546 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 30,146,022 - 30,151,607 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 6 31,636,296 - 31,641,881 (-) NCBI Celera Cytogenetic Map 6 p22.1 NCBI HuRef 6 29,836,215 - 29,841,800 (-) NCBI HuRef CHM1_1 6 30,040,092 - 30,045,677 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 29,934,544 - 29,940,043 (-) NCBI T2T-CHM13v2.0
Rnf39 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 37,253,943 - 37,258,878 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 37,253,810 - 37,258,878 (+) Ensembl GRCm39 Ensembl GRCm38 17 36,943,051 - 36,947,986 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 36,942,918 - 36,947,986 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 37,079,996 - 37,084,931 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 Celera 17 40,366,596 - 40,371,525 (+) NCBI Celera Cytogenetic Map 17 B1 NCBI cM Map 17 19.16 NCBI
Rnf39 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 1,610,027 - 1,615,516 (-) NCBI GRCr8 mRatBN7.2 20 1,604,794 - 1,610,283 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 1,604,794 - 1,610,283 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 1,657,567 - 1,663,054 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 1,661,064 - 1,666,549 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 1,602,535 - 1,608,038 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 2,098,375 - 2,103,864 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 2,098,375 - 2,103,864 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 4,135,089 - 4,140,578 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 1,697,530 - 1,703,019 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 1,697,529 - 1,703,019 (-) NCBI Celera 20 2,313,358 - 2,318,849 (-) NCBI Celera Cytogenetic Map 20 p12 NCBI
Rnf39 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955583 201,638 - 206,754 (-) NCBI ChiLan1.0 ChiLan1.0
RNF39 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 44,663,536 - 44,669,354 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 40,626,537 - 40,632,281 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 29,848,055 - 29,853,659 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 30,518,327 - 30,523,597 (-) NCBI panpan1.1 PanPan1.1 panPan2
RNF39 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 35 26,292,218 - 26,296,980 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 35 26,292,781 - 26,297,083 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 ROS_Cfam_1.0 35 26,600,790 - 26,605,478 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 35 26,601,338 - 26,605,630 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 35 26,255,356 - 26,260,068 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 35 26,316,600 - 26,320,753 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 35 27,786,250 - 27,790,957 (-) NCBI UU_Cfam_GSD_1.0
Rnf39
RNF39 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 22,636,904 - 22,642,612 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 22,637,732 - 22,642,427 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 24,985,817 - 24,990,520 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RNF39 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 42,423,486 - 42,429,631 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 42,424,126 - 42,428,787 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 29,725,245 - 29,731,196 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rnf39
.
Predicted Target Of
Count of predictions: 1251 Count of miRNA genes: 329 Interacting mature miRNAs: 348 Transcripts: ENST00000244360, ENST00000376751 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1358839 MULTSCL5_H Multiple sclerosis susceptibility QTL 5 (human) Multiple sclerosis susceptibility 6 19584311 45584311 Human 597078225 GWAS1174299_H non-obstructive coronary artery disease QTL GWAS1174299 (human) 0.0000007 non-obstructive coronary artery disease 6 30071463 30071464 Human 1643377 BW325_H Body weight QTL 325 (human) 2.32 0.0005 Body fat amount 6 6911960 32911960 Human 1643569 GLUCO21_H Glucose level QTL 21 (human) 0.021 Glucose level non-insulin-dependent 6 6911960 32911960 Human 597066878 GWAS1162952_H susceptibility to chickenpox measurement QTL GWAS1162952 (human) 1e-10 response to viral infection trait (VT:0010439) 6 30072514 30072515 Human 1298458 BW9_H Body weight QTL 9 (human) 2.7 0.0002 Body fat amount 6 6911960 32911960 Human 597179409 GWAS1275483_H hemoglobin measurement QTL GWAS1275483 (human) 8e-17 hemoglobin measurement hemoglobin measurement (CMO:0000508) 6 30070870 30070871 Human 1298431 RA11_H Rheumatoid arthritis QTL 11 (human) 0.0000024 Joint/bone inflammation rheumatoid arthritis 6 19911883 40191709 Human 597195636 GWAS1291710_H intelligence QTL GWAS1291710 (human) 3e-09 intelligence 6 30070870 30070871 Human 597048987 GWAS1145061_H cervical carcinoma QTL GWAS1145061 (human) 7e-09 cervical carcinoma 6 30075223 30075224 Human 597251304 GWAS1347378_H staphylococcus seropositivity QTL GWAS1347378 (human) 2e-09 staphylococcus seropositivity 6 30070870 30070871 Human 1358854 MULTSCL4_H Multiple sclerosis susceptibility QTL 4 (human) Multiple sclerosis susceptibility 6 6911960 32911960 Human 597049100 GWAS1145174_H cervical carcinoma QTL GWAS1145174 (human) 6e-08 cervical carcinoma 6 30075223 30075224 Human 596969550 GWAS1089069_H intelligence QTL GWAS1089069 (human) 3e-09 intelligence 6 30070870 30070871 Human 1358857 MULTSCL19_H Multiple sclerosis susceptibility QTL 19 (human) Multiple sclerosis susceptibility 6 19584311 45584311 Human 1643399 BMD5_H Bone mineral density QTL 5 (human) 2.32 0.0005 Bone mineral density 6 6911960 32911960 Human
G31541
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 30,038,717 - 30,038,828 UniSTS GRCh37 Build 36 6 30,146,696 - 30,146,807 RGD NCBI36 Celera 6 31,636,970 - 31,637,081 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 29,836,889 - 29,837,000 UniSTS
RH99256
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 30,041,144 - 30,041,302 UniSTS GRCh37 Build 36 6 30,149,123 - 30,149,281 RGD NCBI36 Celera 6 31,639,397 - 31,639,555 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 29,839,316 - 29,839,474 UniSTS GeneMap99-GB4 RH Map 6 117.14 UniSTS
RNF39_1552.2
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 30,038,029 - 30,038,779 UniSTS GRCh37 Build 36 6 30,146,008 - 30,146,758 RGD NCBI36 Celera 6 31,636,282 - 31,637,032 RGD HuRef 6 29,836,201 - 29,836,951 UniSTS
G29206
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 30,037,875 - 30,038,014 UniSTS GRCh37 Build 36 6 30,145,854 - 30,145,993 RGD NCBI36 Celera 6 31,636,128 - 31,636,267 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 29,836,047 - 29,836,186 UniSTS
STS-R63837
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 30,041,559 - 30,041,681 UniSTS GRCh37 Build 36 6 30,149,538 - 30,149,660 RGD NCBI36 Celera 6 31,639,812 - 31,639,934 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 29,839,731 - 29,839,853 UniSTS GeneMap99-GB4 RH Map 6 117.03 UniSTS NCBI RH Map 6 396.6 UniSTS
STS-W44579
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 30,037,733 - 30,037,892 UniSTS GRCh37 Build 36 6 30,145,712 - 30,145,871 RGD NCBI36 Celera 6 31,635,986 - 31,636,145 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 29,835,905 - 29,836,064 UniSTS GeneMap99-GB4 RH Map 6 117.03 UniSTS NCBI RH Map 6 396.6 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2428
2787
2233
4935
1710
2318
4
613
1890
455
2263
7189
6382
42
3704
840
1729
1594
170
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000244360 ⟹ ENSP00000244360
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 30,070,270 - 30,075,769 (-) Ensembl
Ensembl Acc Id:
ENST00000376751 ⟹ ENSP00000365942
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 30,070,266 - 30,075,849 (-) Ensembl
RefSeq Acc Id:
NM_025236 ⟹ NP_079512
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 30,070,270 - 30,075,769 (-) NCBI GRCh37 6 30,038,043 - 30,043,628 (-) RGD Build 36 6 30,146,022 - 30,151,607 (-) NCBI Archive Celera 6 31,636,296 - 31,641,881 (-) RGD HuRef 6 29,836,215 - 29,841,800 (-) RGD CHM1_1 6 30,040,092 - 30,045,677 (-) NCBI T2T-CHM13v2.0 6 29,934,544 - 29,940,043 (-) NCBI
Sequence:
GAGACTGAGACTCTGGTTGAAGAGAGAGGCAATCCCAGGAGAGGGGCGGAAAGCGGCAAAAGTTAATGCGGGAGTCGGAGAGAAGGGCATCTACACAGCAAGCAGCAGGGGCGGCCCGCCATCTGCGC
hide sequence
RefSeq Acc Id:
NM_170769 ⟹ NP_739575
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 30,070,270 - 30,075,769 (-) NCBI GRCh37 6 30,038,043 - 30,043,628 (-) RGD Build 36 6 30,146,022 - 30,151,607 (-) NCBI Archive Celera 6 31,636,296 - 31,641,881 (-) RGD HuRef 6 29,836,215 - 29,841,800 (-) RGD CHM1_1 6 30,040,092 - 30,045,675 (-) NCBI T2T-CHM13v2.0 6 29,934,544 - 29,940,043 (-) NCBI
Sequence:
GAGACTGAGACTCTGGTTGAAGAGAGAGGCAATCCCAGGAGAGGGGCGGAAAGCGGCAAAAGTT
hide sequence
RefSeq Acc Id:
XM_017011325 ⟹ XP_016866814
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 30,070,270 - 30,075,769 (-) NCBI
Sequence:
CTCCGCCGGCGACCGGCACCGAGGCTTCCCCCACCGCCTGTCCCTGCTGCGGCCTGCCGTGTCC
hide sequence
RefSeq Acc Id:
XM_054356472 ⟹ XP_054212447
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 6 29,934,544 - 29,940,043 (-) NCBI
RefSeq Acc Id:
NP_079512 ⟸ NM_025236
- Peptide Label:
isoform 1
- UniProtKB:
Q9H2S5 (UniProtKB/Swiss-Prot), Q9H2S4 (UniProtKB/Swiss-Prot), Q9H2S3 (UniProtKB/Swiss-Prot), Q5SS29 (UniProtKB/Swiss-Prot), Q5SRK1 (UniProtKB/Swiss-Prot), Q5SRJ9 (UniProtKB/Swiss-Prot), Q5SPN0 (UniProtKB/Swiss-Prot), Q5SPM9 (UniProtKB/Swiss-Prot), Q5SPM8 (UniProtKB/Swiss-Prot), B0S858 (UniProtKB/Swiss-Prot), A6NCD6 (UniProtKB/Swiss-Prot), A2BEK3 (UniProtKB/Swiss-Prot), Q96QB5 (UniProtKB/TrEMBL)
- Sequence:
MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMDAPELGPGLVERLEQLATCPLCGGSFEDPVLLACEHSFCRACLARRWGTPPATGTEASP
hide sequence
RefSeq Acc Id:
NP_739575 ⟸ NM_170769
- Peptide Label:
isoform 2
- UniProtKB:
A0A1U9X8G2 (UniProtKB/TrEMBL)
- Sequence:
MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASR
hide sequence
RefSeq Acc Id:
XP_016866814 ⟸ XM_017011325
- Peptide Label:
isoform X1
- Sequence:
MCGWRWRCESAASCERSWLSLGPVRGDAEGGASPPWAAWTCPERFEVPTSKSSNSEDDLPEDYP
hide sequence
Ensembl Acc Id:
ENSP00000244360 ⟸ ENST00000244360
Ensembl Acc Id:
ENSP00000365942 ⟸ ENST00000376751
RefSeq Acc Id:
XP_054212447 ⟸ XM_054356472
- Peptide Label:
isoform X1
RGD ID: 6872352 Promoter ID: EPDNEW_H9341 Type: initiation region Name: RNF39_1 Description: ring finger protein 39 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 6 30,075,769 - 30,075,829 EPDNEW
RGD ID: 6813068 Promoter ID: HG_ACW:67893 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, Lymphoblastoid Transcripts: RNF39.CAPR07-UNSPLICED, SPAKLUBU.AAPR07-UNSPLICED, SPYKLUBU.AAPR07-UNSPLICED Position: Human Assembly Chr Position (strand) Source Build 36 6 30,146,904 - 30,147,404 (-) MPROMDB
RGD ID: 6804622 Promoter ID: HG_KWN:52795 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: HeLa_S3 Transcripts: ENST00000376746, OTTHUMT00000076625, OTTHUMT00000076626 Position: Human Assembly Chr Position (strand) Source Build 36 6 30,151,496 - 30,151,996 (-) MPROMDB
