Symbol:
Mrpl20
Name:
mitochondrial ribosomal protein L20
RGD ID:
1588219
Description:
Predicted to enable rRNA binding activity. Predicted to be a structural constituent of ribosome. Predicted to be involved in translation. Predicted to be located in mitochondrial ribosome. Predicted to be part of mitochondrial large ribosomal subunit. Orthologous to human MRPL20 (mitochondrial ribosomal protein L20); INTERACTS WITH acetamide; aconitine; benzo[a]pyrene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
39S ribosomal protein L20, mitochondrial; large ribosomal subunit protein bL20m; LOC680747; similar to mitochondrial ribosomal protein L20
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MRPL20 (mitochondrial ribosomal protein L20)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mrpl20 (mitochondrial ribosomal protein L20)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mrpl20 (mitochondrial ribosomal protein L20)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MRPL20 (mitochondrial ribosomal protein L20)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MRPL20 (mitochondrial ribosomal protein L20)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mrpl20 (mitochondrial ribosomal protein L20)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MRPL20 (mitochondrial ribosomal protein L20)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MRPL20 (mitochondrial ribosomal protein L20)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mrpl20 (mitochondrial ribosomal protein L20)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
MRPL20 (mitochondrial ribosomal protein L20)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Mrpl20 (mitochondrial ribosomal protein L20)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mrpl20 (mitochondrial ribosomal protein L20)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
mrpl-20
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
mRpL20
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mrpl20
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 171,690,664 - 171,695,728 (+) NCBI GRCr8 mRatBN7.2 5 166,408,962 - 166,413,492 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 166,408,962 - 166,413,492 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 169,113,837 - 169,118,373 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 170,935,256 - 170,939,792 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 170,897,787 - 170,902,323 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 173,248,245 - 173,252,775 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 173,248,245 - 173,252,775 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 176,723,859 - 176,728,389 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 172,657,923 - 172,662,453 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 164,609,698 - 164,614,228 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mrpl20 Rat (+)-catechin multiple interactions ISO MRPL20 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of MRPL20 mRNA CTD PMID:24763279 Mrpl20 Rat (-)-alpha-phellandrene decreases expression ISO MRPL20 (Homo sapiens) 6480464 alpha phellandrene results in decreased expression of MRPL20 mRNA CTD PMID:25075043 Mrpl20 Rat (S)-nicotine multiple interactions ISO Mrpl20 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Mrpl20 Rat 1,2-dimethylhydrazine multiple interactions ISO Mrpl20 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MRPL20 mRNA CTD PMID:22206623 Mrpl20 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Mrpl20 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Mrpl20 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Mrpl20 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Mrpl20 Rat 17alpha-ethynylestradiol increases expression ISO Mrpl20 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of MRPL20 mRNA CTD PMID:17942748 Mrpl20 Rat 17alpha-ethynylestradiol multiple interactions ISO Mrpl20 (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of MRPL20 mRNA CTD PMID:37844793 Mrpl20 Rat 17beta-estradiol affects expression ISO Mrpl20 (Mus musculus) 6480464 Estradiol affects the expression of MRPL20 mRNA CTD PMID:15598610 Mrpl20 Rat 17beta-estradiol increases expression ISO Mrpl20 (Mus musculus) 6480464 Estradiol results in increased expression of MRPL20 mRNA CTD PMID:39298647 Mrpl20 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mrpl20 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MRPL20 mRNA CTD PMID:21570461 Mrpl20 Rat 4,4'-sulfonyldiphenol increases expression ISO Mrpl20 (Mus musculus) 6480464 bisphenol S results in increased expression of MRPL20 mRNA CTD PMID:39298647 Mrpl20 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of MRPL20 mRNA CTD PMID:31881176 Mrpl20 Rat aconitine increases expression EXP 6480464 Aconitine results in increased expression of MRPL20 protein CTD PMID:33236894 Mrpl20 Rat alpha-phellandrene decreases expression ISO MRPL20 (Homo sapiens) 6480464 alpha phellandrene results in decreased expression of MRPL20 mRNA CTD PMID:25075043 Mrpl20 Rat aluminium atom decreases expression ISO Mrpl20 (Mus musculus) 6480464 Aluminum results in decreased expression of MRPL20 mRNA CTD PMID:37544489 Mrpl20 Rat aluminium(0) decreases expression ISO Mrpl20 (Mus musculus) 6480464 Aluminum results in decreased expression of MRPL20 mRNA CTD PMID:37544489 Mrpl20 Rat arsenite(3-) multiple interactions ISO MRPL20 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to MRPL20 mRNA] CTD PMID:32406909 Mrpl20 Rat aspartame multiple interactions ISO Mrpl20 (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Mrpl20 Rat atrazine decreases expression ISO MRPL20 (Homo sapiens) 6480464 Atrazine results in decreased expression of MRPL20 mRNA CTD PMID:22378314 Mrpl20 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of MRPL20 mRNA CTD PMID:21839799 Mrpl20 Rat benzo[a]pyrene decreases methylation ISO MRPL20 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of MRPL20 promoter CTD PMID:27901495 Mrpl20 Rat benzo[a]pyrene increases expression ISO Mrpl20 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MRPL20 mRNA CTD PMID:22228805 Mrpl20 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MRPL20 mRNA and bisphenol A results in increased expression of MRPL20 protein CTD PMID:25181051 more ... Mrpl20 Rat bisphenol A increases expression ISO Mrpl20 (Mus musculus) 6480464 bisphenol A results in increased expression of MRPL20 mRNA CTD PMID:32156529 Mrpl20 Rat bisphenol A decreases expression ISO Mrpl20 (Mus musculus) 6480464 bisphenol A results in decreased expression of MRPL20 mRNA CTD PMID:35598803 Mrpl20 Rat bisphenol A decreases expression ISO MRPL20 (Homo sapiens) 6480464 bisphenol A results in decreased expression of MRPL20 mRNA CTD PMID:29275510 Mrpl20 Rat cadmium atom multiple interactions ISO MRPL20 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MRPL20 mRNA CTD PMID:35301059 Mrpl20 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of MRPL20 mRNA CTD PMID:33453195 Mrpl20 Rat cadmium dichloride multiple interactions ISO MRPL20 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MRPL20 mRNA CTD PMID:35301059 Mrpl20 Rat caffeine multiple interactions ISO Mrpl20 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Mrpl20 Rat carbon nanotube increases expression ISO Mrpl20 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of MRPL20 mRNA CTD PMID:25554681 Mrpl20 Rat chromium(6+) affects expression ISO Mrpl20 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of MRPL20 mRNA CTD PMID:28472532 Mrpl20 Rat cobalt dichloride decreases expression ISO MRPL20 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of MRPL20 mRNA CTD PMID:19376846 Mrpl20 Rat copper(II) sulfate decreases expression ISO MRPL20 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of MRPL20 mRNA CTD PMID:19549813 Mrpl20 Rat corosolic acid decreases expression ISO MRPL20 (Homo sapiens) 6480464 corosolic acid results in decreased expression of MRPL20 mRNA CTD PMID:37939859 Mrpl20 Rat dextran sulfate increases expression ISO Mrpl20 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of MRPL20 mRNA CTD PMID:35093514 Mrpl20 Rat diazinon increases methylation ISO MRPL20 (Homo sapiens) 6480464 Diazinon results in increased methylation of MRPL20 gene CTD PMID:22964155 Mrpl20 Rat Dibutyl phosphate affects expression ISO MRPL20 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MRPL20 mRNA CTD PMID:37042841 Mrpl20 Rat diclofenac multiple interactions ISO Mrpl20 (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of MRPL20 mRNA CTD PMID:37844793 Mrpl20 Rat disodium selenite increases expression ISO MRPL20 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of MRPL20 mRNA CTD PMID:18175754 Mrpl20 Rat ethanol increases expression ISO Mrpl20 (Mus musculus) 6480464 Ethanol results in increased expression of MRPL20 mRNA CTD PMID:30319688 Mrpl20 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of MRPL20 mRNA CTD PMID:24136188 Mrpl20 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of MRPL20 mRNA CTD PMID:24136188 Mrpl20 Rat folic acid multiple interactions ISO Mrpl20 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MRPL20 mRNA CTD PMID:22206623 Mrpl20 Rat genistein multiple interactions ISO MRPL20 (Homo sapiens) 6480464 ESR1 promotes the reaction [Genistein results in increased expression of MRPL20 protein] CTD PMID:20884965 Mrpl20 Rat genistein increases expression ISO MRPL20 (Homo sapiens) 6480464 Genistein results in increased expression of MRPL20 protein CTD PMID:20884965 Mrpl20 Rat hydrogen peroxide affects expression ISO MRPL20 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of MRPL20 mRNA CTD PMID:21179406 Mrpl20 Rat ibuprofen multiple interactions ISO Mrpl20 (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of MRPL20 mRNA CTD PMID:37844793 Mrpl20 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of MRPL20 mRNA CTD PMID:24136188 Mrpl20 Rat lipopolysaccharide multiple interactions ISO MRPL20 (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of MRPL20 mRNA CTD PMID:31059760 Mrpl20 Rat monosodium L-glutamate multiple interactions ISO Mrpl20 (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Mrpl20 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of MRPL20 mRNA CTD PMID:24136188 Mrpl20 Rat nickel atom increases expression ISO MRPL20 (Homo sapiens) 6480464 Nickel results in increased expression of MRPL20 mRNA CTD PMID:25583101 Mrpl20 Rat nicotine multiple interactions ISO Mrpl20 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Mrpl20 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of MRPL20 mRNA CTD PMID:24136188 Mrpl20 Rat paracetamol affects expression ISO Mrpl20 (Mus musculus) 6480464 Acetaminophen affects the expression of MRPL20 mRNA CTD PMID:17562736 Mrpl20 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of MRPL20 mRNA CTD PMID:33387578 Mrpl20 Rat paracetamol decreases expression ISO MRPL20 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MRPL20 mRNA CTD PMID:31059760 Mrpl20 Rat paracetamol multiple interactions ISO MRPL20 (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of MRPL20 mRNA CTD PMID:31059760 Mrpl20 Rat pirinixic acid increases expression ISO Mrpl20 (Mus musculus) 6480464 pirinixic acid results in increased expression of MRPL20 mRNA CTD PMID:23811191 Mrpl20 Rat quercetin decreases expression ISO MRPL20 (Homo sapiens) 6480464 Quercetin results in decreased expression of MRPL20 mRNA CTD PMID:21632981 Mrpl20 Rat resveratrol increases expression ISO Mrpl20 (Mus musculus) 6480464 resveratrol results in increased expression of MRPL20 mRNA CTD PMID:22610192 Mrpl20 Rat resveratrol multiple interactions ISO MRPL20 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of MRPL20 mRNA CTD PMID:23557933 Mrpl20 Rat silicon dioxide decreases expression ISO MRPL20 (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of MRPL20 mRNA CTD PMID:25351596 Mrpl20 Rat sodium arsenite decreases expression ISO MRPL20 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MRPL20 mRNA CTD PMID:38568856 Mrpl20 Rat sodium arsenite increases expression ISO MRPL20 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MRPL20 mRNA CTD PMID:34032870 Mrpl20 Rat sulindac decreases expression EXP 6480464 Sulindac results in decreased expression of MRPL20 mRNA CTD PMID:24136188 Mrpl20 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of MRPL20 mRNA CTD PMID:34492290 Mrpl20 Rat thiram decreases expression ISO MRPL20 (Homo sapiens) 6480464 Thiram results in decreased expression of MRPL20 mRNA CTD PMID:38568856 Mrpl20 Rat tolcapone decreases expression EXP 6480464 tolcapone results in decreased expression of MRPL20 mRNA CTD PMID:24136188 Mrpl20 Rat trimellitic anhydride increases expression ISO Mrpl20 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of MRPL20 mRNA CTD PMID:19042947 Mrpl20 Rat tungsten increases expression ISO Mrpl20 (Mus musculus) 6480464 Tungsten results in increased expression of MRPL20 mRNA CTD PMID:30912803 Mrpl20 Rat tunicamycin decreases expression ISO MRPL20 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of MRPL20 mRNA CTD PMID:22378314 Mrpl20 Rat urethane decreases expression ISO MRPL20 (Homo sapiens) 6480464 Urethane results in decreased expression of MRPL20 mRNA CTD PMID:28818685 Mrpl20 Rat valproic acid increases methylation ISO MRPL20 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MRPL20 gene CTD PMID:29154799 Mrpl20 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of MRPL20 mRNA CTD PMID:23034163
(+)-catechin (ISO) (-)-alpha-phellandrene (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) aconitine (EXP) alpha-phellandrene (ISO) aluminium atom (ISO) aluminium(0) (ISO) arsenite(3-) (ISO) aspartame (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) carbon nanotube (ISO) chromium(6+) (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) corosolic acid (ISO) dextran sulfate (ISO) diazinon (ISO) Dibutyl phosphate (ISO) diclofenac (ISO) disodium selenite (ISO) ethanol (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) genistein (ISO) hydrogen peroxide (ISO) ibuprofen (ISO) leflunomide (EXP) lipopolysaccharide (ISO) monosodium L-glutamate (ISO) nefazodone (EXP) nickel atom (ISO) nicotine (ISO) nimesulide (EXP) paracetamol (EXP,ISO) pirinixic acid (ISO) quercetin (ISO) resveratrol (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulindac (EXP) thioacetamide (EXP) thiram (ISO) tolcapone (EXP) trimellitic anhydride (ISO) tungsten (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
Mrpl20 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 171,690,664 - 171,695,728 (+) NCBI GRCr8 mRatBN7.2 5 166,408,962 - 166,413,492 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 166,408,962 - 166,413,492 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 169,113,837 - 169,118,373 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 170,935,256 - 170,939,792 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 170,897,787 - 170,902,323 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 173,248,245 - 173,252,775 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 173,248,245 - 173,252,775 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 176,723,859 - 176,728,389 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 172,657,923 - 172,662,453 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 164,609,698 - 164,614,228 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
MRPL20 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 1,401,909 - 1,407,293 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 1,401,909 - 1,407,293 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 1,337,289 - 1,342,673 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 1,327,159 - 1,332,524 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 1,238,564 - 1,243,981 (+) NCBI Celera Cytogenetic Map 1 p36.33 NCBI HuRef 1 609,481 - 614,898 (-) NCBI HuRef CHM1_1 1 1,324,690 - 1,330,107 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 833,839 - 839,223 (-) NCBI T2T-CHM13v2.0
Mrpl20 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 155,887,335 - 155,893,288 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 155,887,335 - 155,894,432 (+) Ensembl GRCm39 Ensembl GRCm38 4 155,802,878 - 155,808,831 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 155,802,878 - 155,809,975 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 155,177,727 - 155,182,938 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 154,647,418 - 154,652,629 (+) NCBI MGSCv36 mm8 Celera 4 158,074,686 - 158,080,132 (+) NCBI Celera Cytogenetic Map 4 E2 NCBI cM Map 4 87.44 NCBI
Mrpl20 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955486 9,417,925 - 9,420,789 (+) NCBI ChiLan1.0 ChiLan1.0
MRPL20 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 226,817,684 - 226,823,585 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 225,515,726 - 225,521,152 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 157,984 - 163,411 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 1,358,009 - 1,363,012 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 1,358,009 - 1,363,014 (-) Ensembl panpan1.1 panPan2
MRPL20 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 56,553,326 - 56,558,182 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 56,553,331 - 56,558,136 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 56,629,506 - 56,634,365 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 56,755,633 - 56,760,741 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 56,755,638 - 56,760,692 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 56,746,132 - 56,750,989 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 56,638,398 - 56,643,257 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 57,028,682 - 57,033,572 (-) NCBI UU_Cfam_GSD_1.0
Mrpl20 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
MRPL20 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 63,670,755 - 63,675,839 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 63,670,750 - 63,675,834 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 58,274,566 - 58,279,667 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MRPL20 (Chlorocebus sabaeus - green monkey)
Mrpl20 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 98 Count of miRNA genes: 86 Interacting mature miRNAs: 91 Transcripts: ENSRNOT00000025213 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1549904 Neuinf1 Neuroinflammation QTL 1 3 0 nervous system integrity trait (VT:0010566) blood T lymphocyte count (CMO:0000110) 5 154828214 166875058 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat
RH133343
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 4 419.82 UniSTS Cytogenetic Map 5 q36 UniSTS
RH135074
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 166,408,786 - 166,408,980 (+) MAPPER mRatBN7.2 Rnor_6.0 5 173,248,070 - 173,248,263 NCBI Rnor6.0 Rnor_5.0 5 176,723,684 - 176,723,877 UniSTS Rnor5.0 RGSC_v3.4 5 172,657,748 - 172,657,941 UniSTS RGSC3.4 Celera 5 164,609,523 - 164,609,716 UniSTS RH 3.4 Map 5 1174.7 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025213 ⟹ ENSRNOP00000025213
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 166,408,962 - 166,413,492 (+) Ensembl Rnor_6.0 Ensembl 5 173,248,245 - 173,252,775 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000116054 ⟹ ENSRNOP00000085470
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 166,409,090 - 166,413,492 (+) Ensembl
RefSeq Acc Id:
NM_001109428 ⟹ NP_001102898
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 171,691,198 - 171,695,728 (+) NCBI mRatBN7.2 5 166,408,962 - 166,413,492 (+) NCBI Rnor_6.0 5 173,248,245 - 173,252,775 (+) NCBI Rnor_5.0 5 176,723,859 - 176,728,389 (+) NCBI RGSC_v3.4 5 172,657,923 - 172,662,453 (+) RGD Celera 5 164,609,698 - 164,614,228 (+) RGD
Sequence:
ACTGAACTCAGGGACGAGTCTAGAGGCGACCCGGAAGACAGTGCTTGCACACATCCGTCAGGGCAGGACTTTCTGACCGTTGACCCGGAAGCGCTTATGGTAGCCCCTCGGGATTCCGGGGTCCCATC ATGGTCTTCCTTACGACGCGGCTCTGGCTACGGAACCGCCTCACAGACCGCTATTGGCGGGTTCAGGAGGTGCTGAAACATGCTGGGCATTTTAGGGGAAGGAAGAATCGCTGCTACCGGCTGGCCGT CAGGGCGGTGACCAGAGCCTTCGTTAAGTGTACGAACTCCCGCAGACTTAAGAAGCGGAACCTGAGGACCCTCTGGATTAATCGAATTACAGCTGCCTCCCAGGAACATGGCTTACAGTACCCAGCAT TTATTCTCAACTTAGTTAAGTGCCAGGTGGAGCTCAACAGGAAAGTACTTGTGGACCTGGCCATCTATGAACCAAAGACGTTTAAATCTTTGGCTGCTTTGGCTAAGAGGAGGCAGCAGGAAGGATTT GCTGCAGCTTTGGGGGATGGAAAGGAGCCTGAAGGTATCTTTTCCAGAGTGGTACAATACCACTGAAGGCTGCAGTGCTATAGAAACTGTTAAAAACAAGATAGGACCAAAAGGATTGTCACCAGTAA GTCTGATTTGTATTTATTTACATTTTAGCAACAGGCCTGAGACAACAGGTGTTTACTCAGTGACACAGCCCCAAACTGTCCTGTAAAGAATGTACAAATAAAGTTTTTGCAGTGTTGAA
hide sequence
RefSeq Acc Id:
XM_063288394 ⟹ XP_063144464
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 171,690,664 - 171,695,728 (+) NCBI
RefSeq Acc Id:
NP_001102898 ⟸ NM_001109428
- UniProtKB:
B2GV62 (UniProtKB/TrEMBL), A6IUS6 (UniProtKB/TrEMBL), F7ELM1 (UniProtKB/TrEMBL)
- Sequence:
MVFLTTRLWLRNRLTDRYWRVQEVLKHAGHFRGRKNRCYRLAVRAVTRAFVKCTNSRRLKKRNLRTLWINRITAASQEHGLQYPAFILNLVKCQVELNRKVLVDLAIYEPKTFKSLAALAKRRQQEGF AAALGDGKEPEGIFSRVVQYH
hide sequence
Ensembl Acc Id:
ENSRNOP00000025213 ⟸ ENSRNOT00000025213
Ensembl Acc Id:
ENSRNOP00000085470 ⟸ ENSRNOT00000116054
RefSeq Acc Id:
XP_063144464 ⟸ XM_063288394
- Peptide Label:
isoform X1
- UniProtKB:
A6IUS6 (UniProtKB/TrEMBL), B2GV62 (UniProtKB/TrEMBL), F7ELM1 (UniProtKB/TrEMBL)
RGD ID: 13694330
Promoter ID: EPDNEW_R4855
Type: initiation region
Name: Mrpl20_1
Description: mitochondrial ribosomal protein L20
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 173,248,341 - 173,248,401 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-05
Mrpl20
mitochondrial ribosomal protein L20
LOC680747
similar to mitochondrial ribosomal protein L20
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-01-09
LOC680747
similar to mitochondrial ribosomal protein L20
LOC687253
similar to mitochondrial ribosomal protein L20
Data merged from RGD:1587725
1643240
APPROVED
2006-11-19
LOC680747
similar to mitochondrial ribosomal protein L20
Symbol and Name status set to provisional
70820
PROVISIONAL
2006-11-19
LOC687253
similar to mitochondrial ribosomal protein L20
Symbol and Name status set to provisional
70820
PROVISIONAL