Advanced Search (OLGA)

Gene: Ppp1r42 (protein phosphatase 1, regulatory subunit 42) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ppp1r42

Name:

protein phosphatase 1, regulatory subunit 42

RGD ID:

1585679

Description:

Predicted to enable actin binding activity; dynein complex binding activity; and tubulin binding activity. Predicted to be involved in regulation of phosphatase activity. Predicted to be located in centrosome and manchette. Orthologous to human PPP1R42 (protein phosphatase 1 regulatory subunit 42); INTERACTS WITH bisphenol A; flutamide; furan.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hypothetical protein LOC683514; LOC683514; uncharacterized protein LOC683514

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	14,009,972 - 14,057,330 (+)	NCBI		GRCr8
mRatBN7.2	5	9,227,109 - 9,274,461 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	9,227,204 - 9,274,453 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	11,379,422 - 11,430,891 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	13,006,578 - 13,060,838 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	12,714,074 - 12,765,558 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	8,911,356 - 8,956,313 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	8,916,633 - 8,956,119 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	13,718,715 - 13,763,672 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	8,773,373 - 8,818,333 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	8,740,514 - 8,787,374 (+)	NCBI		Celera
Cytogenetic Map	5	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp1r42	Rat	Joubert syndrome 21		ISO	PPP1R42 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Joubert syndrome 21	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp1r42	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Ppp1r42 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PPP1R42 mRNA	CTD	PMID:36331819
Ppp1r42	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Ppp1r42 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of PPP1R42 mRNA	CTD	PMID:19770486
Ppp1r42	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Ppp1r42 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of PPP1R42 mRNA	CTD	PMID:21570461
Ppp1r42	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	PPP1R42 (Homo sapiens)	6480464	bisphenol S results in decreased methylation of PPP1R42 gene	CTD	PMID:31601247
Ppp1r42	Rat	aflatoxin B1	decreases expression	ISO	Ppp1r42 (Mus musculus)	6480464	Aflatoxin B1 results in decreased expression of PPP1R42 mRNA	CTD	PMID:19770486
Ppp1r42	Rat	arsenite(3-)	increases methylation	ISO	PPP1R42 (Homo sapiens)	6480464	arsenite results in increased methylation of PPP1R42 promoter	CTD	PMID:23974009
Ppp1r42	Rat	atrazine	increases expression	ISO	PPP1R42 (Homo sapiens)	6480464	Atrazine results in increased expression of PPP1R42 mRNA	CTD	PMID:22378314
Ppp1r42	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of PPP1R42 mRNA	CTD	PMID:25181051 more ...
Ppp1r42	Rat	cisplatin	increases response to substance	ISO	PPP1R42 (Homo sapiens)	6480464	PPP1R42 results in increased susceptibility to Cisplatin	CTD	PMID:21755009
Ppp1r42	Rat	cyproconazole	increases expression	ISO	Ppp1r42 (Mus musculus)	6480464	cyproconazole results in increased expression of PPP1R42 mRNA	CTD	PMID:22334560
Ppp1r42	Rat	epoxiconazole	increases expression	ISO	Ppp1r42 (Mus musculus)	6480464	epoxiconazole results in increased expression of PPP1R42 mRNA	CTD	PMID:22334560 and PMID:23970803
Ppp1r42	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of PPP1R42 mRNA	CTD	PMID:24793618
Ppp1r42	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of PPP1R42 mRNA	CTD	PMID:25539665
Ppp1r42	Rat	lipopolysaccharide	multiple interactions	ISO	PPP1R42 (Homo sapiens)	6480464	[S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of PPP1R42 mRNA	CTD	PMID:35811015
Ppp1r42	Rat	ozone	multiple interactions	ISO	Ppp1r42 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of PPP1R42 mRNA	CTD	PMID:34911549
Ppp1r42	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Ppp1r42 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PPP1R42 mRNA	CTD	PMID:36331819
Ppp1r42	Rat	phenobarbital	increases expression	ISO	Ppp1r42 (Mus musculus)	6480464	Phenobarbital results in increased expression of PPP1R42 mRNA	CTD	PMID:23091169
Ppp1r42	Rat	pregnenolone 16alpha-carbonitrile	increases expression	ISO	Ppp1r42 (Mus musculus)	6480464	Pregnenolone Carbonitrile results in increased expression of PPP1R42 mRNA	CTD	PMID:22698814
Ppp1r42	Rat	propiconazole	increases expression	ISO	Ppp1r42 (Mus musculus)	6480464	propiconazole results in increased expression of PPP1R42 mRNA	CTD	PMID:21278054 more ...
Ppp1r42	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	PPP1R42 (Homo sapiens)	6480464	[S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of PPP1R42 mRNA	CTD	PMID:35811015
Ppp1r42	Rat	titanium dioxide	affects expression	ISO	Ppp1r42 (Mus musculus)	6480464	titanium dioxide affects the expression of PPP1R42 mRNA	CTD	PMID:23557971
Ppp1r42	Rat	titanium dioxide	decreases methylation	ISO	Ppp1r42 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of PPP1R42 enhancer	CTD	PMID:35295148
Ppp1r42	Rat	tremolite asbestos	increases expression	ISO	Ppp1r42 (Mus musculus)	6480464	tremolite results in increased expression of PPP1R42 mRNA	CTD	PMID:29279043
Ppp1r42	Rat	triadimefon	increases expression	ISO	Ppp1r42 (Mus musculus)	6480464	triadimefon results in increased expression of PPP1R42 mRNA	CTD	PMID:23970803
Ppp1r42	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of PPP1R42 mRNA	CTD	PMID:33387578
Ppp1r42	Rat	triptonide	increases expression	ISO	Ppp1r42 (Mus musculus)	6480464	triptonide results in increased expression of PPP1R42 mRNA	CTD	PMID:33045310

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp1r42	Rat	regulation of phosphatase activity	involved_in	ISO	Ppp1r42 (Mus musculus)	1624291	PMID:21738792	RGD	PMID:21738792

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp1r42	Rat	centrosome	located_in	ISO	Ppp1r42 (Mus musculus)	1624291	PMID:19886865	RGD	PMID:19886865
Ppp1r42	Rat	centrosome	located_in	IEA	UniProtKB:Q8R1Z4 and ensembl:ENSMUSP00000027049	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ppp1r42	Rat	manchette	located_in	ISO	Ppp1r42 (Mus musculus)	1624291	PMID:18237440 and PMID:19886865	RGD	PMID:18237440 and PMID:19886865
Ppp1r42	Rat	manchette	located_in	IEA	UniProtKB:Q8R1Z4 and ensembl:ENSMUSP00000027049	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ppp1r42	Rat	microtubule cytoskeleton	located_in	ISO	Ppp1r42 (Mus musculus)	1624291	PMID:19886865	RGD	PMID:19886865
Ppp1r42	Rat	microtubule cytoskeleton	located_in	IEA	UniProtKB:Q8R1Z4 and ensembl:ENSMUSP00000027049	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ppp1r42	Rat	microtubule organizing center	located_in	ISO	Ppp1r42 (Mus musculus)	1624291	PMID:19886865	RGD	PMID:19886865
Ppp1r42	Rat	microtubule organizing center	located_in	IEA	UniProtKB:Q8R1Z4 and ensembl:ENSMUSP00000027049	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp1r42	Rat	actin binding	enables	ISO	Ppp1r42 (Mus musculus)	1624291	PMID:19886865	RGD	PMID:19886865
Ppp1r42	Rat	actin binding	enables	IEA	UniProtKB:Q8R1Z4 and ensembl:ENSMUSP00000027049	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ppp1r42	Rat	dynein complex binding	enables	ISO	Ppp1r42 (Mus musculus)	1624291	PMID:19886865	RGD	PMID:19886865
Ppp1r42	Rat	dynein complex binding	enables	IEA	UniProtKB:Q8R1Z4 and ensembl:ENSMUSP00000027049	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ppp1r42	Rat	protein binding	enables	ISO	Ppp1r42 (Mus musculus)	1624291	UniProtKB:P63087 more ...	RGD	PMID:18237440 more ...
Ppp1r42	Rat	tubulin binding	enables	ISO	Ppp1r42 (Mus musculus)	1624291	PMID:19886865	RGD	PMID:19886865
Ppp1r42	Rat	tubulin binding	enables	IEA	UniProtKB:Q8R1Z4 and ensembl:ENSMUSP00000027049	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:18237440	PMID:19886865	PMID:21738792

Ppp1r42
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	14,009,972 - 14,057,330 (+)	NCBI		GRCr8
mRatBN7.2	5	9,227,109 - 9,274,461 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	9,227,204 - 9,274,453 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	11,379,422 - 11,430,891 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	13,006,578 - 13,060,838 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	12,714,074 - 12,765,558 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	8,911,356 - 8,956,313 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	8,916,633 - 8,956,119 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	13,718,715 - 13,763,672 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	8,773,373 - 8,818,333 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	8,740,514 - 8,787,374 (+)	NCBI		Celera
Cytogenetic Map	5	q11	NCBI

PPP1R42
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	66,964,103 - 67,028,554 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	66,964,099 - 67,056,604 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	67,876,338 - 67,940,789 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	68,062,920 - 68,103,340 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	8	63,893,786 - 63,934,229 (-)	NCBI		Celera
Cytogenetic Map	8	q13.1	NCBI
HuRef	8	63,393,125 - 63,433,545 (-)	NCBI		HuRef
CHM1_1	8	67,955,410 - 67,995,835 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	67,390,584 - 67,455,035 (-)	NCBI		T2T-CHM13v2.0

Ppp1r42
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	10,038,847 - 10,083,766 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	10,038,849 - 10,079,361 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	9,968,622 - 10,013,541 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	9,968,624 - 10,009,136 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	9,958,705 - 9,999,211 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	9,953,838 - 9,994,344 (-)	NCBI		MGSCv36	mm8
Celera	1	9,942,800 - 9,983,315 (-)	NCBI		Celera
Cytogenetic Map	1	A2	NCBI
cM Map	1	2.25	NCBI

Ppp1r42
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955444	12,259,941 - 12,308,911 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955444	12,255,381 - 12,294,605 (+)	NCBI	ChiLan1.0	ChiLan1.0

PPP1R42
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	82,701,653 - 82,769,756 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	58,343,914 - 58,412,017 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	63,507,439 - 63,572,137 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	65,193,802 - 65,233,450 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

PPP1R42
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	16,507,235 - 16,549,210 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	29	16,492,392 - 16,549,320 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	29	16,799,958 - 16,865,364 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	29	16,588,125 - 16,630,441 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	16,580,978 - 16,630,181 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	29	16,620,104 - 16,661,985 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	29	16,696,676 - 16,762,177 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	16,953,032 - 17,018,688 (-)	NCBI		UU_Cfam_GSD_1.0

Ppp1r42
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	67,672,550 - 67,722,170 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936496	7,063,304 - 7,106,130 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936496	7,063,335 - 7,112,890 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PPP1R42
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	67,772,806 - 67,816,230 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	67,771,755 - 67,816,392 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	73,833,186 - 73,875,554 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PPP1R42
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	62,823,763 - 62,891,976 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666039	78,624,276 - 78,679,408 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ppp1r42
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624744	24,336,145 - 24,379,811 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624744	24,331,557 - 24,371,988 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ppp1r42
486 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	29
Count of miRNA genes:	24
Interacting mature miRNAs:	29
Transcripts:	ENSRNOT00000066395
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293666	Bmd38	Bone mineral density QTL 38	4.4		femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	5	8948228	53948228	Rat
2312562	Pur18	Proteinuria QTL 18	2.6	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	5	2138965	32656739	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1300117	Hrtrt8	Heart rate QTL 8	3.49		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	3844018	47869213	Rat
61462	Niddm10	Non-insulin dependent diabetes mellitus QTL 10	3.9	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	5	5112159	47171491	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
631827	Alc4	Alcohol consumption QTL 4	3.5		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	5	8187501	18616199	Rat
2313085	Bss59	Bone structure and strength QTL 59	2.9	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	5	3844018	26141981	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	6	49	112	78	77	47	23	47	6	198	93	92	45	60	30


RefSeq Transcripts	NM_001127569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110784	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063288419	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC161888	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473984	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000066395 ⟹ ENSRNOP00000061242

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	9,227,204 - 9,274,453 (+)	Ensembl
Rnor_6.0 Ensembl	5	8,916,633 - 8,956,119 (+)	Ensembl

RefSeq Acc Id:

NM_001127569 ⟹ NP_001121041

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	14,010,022 - 14,057,330 (+)	NCBI
mRatBN7.2	5	9,227,149 - 9,274,461 (+)	NCBI
Rnor_6.0	5	8,911,356 - 8,956,313 (+)	NCBI
Rnor_5.0	5	13,718,715 - 13,763,672 (+)	NCBI
RGSC_v3.4	5	8,773,373 - 8,818,333 (+)	RGD
Celera	5	8,740,514 - 8,787,374 (+)	RGD

Sequence:

show sequence

CCGGACTGGACAGAGCGGTGAGACGCCCCCCGGAAACCCTAGCCAGTTTTAGAAAGTGGACGTGATACCTAAGCCTGCTTCTGGACATGCTGTCAAAGTGGAGCTTTCGCTGAGAGTTTGACTTATGC
AGAAACTATGGTTCGACTGACAGTGGATTTAATTGCCAAAAACAGCAATCTTAAACCCAGAAAAGAAGAAACCCTTGTACAATGCCTGAAGAAAATAACACACATAAATTTTTCAGACAGAAATATAG
ATTCGATTGATGACCTCTCTCTTTGTAAAAACCTGAGCGTTTTATATTTGTATGATAATCGCATTAGTCAAGTCACTAACCTGAATTACACCACAAATCTGACCCACTTGTACCTACAGAACAATTGC
ATTTCCTGCATCGAAAACCTCAGTTCACTAAAGAAATTGGAAAAACTGTATCTGGGAGGCAATTACATTGCAGTCGTCGAAGGCTTGGAAGGATTAGAGGAGCTGAGAGAGCTTCATGTTGAAAGTCA
GAGGCTCCCCCTGGGAGAAAAGCTCCTGTTTGACCCAAGGACTCTTCGTTCTCTAGCAAAATCCCTCTCTACTTTGAATATCAGCAACAATAACATTGATGACATAAAAGATTTAGAGATGCTGGAGA
ATCTTAATCACCTGATTGCAGTTGACAACCAGCTGATGCACGTGAAGGACTTGGAAGTTTTACTGAGAAAACTGATGAAGTTGTGGAAAATGGATTTAAATGGAAATCCTGTTTGTCTTAAACCAAAA
TACAGGGACAGGCTGATACTGATGTCCAAGTCACTGGAGTTTCTTGATGGAAAAGAAATAAAAAACCTGGAAAGACAATTCCTAATGAATTGGAAAGCATCCAAAGAGGCCAAGAAAATCAGCAAGAA
AAGGAGGAACAGAAGTGAGGATCAAAACAACTCCTACATAAGTAACTTTGAAACAATACATCACATAGTTCCTGTTTATTACCCACAGGTGGGTAAGCCAAAAGTAGTCTTTTTCTCTGATGTACAGA
GATATCTTGGAAAGGCATCTTCAAAGTTTTCTCAAGAAGATAAAACTACAATTACTGAAGATATAGGGAATCTATCCTTGAAGGAATCTGAAAGCTTGCTAACAAAAACCGATATCCATGAACCTCAC
CTTCTCCAAAACCCAAAAGTAAAGGAAAATTTGTCTGAGAATAAGGAGTAAATTCTGCCTCCAGTGATTTGATTTCTTCATAGAACGAGGCAACAGCGTGTTTTGAGGGTTTATAGACTTCGTTTATC
TTGGTGTGTATGTTGTTTTTTTCTTTATAGAATCTGAGACTTTGCTTTATGTGTGTGAATTCTGGGATCTATTTACTCTATTAGCTGTTAAATAAAATTTACCAGGAAATAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039110784 ⟹ XP_038966712

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	14,018,587 - 14,057,330 (+)	NCBI
mRatBN7.2	5	9,235,715 - 9,274,455 (+)	NCBI

RefSeq Acc Id:

XM_063288419 ⟹ XP_063144489

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	14,009,972 - 14,049,523 (+)	NCBI


Protein RefSeqs	NP_001121041	(Get FASTA)	NCBI Sequence Viewer
	XP_038966712	(Get FASTA)	NCBI Sequence Viewer
	XP_063144489	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI61888	(Get FASTA)	NCBI Sequence Viewer
	EDM11551	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000061242
	ENSRNOP00000061242.2

RefSeq Acc Id:

NP_001121041 ⟸ NM_001127569

- UniProtKB:

B1WBU1 (UniProtKB/TrEMBL), E9PTW7 (UniProtKB/TrEMBL), A0A9K3Y8A7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVRLTVDLIAKNSNLKPRKEETLVQCLKKITHINFSDRNIDSIDDLSLCKNLSVLYLYDNRISQVTNLNYTTNLTHLYLQNNCISCIENLSSLKKLEKLYLGGNYIAVVEGLEGLEELRELHVESQRL
PLGEKLLFDPRTLRSLAKSLSTLNISNNNIDDIKDLEMLENLNHLIAVDNQLMHVKDLEVLLRKLMKLWKMDLNGNPVCLKPKYRDRLILMSKSLEFLDGKEIKNLERQFLMNWKASKEAKKISKKRR
NRSEDQNNSYISNFETIHHIVPVYYPQVGKPKVVFFSDVQRYLGKASSKFSQEDKTTITEDIGNLSLKESESLLTKTDIHEPHLLQNPKVKENLSENKE

hide sequence

Ensembl Acc Id:

ENSRNOP00000061242 ⟸ ENSRNOT00000066395

RefSeq Acc Id:	XP_038966712 ⟸ XM_039110784
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063144489 ⟸ XM_063288419
- Peptide Label:	isoform X1

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-42208	BioCyc
Ensembl Genes	ENSRNOG00000006804	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000066395	ENTREZGENE
	ENSRNOT00000066395.3	UniProtKB/TrEMBL
Gene3D-CATH	3.80.10.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7134408	IMAGE-MGC_LOAD
InterPro	L_dom-like	UniProtKB/TrEMBL
	Leu-rich_rpt	UniProtKB/TrEMBL
	Leu-rich_rpt_2_copies	UniProtKB/TrEMBL
	SDS22/Internalin_LRR	UniProtKB/TrEMBL
KEGG Report	rno:683514	UniProtKB/TrEMBL
MGC_CLONE	MGC:187463	IMAGE-MGC_LOAD
NCBI Gene	683514	ENTREZGENE
PANTHER	LEUCINE-RICH REPEAT AND IQ DOMAIN-CONTAINING PROTEIN 1-RELATED	UniProtKB/TrEMBL
	LEUCINE-RICH REPEAT-CONTAINING PROTEIN 9	UniProtKB/TrEMBL
Pfam	LRR_4	UniProtKB/TrEMBL
	LRR_9	UniProtKB/TrEMBL
PhenoGen	Ppp1r42	PhenoGen
PROSITE	LRR	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000006804	RatGTEx
SMART	LRR_SD22	UniProtKB/TrEMBL
Superfamily-SCOP	L domain-like	UniProtKB/TrEMBL
UniProt	A0A9K3Y8A7	ENTREZGENE, UniProtKB/TrEMBL
	B1WBU1	ENTREZGENE, UniProtKB/TrEMBL
	E9PTW7	ENTREZGENE
UniProt Secondary	E9PTW7	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-09-26	Ppp1r42	protein phosphatase 1, regulatory subunit 42	LOC683514	hypothetical protein LOC683514	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC683514	hypothetical protein LOC683514			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar