Spmip2 (sperm microtubule inner protein 2)

Gene: Spmip2 (sperm microtubule inner protein 2) Rattus norvegicus

Analyze

Symbol:

Spmip2 (Ensembl: LOC499643)

Name:

sperm microtubule inner protein 2 (Ensembl:similar to hypothetical protein FLJ25371)

RGD ID:

1566255

Description:

Orthologous to human SPMIP2 (sperm microtubule inner protein 2); INTERACTS WITH bisphenol A; benzo[a]pyrene (ortholog); daunorubicin (ortholog).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC499643; similar to hypothetical protein FLJ25371; sperm associated microtubule inner protein 2; uncharacterized protein C4orf45 homolog; uncharacterized protein LOC499643

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	166,788,056 - 166,902,548 (+)	NCBI		GRCr8
mRatBN7.2	2	164,490,247 - 164,604,379 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	164,490,252 - 164,604,379 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	171,708,210 - 171,822,713 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	169,724,259 - 169,838,741 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	164,333,098 - 164,447,586 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	178,117,385 - 178,231,388 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	178,117,466 - 178,231,479 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	197,453,256 - 197,566,926 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	170,755,542 - 170,870,813 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	158,586,214 - 158,701,037 (+)	NCBI		Celera
Cytogenetic Map	2	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

benzo[a]pyrene (ISO)

bisphenol A (EXP)

daunorubicin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Genomics

Comparative Map Data

Spmip2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	166,788,056 - 166,902,548 (+)	NCBI		GRCr8
mRatBN7.2	2	164,490,247 - 164,604,379 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	164,490,252 - 164,604,379 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	171,708,210 - 171,822,713 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	169,724,259 - 169,838,741 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	164,333,098 - 164,447,586 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	178,117,385 - 178,231,388 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	178,117,466 - 178,231,479 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	197,453,256 - 197,566,926 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	170,755,542 - 170,870,813 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	158,586,214 - 158,701,037 (+)	NCBI		Celera
Cytogenetic Map	2	q33	NCBI

SPMIP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	158,893,134 - 159,082,885 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	158,893,134 - 159,038,760 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	159,814,286 - 159,956,381 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	160,034,134 - 160,175,783 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	4	157,155,716 - 157,297,403 (-)	NCBI		Celera
Cytogenetic Map	4	q32.1	NCBI
HuRef	4	155,564,781 - 155,706,191 (-)	NCBI		HuRef
CHM1_1	4	159,791,149 - 159,932,816 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	162,243,906 - 162,433,698 (-)	NCBI		T2T-CHM13v2.0

Spmip2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	79,243,937 - 79,371,436 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	79,243,968 - 79,371,436 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	79,336,630 - 79,464,129 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	79,336,661 - 79,464,129 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	79,149,298 - 79,268,051 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
Celera	3	79,381,624 - 79,500,963 (+)	NCBI		Celera
Cytogenetic Map	3	E3	NCBI
cM Map	3	34.91	NCBI

Spmip2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955471	12,437,203 - 12,537,997 (-)	NCBI	ChiLan1.0	ChiLan1.0

SPMIP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	156,755,405 - 156,902,610 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	157,110,653 - 157,257,870 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	151,201,560 - 151,353,543 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	163,019,096 - 163,160,743 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	163,019,096 - 163,160,743 (-)	Ensembl	panpan1.1		panPan2

SPMIP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	55,953,580 - 56,055,693 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	55,954,929 - 56,055,633 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	56,316,710 - 56,417,393 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	56,698,623 - 56,799,359 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	56,698,640 - 56,799,299 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	55,936,516 - 56,037,042 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	56,036,228 - 56,134,423 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	56,349,846 - 56,448,283 (-)	NCBI		UU_Cfam_GSD_1.0

Spmip2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	34,123,222 - 34,206,980 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936576	5,340,998 - 5,382,135 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936576	5,341,414 - 5,423,325 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SPMIP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	105,430,898 - 105,558,534 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666037	85,140,385 - 85,284,154 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Spmip2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624848	3,831,799 - 3,866,082 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Spmip2
688 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	39
Count of miRNA genes:	38
Interacting mature miRNAs:	38
Transcripts:	ENSRNOT00000065115
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	114837527	185876470	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
6907363	Bp357	Blood pressure QTL 357	4.1	0.002	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	129540907	174540907	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	143657411	190602963	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	143657569	184114274	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
631520	Bp73	Blood pressure QTL 73		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147686913	168355276	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
12879845	Cm89	Cardiac mass QTL 89		0.008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	175950118	Rat
12879846	Cm90	Cardiac mass QTL 90		0.011	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	2	152413072	175950118	Rat
12879847	Am4	Aortic mass QTL 4		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	175950118	Rat
11565180	Kidm56	Kidney mass QTL 56		0.003	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	175950118	Rat
11565181	Bw176	Body weight QTL 176		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	175950118	Rat
2301415	Cm67	Cardiac mass QTL 67		0.003	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	175950118	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	185122374	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	185122374	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	185122374	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	185122374	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	185122374	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat

Markers in Region

D2Rat133

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	164,552,433 - 164,552,628 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	178,177,359 - 178,177,553	NCBI	Rnor6.0
Rnor_5.0	2	197,513,076 - 197,513,270	UniSTS	Rnor5.0
RGSC_v3.4	2	170,817,615 - 170,817,807	RGD	RGSC3.4
RGSC_v3.4	2	170,817,613 - 170,817,807	UniSTS	RGSC3.4
RGSC_v3.1	2	170,767,678 - 170,767,941	RGD
Celera	2	158,648,362 - 158,648,555	UniSTS
SHRSP x BN Map	2	69.1098	UniSTS
SHRSP x BN Map	2	69.1098	RGD
FHH x ACI Map	2	73.2599	RGD
Cytogenetic Map	2	q32	UniSTS

RH131653

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	164,596,774 - 164,596,977 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	178,223,784 - 178,223,986	NCBI	Rnor6.0
Rnor_5.0	2	197,559,322 - 197,559,524	UniSTS	Rnor5.0
RGSC_v3.4	2	170,863,209 - 170,863,411	UniSTS	RGSC3.4
Celera	2	158,693,433 - 158,693,635	UniSTS
RH 3.4 Map	2	1060.9	UniSTS
Cytogenetic Map	2	q32	UniSTS

RH142649

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	164,520,206 - 164,520,325 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	178,145,139 - 178,145,257	NCBI	Rnor6.0
Rnor_5.0	2	197,480,935 - 197,481,053	UniSTS	Rnor5.0
RGSC_v3.4	2	170,785,496 - 170,785,614	UniSTS	RGSC3.4
Celera	2	158,616,265 - 158,616,383	UniSTS
RH 3.4 Map	2	1057.6	UniSTS
Cytogenetic Map	2	q32	UniSTS

BI276803

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	164,599,066 - 164,599,225 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	178,226,076 - 178,226,234	NCBI	Rnor6.0
Rnor_5.0	2	197,561,614 - 197,561,772	UniSTS	Rnor5.0
RGSC_v3.4	2	170,865,501 - 170,865,659	UniSTS	RGSC3.4
Celera	2	158,695,725 - 158,695,883	UniSTS
RH 3.4 Map	2	1059.3	UniSTS
Cytogenetic Map	2	q32	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium											7
Low			19	8	16	8	1	1	7	9	6	9	1
Below cutoff	3	11	14	9	3	9	7	9	10	14	13	2	7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024301	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001401975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008761109	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282370	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282371	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC121415	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC085354	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000065115 ⟹ ENSRNOP00000061794

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	164,490,252 - 164,604,379 (+)	Ensembl
Rnor_6.0 Ensembl	2	178,117,466 - 178,231,479 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000084198 ⟹ ENSRNOP00000075026

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	164,490,255 - 164,571,517 (+)	Ensembl
Rnor_6.0 Ensembl	2	178,117,486 - 178,199,062 (+)	Ensembl

RefSeq Acc Id:

NM_001024301 ⟹ NP_001019472

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	166,788,442 - 166,902,548 (+)	NCBI
mRatBN7.2	2	164,490,252 - 164,604,379 (+)	NCBI
Rnor_6.0	2	178,117,483 - 178,231,388 (+)	NCBI
Rnor_5.0	2	197,453,256 - 197,566,926 (+)	NCBI
RGSC_v3.4	2	170,755,542 - 170,870,813 (+)	RGD
Celera	2	158,586,214 - 158,701,037 (+)	RGD

Sequence:

show sequence

ACAGACAGGGAGAGCAGAGACACGGTCCTTGCCACTTACTGGTGCACTCACTGTTCTGAGGACA
TTCAGGCAGTAATTGCAGCAAAGAAGTTGAAACTTCGGCCATGGCTTTGTCACACCGGGAGCCA
CTCTCTGAGACGGTGGGAAAGCGCATGGTCATCACAGGTCCAGACTACATAAAAGACCACTTGC
CTAAAGTTCACCAGCATATCGCCTATATAGGAGAAAAGCGTCCAGCATTAGAGAAAACTGGAGA
TCTCAGATATTTATGGAGGTCTGCTTCCAACAGAAGCCTGCCGGCAAAGTATAAACACGAGTAC
ACTGGTGGAATTGGTTGGGGGATACCACAGTACAGTTTCTTCAACAGATCAAGAGTGGAAAGTG
GCTTTCATATCCAGCACGGCGAACTAAGTCTTCGAGCGATGGACAGATTAACCCACCGCTATCA
AAACCCTTGGCAGCCGAAGCCTTTTGTTCTGAACCAGCAACAAGGATACAGTCGTGGTTTTCTC
GCTTGGAATATGGGAGATTATGAAAACATCCAGCAGAGAGACTCCAAACGGGCTATTCTTCTTA
AACAGAGTAAGTTACTAAGGAGCACCCCACCCTCCAGGCTGCCCAAGCTACCAAGCAAGGAAGA
GAAGAAAAGGAAATTCAAGTCTCAAAATCAGGACAGATCAAAACACTTCTAGGATAAAGTGAGA
TCATAATAACGCTGAGTGGTGCTCCTGACGCCCCTTGGACCCACAGTCTGCAGAGCACGCTTCA
GCTAAGAGCCAAATAAAGATTGTTATGAAA

hide sequence

RefSeq Acc Id:

NM_001401975 ⟹ NP_001388904

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	166,788,437 - 166,869,686 (+)	NCBI
mRatBN7.2	2	164,490,247 - 164,571,519 (+)	NCBI

RefSeq Acc Id:

XM_063282370 ⟹ XP_063138440

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	166,788,056 - 166,869,686 (+)	NCBI

RefSeq Acc Id:

XM_063282371 ⟹ XP_063138441

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	166,843,337 - 166,869,686 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001019472	(Get FASTA)	NCBI Sequence Viewer
	NP_001388904	(Get FASTA)	NCBI Sequence Viewer
	XP_063138440	(Get FASTA)	NCBI Sequence Viewer
	XP_063138441	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH85354	(Get FASTA)	NCBI Sequence Viewer
	EDM00873	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000061794
	ENSRNOP00000061794.1
	ENSRNOP00000075026
	ENSRNOP00000075026.1

RefSeq Acc Id:	NP_001019472 ⟸ NM_001024301
- Peptide Label:	isoform 1
- UniProtKB:	D4A0C9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MALSHREPLSETVGKRMVITGPDYIKDHLPKVHQHIAYIGEKRPALEKTGDLRYLWRSASNRSL PAKYKHEYTGGIGWGIPQYSFFNRSRVESGFHIQHGELSLRAMDRLTHRYQNPWQPKPFVLNQQ QGYSRGFLAWNMGDYENIQQRDSKRAILLKQSKLLRSTPPSRLPKLPSKEEKKRKFKSQNQDRS KHF hide sequence

RefSeq Acc Id:

ENSRNOP00000061794 ⟸ ENSRNOT00000065115

RefSeq Acc Id:

ENSRNOP00000075026 ⟸ ENSRNOT00000084198

RefSeq Acc Id:	NP_001388904 ⟸ NM_001401975
- Peptide Label:	isoform 2
- UniProtKB:	Q5U3X7 (UniProtKB/TrEMBL), A6J5R6 (UniProtKB/TrEMBL), A0A0G2K9K1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063138440 ⟸ XM_063282370
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063138441 ⟸ XM_063282371
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5U3X7-F1-model_v2	AlphaFold	Q5U3X7	1-485	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1566255	AgrOrtholog
BioCyc Gene	G2FUF-52732	BioCyc
Ensembl Genes	ENSRNOG00000032009	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000065115	ENTREZGENE
	ENSRNOT00000065115.3	UniProtKB/TrEMBL
	ENSRNOT00000084198	ENTREZGENE
	ENSRNOT00000084198.2	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7132360	IMAGE-MGC_LOAD
InterPro	DUF4562	UniProtKB/TrEMBL
KEGG Report	rno:499643	UniProtKB/TrEMBL
MGC_CLONE	MGC:105887	IMAGE-MGC_LOAD
NCBI Gene	499643	ENTREZGENE
PANTHER	GENE, 17359-RELATED	UniProtKB/TrEMBL
	PTHR34833	UniProtKB/TrEMBL
Pfam	DUF4562	UniProtKB/TrEMBL
PhenoGen	Spmip2	PhenoGen
RatGTEx	ENSRNOG00000032009	RatGTEx
UniProt	A0A0G2K9K1	ENTREZGENE, UniProtKB/TrEMBL
	A6J5R6	ENTREZGENE, UniProtKB/TrEMBL
	D4A0C9	ENTREZGENE, UniProtKB/TrEMBL
	Q5U3X7	ENTREZGENE
UniProt Secondary	Q5U3X7	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-05-25	Spmip2	sperm microtubule inner protein 2	Spmip2	sperm associated microtubule inner protein 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2023-05-08	Spmip2	sperm associated microtubule inner protein 2	LOC499643	similar to hypothetical protein FLJ25371	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC499643	similar to hypothetical protein FLJ25371			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar