Symbol:
Celf5
Name:
CUGBP, Elav-like family member 5
RGD ID:
1565016
Description:
Predicted to enable mRNA binding activity. Predicted to be involved in mRNA splice site recognition and regulation of alternative mRNA splicing, via spliceosome. Predicted to be part of ribonucleoprotein complex. Predicted to be active in cytoplasm and nucleus. Orthologous to human CELF5 (CUGBP Elav-like family member 5); INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
bruno-like 5, RNA binding protein; bruno-like 5, RNA binding protein (Drosophila); Brunol5; CUG-BP- and ETR-3-like factor 5; CUGBP Elav-like family member 5; LOC314647; RGD1565016; similar to bruno-like 5, RNA binding protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CELF5 (CUGBP Elav-like family member 5) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Mus musculus (house mouse):
Celf5 (CUGBP, Elav-like family member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Celf5 (CUGBP Elav-like family member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CELF5 (CUGBP Elav-like family member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CELF5 (CUGBP Elav-like family member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Celf5 (CUGBP Elav-like family member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CELF5 (CUGBP Elav-like family member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CELF5 (CUGBP Elav-like family member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Celf5 (CUGBP Elav-like family member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
RAMAC (RNA guanine-7 methyltransferase activating subunit) HGNC
OMA
Homo sapiens (human):
RAMACL (RNA guanine-7 methyltransferase activating subunit like) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CELF5 (CUGBP Elav-like family member 5)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Celf5 (CUGBP, Elav-like family member 5)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
celf5a (cugbp, Elav-like family member 5a)
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
celf5b (cugbp, Elav-like family member 5b)
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
unc-75
Alliance
DIOPT (Hieranoid|OrthoInspector|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
celf5
Alliance
DIOPT (Hieranoid|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 8,876,551 - 8,901,078 (+) NCBI GRCr8 mRatBN7.2 7 8,225,787 - 8,250,322 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 8,225,825 - 8,250,322 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 11,111,860 - 11,136,274 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 12,987,344 - 13,011,759 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 10,854,468 - 10,879,038 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 11,095,449 - 11,119,941 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 11,095,468 - 11,119,941 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 11,262,391 - 11,287,130 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 9,709,875 - 9,735,811 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 6,416,360 - 6,439,598 (+) NCBI Celera Cytogenetic Map 7 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Celf5 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1557373 6480464 1,2-Dimethylhydrazine results in decreased expression of CELF5 mRNA CTD PMID:22206623 Celf5 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of CELF5 mRNA CTD PMID:30723492 Celf5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1557373 6480464 Tetrachlorodibenzodioxin results in increased expression of CELF5 mRNA CTD PMID:16962184 Celf5 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CELF5 mRNA CTD PMID:33387578 Celf5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CELF5 mRNA CTD PMID:32109520 Celf5 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1557373 6480464 bisphenol S results in decreased expression of CELF5 mRNA CTD PMID:30951980 Celf5 Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:1557373 6480464 bisphenol S affects the methylation of CELF5 gene CTD PMID:31683443 Celf5 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CELF5 mRNA CTD PMID:30047161 Celf5 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of CELF5 mRNA CTD PMID:36843608 Celf5 Rat 7,12-dimethyltetraphene increases expression ISO RGD:1557373 6480464 9,10-Dimethyl-1,2-benzanthracene metabolite results in increased expression of CELF5 mRNA CTD PMID:32553695 Celf5 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of CELF5 mRNA CTD PMID:31881176 Celf5 Rat aflatoxin B1 increases methylation ISO RGD:1345217 6480464 Aflatoxin B1 results in increased methylation of CELF5 3' UTR; Aflatoxin B1 results in increased more ... CTD PMID:30157460 Celf5 Rat Aflatoxin B2 alpha increases methylation ISO RGD:1345217 6480464 aflatoxin B2 results in increased methylation of CELF5 intron CTD PMID:30157460 Celf5 Rat all-trans-retinoic acid decreases expression ISO RGD:1345217 6480464 Tretinoin results in decreased expression of CELF5 mRNA CTD PMID:21934132 Celf5 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CELF5 mRNA CTD PMID:35163327 Celf5 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of CELF5 mRNA CTD PMID:30047161|PMID:38685447 Celf5 Rat benzo[a]pyrene increases mutagenesis ISO RGD:1345217 6480464 Benzo(a)pyrene results in increased mutagenesis of CELF5 gene CTD PMID:25435355 Celf5 Rat benzo[a]pyrene multiple interactions ISO RGD:1557373 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ... CTD PMID:27858113 Celf5 Rat benzo[a]pyrene increases expression ISO RGD:1557373 6480464 Benzo(a)pyrene metabolite results in increased expression of CELF5 mRNA; Benzo(a)pyrene results in increased expression of more ... CTD PMID:23735875|PMID:32553695 Celf5 Rat benzo[b]fluoranthene increases expression ISO RGD:1557373 6480464 benzo(b)fluoranthene results in increased expression of CELF5 mRNA CTD PMID:26377693 Celf5 Rat benzo[b]fluoranthene multiple interactions ISO RGD:1557373 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ... CTD PMID:27858113 Celf5 Rat benzo[e]pyrene decreases methylation ISO RGD:1345217 6480464 benzo(e)pyrene results in decreased methylation of CELF5 intron CTD PMID:30157460 Celf5 Rat Benzo[ghi]perylene decreases expression ISO RGD:1557373 6480464 1,12-benzoperylene results in decreased expression of CELF5 mRNA CTD PMID:26377693 Celf5 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CELF5 mRNA CTD PMID:25181051|PMID:30816183 Celf5 Rat bisphenol A decreases expression ISO RGD:1557373 6480464 bisphenol A results in decreased expression of CELF5 mRNA CTD PMID:32156529 Celf5 Rat bisphenol A increases methylation ISO RGD:1345217 6480464 bisphenol A results in increased methylation of CELF5 gene CTD PMID:31601247 Celf5 Rat bisphenol A multiple interactions ISO RGD:1345217 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of CELF5 gene CTD PMID:31601247 Celf5 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CELF5 mRNA CTD PMID:34947998 Celf5 Rat bisphenol F decreases expression ISO RGD:1557373 6480464 bisphenol F results in decreased expression of CELF5 mRNA CTD PMID:30951980 Celf5 Rat butanal increases expression ISO RGD:1345217 6480464 butyraldehyde results in increased expression of CELF5 mRNA CTD PMID:26079696 Celf5 Rat Butylparaben increases expression ISO RGD:1345217 6480464 butylparaben results in increased expression of CELF5 mRNA CTD PMID:17121429 Celf5 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of CELF5 mRNA CTD PMID:19167457 Celf5 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of CELF5 promoter CTD PMID:22457795 Celf5 Rat chlorpyrifos decreases expression ISO RGD:1557373 6480464 Chlorpyrifos results in decreased expression of CELF5 mRNA CTD PMID:37019170 Celf5 Rat chrysene multiple interactions ISO RGD:1557373 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ... CTD PMID:27858113 Celf5 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of CELF5 mRNA CTD PMID:24386269 Celf5 Rat copper atom multiple interactions EXP 6480464 [Copper co-treated with Dietary Sucrose] results in increased expression of CELF5 mRNA CTD PMID:26033743 Celf5 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of CELF5 mRNA CTD PMID:26033743 Celf5 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of CELF5 mRNA CTD PMID:26033743 Celf5 Rat copper(0) multiple interactions EXP 6480464 [Copper co-treated with Dietary Sucrose] results in increased expression of CELF5 mRNA CTD PMID:26033743 Celf5 Rat DDE decreases expression ISO RGD:1345217 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of CELF5 mRNA CTD PMID:38568856 Celf5 Rat dibenz[a,h]anthracene increases expression ISO RGD:1557373 6480464 1,2,5,6-dibenzanthracene results in increased expression of CELF5 mRNA CTD PMID:26377693 Celf5 Rat dorsomorphin multiple interactions ISO RGD:1345217 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Celf5 Rat ethanol multiple interactions ISO RGD:1557373 6480464 Ethanol affects the expression of and affects the splicing of CELF5 mRNA CTD PMID:30319688 Celf5 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of CELF5 mRNA CTD PMID:30307764 Celf5 Rat folic acid decreases expression ISO RGD:1557373 6480464 Folic Acid results in decreased expression of CELF5 mRNA CTD PMID:25629700 Celf5 Rat fulvestrant multiple interactions ISO RGD:1345217 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of CELF5 gene CTD PMID:31601247 Celf5 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of CELF5 mRNA CTD PMID:33387578 Celf5 Rat Licochalcone B increases expression ISO RGD:1345217 6480464 licochalcone B results in increased expression of CELF5 mRNA CTD PMID:33647349 Celf5 Rat mercury dibromide decreases expression ISO RGD:1345217 6480464 mercuric bromide results in decreased expression of CELF5 mRNA CTD PMID:26272509 Celf5 Rat mercury dibromide multiple interactions ISO RGD:1345217 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Celf5 Rat methapyrilene decreases methylation ISO RGD:1345217 6480464 Methapyrilene results in decreased methylation of CELF5 intron CTD PMID:30157460 Celf5 Rat methylmercury chloride decreases expression ISO RGD:1345217 6480464 methylmercuric chloride results in decreased expression of CELF5 mRNA CTD PMID:28001369 Celf5 Rat methylparaben increases expression ISO RGD:1345217 6480464 methylparaben results in increased expression of CELF5 mRNA CTD PMID:17121429 Celf5 Rat ozone multiple interactions ISO RGD:1557373 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of CELF5 more ... CTD PMID:27106289|PMID:34911549 Celf5 Rat p-chloromercuribenzoic acid decreases expression ISO RGD:1345217 6480464 p-Chloromercuribenzoic Acid results in decreased expression of CELF5 mRNA CTD PMID:26272509 Celf5 Rat p-chloromercuribenzoic acid multiple interactions ISO RGD:1345217 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Celf5 Rat panobinostat decreases expression ISO RGD:1345217 6480464 panobinostat results in decreased expression of CELF5 mRNA CTD PMID:26272509 Celf5 Rat panobinostat multiple interactions ISO RGD:1345217 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Celf5 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CELF5 mRNA CTD PMID:33387578 Celf5 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CELF5 mRNA CTD PMID:35163327 Celf5 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of CELF5 mRNA CTD PMID:35163327 Celf5 Rat phenylmercury acetate decreases expression ISO RGD:1345217 6480464 Phenylmercuric Acetate results in decreased expression of CELF5 mRNA CTD PMID:26272509 Celf5 Rat phenylmercury acetate multiple interactions ISO RGD:1345217 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Celf5 Rat propanal increases expression ISO RGD:1345217 6480464 propionaldehyde results in increased expression of CELF5 mRNA CTD PMID:26079696 Celf5 Rat resveratrol multiple interactions ISO RGD:1345217 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of CELF5 mRNA CTD PMID:23557933 Celf5 Rat SB 431542 multiple interactions ISO RGD:1345217 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Celf5 Rat silicon dioxide decreases expression ISO RGD:1345217 6480464 Silicon Dioxide analog results in decreased expression of CELF5 mRNA CTD PMID:25895662 Celf5 Rat tetraphene multiple interactions ISO RGD:1557373 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ... CTD PMID:27858113 Celf5 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of CELF5 mRNA CTD PMID:23411599 Celf5 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CELF5 mRNA CTD PMID:34492290 Celf5 Rat titanium dioxide increases methylation ISO RGD:1557373 6480464 titanium dioxide results in increased methylation of CELF5 gene CTD PMID:35295148 Celf5 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of CELF5 mRNA CTD PMID:33387578 Celf5 Rat trichostatin A increases expression ISO RGD:1345217 6480464 trichostatin A results in increased expression of CELF5 mRNA CTD PMID:24935251 Celf5 Rat trichostatin A multiple interactions ISO RGD:1345217 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Celf5 Rat trichostatin A decreases expression ISO RGD:1345217 6480464 trichostatin A results in decreased expression of CELF5 mRNA CTD PMID:24935251|PMID:26272509 Celf5 Rat triptonide increases expression ISO RGD:1557373 6480464 triptonide results in increased expression of CELF5 mRNA CTD PMID:33045310 Celf5 Rat tris(2-butoxyethyl) phosphate affects expression ISO RGD:1345217 6480464 tris(2-butoxyethyl) phosphate affects the expression of CELF5 mRNA CTD PMID:29024780 Celf5 Rat valproic acid affects expression ISO RGD:1345217 6480464 Valproic Acid affects the expression of CELF5 mRNA CTD PMID:25979313 Celf5 Rat valproic acid increases expression ISO RGD:1345217 6480464 Valproic Acid results in increased expression of CELF5 mRNA CTD PMID:19101580|PMID:23179753|PMID:27188386 Celf5 Rat valproic acid decreases expression ISO RGD:1345217 6480464 Valproic Acid results in decreased expression of CELF5 mRNA CTD PMID:28001369 Celf5 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of CELF5 mRNA CTD PMID:29427782
1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) acetamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amitrole (EXP) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) Benzo[ghi]perylene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) Butylparaben (ISO) C60 fullerene (EXP) cadmium dichloride (EXP) chlorpyrifos (ISO) chrysene (ISO) cobalt dichloride (EXP) copper atom (EXP) copper(0) (EXP) DDE (ISO) dibenz[a,h]anthracene (ISO) dorsomorphin (ISO) ethanol (ISO) fenvalerate (EXP) folic acid (ISO) fulvestrant (ISO) gentamycin (EXP) Licochalcone B (ISO) mercury dibromide (ISO) methapyrilene (ISO) methylmercury chloride (ISO) methylparaben (ISO) ozone (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) paracetamol (EXP) perfluorooctanoic acid (EXP) phenylmercury acetate (ISO) propanal (ISO) resveratrol (ISO) SB 431542 (ISO) silicon dioxide (ISO) tetraphene (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triptonide (ISO) tris(2-butoxyethyl) phosphate (ISO) valproic acid (EXP,ISO)
Celf5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 8,876,551 - 8,901,078 (+) NCBI GRCr8 mRatBN7.2 7 8,225,787 - 8,250,322 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 8,225,825 - 8,250,322 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 11,111,860 - 11,136,274 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 12,987,344 - 13,011,759 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 10,854,468 - 10,879,038 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 11,095,449 - 11,119,941 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 11,095,468 - 11,119,941 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 11,262,391 - 11,287,130 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 9,709,875 - 9,735,811 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 6,416,360 - 6,439,598 (+) NCBI Celera Cytogenetic Map 7 q11 NCBI
CELF5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 3,224,661 - 3,297,076 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 3,224,661 - 3,297,076 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 3,224,659 - 3,297,074 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 3,175,701 - 3,248,074 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 3,175,700 - 3,248,071 NCBI Celera 19 3,161,110 - 3,233,889 (+) NCBI Celera Cytogenetic Map 19 p13.3 NCBI HuRef 19 2,992,255 - 3,064,363 (+) NCBI HuRef CHM1_1 19 3,224,288 - 3,296,678 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 3,199,540 - 3,272,447 (+) NCBI T2T-CHM13v2.0
Celf5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 81,295,061 - 81,318,564 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 81,295,061 - 81,318,543 (-) Ensembl GRCm39 Ensembl GRCm38 10 81,459,227 - 81,482,730 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 81,459,227 - 81,482,709 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 80,921,973 - 80,945,454 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 80,865,343 - 80,885,807 (-) NCBI MGSCv36 mm8 Celera 10 82,482,165 - 82,506,092 (-) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 39.72 NCBI
Celf5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 5,185,126 - 5,214,718 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 5,182,758 - 5,214,724 (-) NCBI ChiLan1.0 ChiLan1.0
CELF5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 7,620,674 - 7,693,777 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 6,853,922 - 6,928,845 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 2,250,694 - 2,278,961 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 3,230,999 - 3,274,900 (+) NCBI panpan1.1 PanPan1.1 panPan2
CELF5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 56,027,245 - 56,075,579 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 56,029,575 - 56,075,948 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 55,751,352 - 55,799,556 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 56,686,152 - 56,734,387 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 56,686,738 - 56,734,681 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 55,741,712 - 55,789,866 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 56,225,332 - 56,273,852 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 56,424,157 - 56,472,338 (-) NCBI UU_Cfam_GSD_1.0
Celf5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 215,947,705 - 215,982,648 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936588 1,852,126 - 1,887,240 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936588 1,864,793 - 1,887,082 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CELF5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 75,314,834 - 75,364,103 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 75,314,808 - 75,364,189 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 75,956,800 - 75,987,394 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CELF5
Celf5
.
Predicted Target Of
Count of predictions: 393 Count of miRNA genes: 224 Interacting mature miRNAs: 290 Transcripts: ENSRNOT00000061219 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
8
43
113
81
80
49
25
49
6
195
89
93
41
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000061219 ⟹ ENSRNOP00000057932
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 8,225,825 - 8,250,322 (+) Ensembl Rnor_6.0 Ensembl 7 11,095,468 - 11,119,941 (+) Ensembl
RefSeq Acc Id:
NM_001135603 ⟹ NP_001129075
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 8,876,585 - 8,901,078 (+) NCBI mRatBN7.2 7 8,225,825 - 8,250,322 (+) NCBI Rnor_6.0 7 11,095,468 - 11,119,941 (+) NCBI Rnor_5.0 7 11,262,391 - 11,287,130 (+) NCBI RGSC_v3.4 7 9,709,875 - 9,735,811 (+) RGD Celera 7 6,416,360 - 6,439,598 (+) RGD
Sequence:
CGGCCGCACCACAGCTCCTGCCCGGGCCAGGCCGGTGGGCGGCAGCGGGCCCGAGCGCCCCGGGGCGCGGCCCGACGGCATGAAGGACCTGGACGCCATCAAGCTCTTCGTGGGCCAAATCCCGCGTC
hide sequence
RefSeq Acc Id:
XM_006240942 ⟹ XP_006241004
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 8,876,551 - 8,901,072 (+) NCBI mRatBN7.2 7 8,225,787 - 8,250,322 (+) NCBI Rnor_6.0 7 11,095,449 - 11,119,941 (+) NCBI Rnor_5.0 7 11,262,391 - 11,287,130 (+) NCBI
Sequence:
GGCCGCTGACGGAGCGAAGCGGCCGCACCACAGCTCCTGCCCGGGCCAGGCCGGTGGGCGGCAG
hide sequence
RefSeq Acc Id:
XM_008765104 ⟹ XP_008763326
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 8,887,384 - 8,901,072 (+) NCBI mRatBN7.2 7 8,236,655 - 8,250,322 (+) NCBI Rnor_6.0 7 11,106,303 - 11,119,941 (+) NCBI
Sequence:
ACCCCTCCCCTGCCTCTTCGCCCCACACCCCTCCTAGGCGCCCTGACCCCAGAAGCGGAACTAT
hide sequence
RefSeq Acc Id:
XM_008765105 ⟹ XP_008763327
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 8,877,144 - 8,901,072 (+) NCBI mRatBN7.2 7 8,226,391 - 8,250,322 (+) NCBI Rnor_6.0 7 11,096,080 - 11,119,941 (+) NCBI
Sequence:
GGCATCTACCTCTCTTTTCCCCTCTCCCTCCCATTCCCATTCCCAGACCCCTCCTAACCTGTGCCTAGAGCGCCAGAGACCCCAGCCTCCCAGCCCCCACCACCCTTCTTGTTGCTTTTGGTCTTCCT
hide sequence
RefSeq Acc Id:
XM_017594819 ⟹ XP_017450308
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 8,876,552 - 8,901,072 (+) NCBI mRatBN7.2 7 8,225,787 - 8,250,322 (+) NCBI Rnor_6.0 7 11,095,449 - 11,119,941 (+) NCBI
Sequence:
GGCCGCTGACGGAGCGAAGCGGCCGCACCACAGCTCCTGCCCGGGCCAGGCCGGTGGGCGGCAGCGGGCCCGAGCGCCCCGGGGCGCGGCCCGACGGCATGAAGGACCTGGACGCCATCAAGCTCTTC
hide sequence
RefSeq Acc Id:
XM_039079023 ⟹ XP_038934951
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 8,876,552 - 8,901,072 (+) NCBI mRatBN7.2 7 8,225,787 - 8,250,322 (+) NCBI
RefSeq Acc Id:
XM_039079024 ⟹ XP_038934952
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 8,887,024 - 8,901,072 (+) NCBI mRatBN7.2 7 8,236,255 - 8,250,322 (+) NCBI
RefSeq Acc Id:
XM_039079025 ⟹ XP_038934953
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 8,887,024 - 8,901,072 (+) NCBI mRatBN7.2 7 8,236,255 - 8,250,322 (+) NCBI
RefSeq Acc Id:
XM_039079026 ⟹ XP_038934954
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 8,887,024 - 8,901,072 (+) NCBI mRatBN7.2 7 8,236,255 - 8,250,322 (+) NCBI
RefSeq Acc Id:
XM_039079027 ⟹ XP_038934955
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 8,887,413 - 8,901,072 (+) NCBI mRatBN7.2 7 8,236,655 - 8,250,322 (+) NCBI
RefSeq Acc Id:
XM_039079028 ⟹ XP_038934956
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 8,887,413 - 8,901,072 (+) NCBI mRatBN7.2 7 8,236,655 - 8,250,322 (+) NCBI
RefSeq Acc Id:
XM_063263430 ⟹ XP_063119500
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 8,887,346 - 8,901,072 (+) NCBI
RefSeq Acc Id:
XM_063263431 ⟹ XP_063119501
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 8,877,145 - 8,901,072 (+) NCBI
RefSeq Acc Id:
XM_063263432 ⟹ XP_063119502
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 8,884,399 - 8,901,072 (+) NCBI
RefSeq Acc Id:
XM_063263433 ⟹ XP_063119503
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 8,877,144 - 8,901,072 (+) NCBI
RefSeq Acc Id:
NP_001129075 ⟸ NM_001135603
- Sequence:
MKDLDAIKLFVGQIPRHLHEQDLKPLFEQFGRIYELTVLKDPHTGVHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSENRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVL
hide sequence
RefSeq Acc Id:
XP_006241004 ⟸ XM_006240942
- Peptide Label:
isoform X2
- Sequence:
MKDLDAIKLFVGQIPRHLHEQDLKPLFEQFGRIYELTVLKDPHTGVHKGCAFLTYCARDSAIKA
hide sequence
RefSeq Acc Id:
XP_008763327 ⟸ XM_008765105
- Peptide Label:
isoform X8
- Sequence:
MARPIQVKPADSENRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFS
hide sequence
RefSeq Acc Id:
XP_008763326 ⟸ XM_008765104
- Peptide Label:
isoform X6
- Sequence:
MWCGTQMARPIQVKPADSENRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPS
hide sequence
RefSeq Acc Id:
XP_017450308 ⟸ XM_017594819
- Peptide Label:
isoform X3
- Sequence:
MKDLDAIKLFVGQIPRHLHEQDLKPLFEQFGRIYELTVLKDPHTGVHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSENRGGDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLR
hide sequence
Ensembl Acc Id:
ENSRNOP00000057932 ⟸ ENSRNOT00000061219
RefSeq Acc Id:
XP_038934951 ⟸ XM_039079023
- Peptide Label:
isoform X1
- UniProtKB:
D4A8V0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934952 ⟸ XM_039079024
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_038934953 ⟸ XM_039079025
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_038934954 ⟸ XM_039079026
- Peptide Label:
isoform X9
RefSeq Acc Id:
XP_038934955 ⟸ XM_039079027
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_038934956 ⟸ XM_039079028
- Peptide Label:
isoform X11
RefSeq Acc Id:
XP_063119503 ⟸ XM_063263433
- Peptide Label:
isoform X13
RefSeq Acc Id:
XP_063119501 ⟸ XM_063263431
- Peptide Label:
isoform X12
- UniProtKB:
A6K877 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119502 ⟸ XM_063263432
- Peptide Label:
isoform X12
- UniProtKB:
A6K877 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119500 ⟸ XM_063263430
- Peptide Label:
isoform X10
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-07-28
Celf5
CUGBP, Elav-like family member 5
Brunol5
bruno-like 5, RNA binding protein (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-07
Brunol5
bruno-like 5, RNA binding protein (Drosophila)
RGD1565016_predicted
similar to bruno-like 5, RNA binding protein (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1565016_predicted
similar to bruno-like 5, RNA binding protein (predicted)
LOC314647
similar to bruno-like 5, RNA binding protein
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC314647
similar to bruno-like 5, RNA binding protein
Symbol and Name status set to provisional
70820 PROVISIONAL
