Advanced Search (OLGA)

Gene: Ppef1 (protein phosphatase with EF-hand domain 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ppef1

Name:

protein phosphatase with EF-hand domain 1

RGD ID:

1562772

Description:

Predicted to enable protein serine/threonine phosphatase activity. Predicted to be involved in chromatin remodeling; detection of stimulus involved in sensory perception; and regulation of transcription by RNA polymerase II. Predicted to be active in cytosol and nucleus. Orthologous to human PPEF1 (protein phosphatase with EF-hand domain 1); INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; atrazine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC317498; MGC125115; PPEF-1; protein phosphatase with EF hand calcium-binding domain 1; protein phosphatase, EF-hand calcium binding domain 1; serine/threonine-protein phosphatase with EF-hands 1; serine/threonine-protein phosphatase with EF-hands 1-like; similar to Serine/threonine protein phosphatase with EF-hands-1 (PPEF-1) (Protein phosphatase with EF calcium-binding domain) (PPEF) (Serine/threonine protein phosphatase 7) (PP7)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	37,803,204 - 37,960,378 (+)	NCBI		GRCr8
mRatBN7.2	X	33,994,503 - 34,151,704 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	34,021,350 - 34,151,701 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	35,194,826 - 35,309,125 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	38,656,656 - 38,770,959 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	36,331,981 - 36,446,278 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	35,822,687 - 35,947,690 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	35,869,538 - 35,947,282 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	36,142,176 - 36,270,449 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	55,347,219 - 55,436,212 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	X	34,715,653 - 34,830,012 (+)	NCBI		Celera
Cytogenetic Map	X	q14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppef1	Rat	autistic disorder		ISO	PPEF1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106 and PMID:30208311
Ppef1	Rat	Coffin-Lowry syndrome		ISO	PPEF1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Coffin-Lowry syndrome	ClinVar	PMID:10679936 more ...
Ppef1	Rat	developmental and epileptic encephalopathy 2		ISO	PPEF1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy and 2	ClinVar	PMID:10679936 more ...
Ppef1	Rat	glycogen storage disease IXA		ISO	PPEF1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Glycogen storage disease IXa1	ClinVar	PMID:17304053 more ...
Ppef1	Rat	Nance-Horan syndrome		ISO	PPEF1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Nance-Horan syndrome	ClinVar	PMID:10679936 more ...
Ppef1	Rat	Neurodevelopmental Disorders		ISO	PPEF1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Ppef1	Rat	Pyruvate Dehydrogenase E1 Alpha Deficiency		ISO	PPEF1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Pyruvate dehydrogenase E1-alpha deficiency	ClinVar	PMID:10679936 more ...
Ppef1	Rat	syndromic X-linked intellectual disability Lubs type		ISO	PPEF1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Syndromic X-linked intellectual disability Lubs type	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppef1	Rat	1-naphthyl isothiocyanate	increases expression	EXP		6480464	1-Naphthylisothiocyanate results in increased expression of PPEF1 mRNA	CTD	PMID:30723492
Ppef1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of PPEF1 mRNA	CTD	PMID:33387578
Ppef1	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of PPEF1 gene	CTD	PMID:35440735
Ppef1	Rat	benzo[a]pyrene	increases mutagenesis	ISO	PPEF1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased mutagenesis of PPEF1 gene	CTD	PMID:25435355
Ppef1	Rat	benzo[a]pyrene	affects methylation	ISO	PPEF1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of PPEF1 exon	CTD	PMID:27901495
Ppef1	Rat	benzo[a]pyrene	decreases methylation	ISO	PPEF1 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of PPEF1 promoter	CTD	PMID:27901495
Ppef1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of PPEF1 mRNA	CTD	PMID:25181051
Ppef1	Rat	bisphenol A	decreases methylation	ISO	PPEF1 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of PPEF1 gene	CTD	PMID:31601247
Ppef1	Rat	cadmium dichloride	decreases expression	ISO	PPEF1 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of PPEF1 mRNA	CTD	PMID:38382870
Ppef1	Rat	carbamazepine	affects expression	ISO	PPEF1 (Homo sapiens)	6480464	Carbamazepine affects the expression of PPEF1 mRNA	CTD	PMID:25979313
Ppef1	Rat	dibromine	increases expression	EXP		6480464	Bromine results in increased expression of PPEF1 protein	CTD	PMID:32979061
Ppef1	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of PPEF1 mRNA	CTD	PMID:29391264
Ppef1	Rat	entinostat	increases expression	ISO	PPEF1 (Homo sapiens)	6480464	entinostat results in increased expression of PPEF1 mRNA	CTD	PMID:27188386
Ppef1	Rat	epoxiconazole	increases expression	ISO	Ppef1 (Mus musculus)	6480464	epoxiconazole results in increased expression of PPEF1 mRNA	CTD	PMID:35436446
Ppef1	Rat	ethylparaben	decreases expression	ISO	PPEF1 (Homo sapiens)	6480464	ethyl-p-hydroxybenzoate results in decreased expression of PPEF1 mRNA	CTD	PMID:37690743
Ppef1	Rat	genistein	decreases expression	ISO	Ppef1 (Mus musculus)	6480464	Genistein results in decreased expression of PPEF1 mRNA	CTD	PMID:32186404
Ppef1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of PPEF1 mRNA	CTD	PMID:33387578
Ppef1	Rat	lead diacetate	increases expression	EXP		6480464	lead acetate results in increased expression of PPEF1 mRNA	CTD	PMID:11578147
Ppef1	Rat	Licochalcone B	decreases expression	ISO	PPEF1 (Homo sapiens)	6480464	licochalcone B results in decreased expression of PPEF1 mRNA	CTD	PMID:33647349
Ppef1	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of PPEF1 mRNA	CTD	PMID:33387578
Ppef1	Rat	permethrin	increases expression	ISO	PPEF1 (Homo sapiens)	6480464	Permethrin results in increased expression of PPEF1 mRNA	CTD	PMID:37047231
Ppef1	Rat	propanal	increases expression	ISO	PPEF1 (Homo sapiens)	6480464	propionaldehyde results in increased expression of PPEF1 mRNA	CTD	PMID:26079696
Ppef1	Rat	thapsigargin	decreases expression	ISO	PPEF1 (Homo sapiens)	6480464	Thapsigargin results in decreased expression of PPEF1 mRNA	CTD	PMID:22378314
Ppef1	Rat	thapsigargin	increases expression	ISO	PPEF1 (Homo sapiens)	6480464	Thapsigargin results in increased expression of PPEF1 mRNA	CTD	PMID:29453283
Ppef1	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of PPEF1 mRNA	CTD	PMID:33387578
Ppef1	Rat	triptonide	increases expression	ISO	Ppef1 (Mus musculus)	6480464	triptonide results in increased expression of PPEF1 mRNA	CTD	PMID:33045310
Ppef1	Rat	tunicamycin	decreases expression	ISO	PPEF1 (Homo sapiens)	6480464	Tunicamycin results in decreased expression of PPEF1 mRNA	CTD	PMID:22378314
Ppef1	Rat	vinclozolin	increases methylation	EXP		6480464	vinclozolin results in increased methylation of PPEF1 gene	CTD	PMID:31682807

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppef1	Rat	detection of stimulus involved in sensory perception	involved_in	IEA	InterPro:IPR012008	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ppef1	Rat	detection of stimulus involved in sensory perception	involved_in	IEA	UniRule:UR000925795	1600115	GO_REF:0000104	UniProt	GO_REF:0000104

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppef1	Rat	cytosol	is_active_in	IBA	MGI:102666 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ppef1	Rat	nucleus	is_active_in	IBA	FB:FBgn0005777 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppef1	Rat	calcium ion binding	enables	IEA	InterPro:IPR002048 and InterPro:IPR012008	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ppef1	Rat	calcium ion binding	enables	IEA	UniRule:UR000925795	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Ppef1	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ppef1	Rat	hydrolase activity	enables	IEA	InterPro:IPR004843 and InterPro:IPR006186	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ppef1	Rat	iron ion binding	enables	IEA	UniRule:UR000925795	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Ppef1	Rat	iron ion binding	enables	IEA	InterPro:IPR012008	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ppef1	Rat	manganese ion binding	enables	IEA	UniRule:UR000925795	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Ppef1	Rat	manganese ion binding	enables	IEA	InterPro:IPR012008	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ppef1	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ppef1	Rat	phosphoprotein phosphatase activity	enables	IEA	UniProtKB-KW:KW-0904	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ppef1	Rat	phosphoprotein phosphatase activity	enables	IEA	InterPro:IPR012008	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ppef1	Rat	protein binding	enables	ISO	PPEF1 (Homo sapiens)	1624291	UniProtKB:O43865 more ...	RGD	PMID:32814053
Ppef1	Rat	protein serine/threonine phosphatase activity	enables	IEA	RHEA:20629 and RHEA:47004	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Ppef1	Rat	protein serine/threonine phosphatase activity	enables	IEA	EC:3.1.3.16	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Ppef1	Rat	protein serine/threonine phosphatase activity	enables	IBA	FB:FBgn0265959 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Ppef1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	37,803,204 - 37,960,378 (+)	NCBI		GRCr8
mRatBN7.2	X	33,994,503 - 34,151,704 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	34,021,350 - 34,151,701 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	35,194,826 - 35,309,125 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	38,656,656 - 38,770,959 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	36,331,981 - 36,446,278 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	35,822,687 - 35,947,690 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	35,869,538 - 35,947,282 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	36,142,176 - 36,270,449 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	55,347,219 - 55,436,212 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	X	34,715,653 - 34,830,012 (+)	NCBI		Celera
Cytogenetic Map	X	q14	NCBI

PPEF1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	18,675,067 - 18,827,917 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	18,675,909 - 18,827,921 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	18,693,187 - 18,846,035 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	18,618,966 - 18,755,956 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	X	22,829,137 - 22,966,124 (+)	NCBI		Celera
Cytogenetic Map	X	p22.13	NCBI
HuRef	X	16,462,688 - 16,598,790 (+)	NCBI		HuRef
CHM1_1	X	18,740,148 - 18,877,076 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	X	18,257,672 - 18,410,535 (+)	NCBI		T2T-CHM13v2.0

Ppef1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	159,404,997 - 159,534,286 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	159,406,090 - 159,518,761 (-)	Ensembl		GRCm39 Ensembl
GRCm38	X	160,622,419 - 160,751,290 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	160,623,094 - 160,735,765 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	X	157,061,026 - 157,157,904 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	X	155,967,609 - 156,038,528 (-)	NCBI		MGSCv36	mm8
Celera	X	143,864,055 - 143,960,973 (-)	NCBI		Celera
Cytogenetic Map	X	F4	NCBI
cM Map	X	73.95	NCBI

Ppef1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955586	597,164 - 760,136 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955586	597,620 - 761,433 (-)	NCBI	ChiLan1.0	ChiLan1.0

PPEF1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	20,471,844 - 20,625,418 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	20,475,230 - 20,628,811 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	11,311,905 - 11,448,676 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	18,675,714 - 18,812,412 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	18,675,714 - 18,812,412 (+)	Ensembl	panpan1.1		panPan2

PPEF1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	14,752,768 - 14,876,297 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	14,760,452 - 14,875,997 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
ROS_Cfam_1.0	X	14,719,061 - 14,842,205 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	14,726,879 - 14,841,905 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	14,779,855 - 14,902,913 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	14,773,051 - 14,900,714 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	14,836,884 - 14,960,026 (+)	NCBI		UU_Cfam_GSD_1.0

Ppef1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	7,827,299 - 7,954,506 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936844	318,367 - 445,183 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936844	316,889 - 444,043 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PPEF1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	15,138,350 - 15,251,228 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	X	15,111,230 - 15,251,415 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	16,319,828 - 16,459,831 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PPEF1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	17,130,694 - 17,265,097 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	17,175,007 - 17,264,701 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666056	19,024,759 - 19,157,194 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ppef1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624829	3,537,840 - 3,666,725 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624829	3,520,439 - 3,666,568 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ppef1
1146 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	191
Count of miRNA genes:	145
Interacting mature miRNAs:	162
Transcripts:	ENSRNOT00000058947
Prediction methods:	Microtar, Miranda, Pita, Pita,Targetscan, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1598873	Memor2	Memory QTL 2	2.5		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	X	20990947	41052531	Rat
1298071	Edpm12	Estrogen-dependent pituitary mass QTL 12	3.2		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	X	2927898	47927898	Rat
2290375	Gluco34	Glucose level QTL 34	2.75		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	X	20990947	41203591	Rat
731181	Uae27	Urinary albumin excretion QTL 27	2.7	0.0059	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	X	1	43491017	Rat
61430	Cia18	Collagen induced arthritis QTL 18	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	X	14843113	120568734	Rat
10755455	Coatc13	Coat color QTL 13		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	4406000	49406000	Rat
631666	Iddm5	Insulin dependent diabetes mellitus QTL 5			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	X	4494549	49494549	Rat
71116	Niddm16	Non-insulin dependent diabetes mellitus QTL 16	7.81		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	X	15297802	60297802	Rat

DXRat125

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	34,150,505 - 34,150,752 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	35,946,493 - 35,946,740	NCBI	Rnor6.0
Rnor_5.0	X	36,269,252 - 36,269,499	UniSTS	Rnor5.0
Celera	X	34,828,813 - 34,829,060	UniSTS
SHRSP x BN Map	X	13.77	RGD
SHRSP x BN Map	X	13.77	UniSTS
Cytogenetic Map	X	q21	UniSTS

DXGot173

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	X	37,959,198 - 37,959,426 (+)	Marker Load Pipeline
mRatBN7.2	X	34,150,525 - 34,150,752 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	35,946,513 - 35,946,740	NCBI	Rnor6.0
Rnor_5.0	X	36,269,272 - 36,269,499	UniSTS	Rnor5.0
Celera	X	34,828,833 - 34,829,060	UniSTS
Cytogenetic Map	X	q21	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	7	44	111	71	71	40	25	40	6	184	87	91	44	59	31


RefSeq Transcripts	NM_001034935	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434223	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434224	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434225	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039099837	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039099839	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039099840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063280083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063280084	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC104696	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473966	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000058947 ⟹ ENSRNOP00000055729

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	34,035,279 - 34,151,701 (+)	Ensembl
Rnor_6.0 Ensembl	X	35,869,538 - 35,947,282 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094755 ⟹ ENSRNOP00000095819

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	34,021,350 - 34,151,701 (+)	Ensembl

RefSeq Acc Id:

NM_001034935 ⟹ NP_001030107

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	37,843,965 - 37,960,378 (+)	NCBI
mRatBN7.2	X	34,035,279 - 34,151,704 (+)	NCBI
Rnor_6.0	X	35,822,687 - 35,947,690 (+)	NCBI
Rnor_5.0	X	36,142,176 - 36,270,449 (+)	NCBI
Celera	X	34,715,653 - 34,830,012 (+)	RGD

Sequence:

show sequence

CTGCACTGGCCGAGCAGAAGGCACAGTATCTATGGACTGAAGGGAATCGGTTGAGTGGCTTCTTGAAGCACAAAGGGAGGGAATTCACACTCTCACTGAGAACCAGAAGTTGAATTTGTCAGCATATA
TGCTTTAGAAGCCATGGGCTGTGGCAGTTCTTCAAAAAAAGGCAAGAAATCTGAGAAAGTGGTGAGAGCTGCATTAATCATCCAAAATTGGTACCGACGGTACAGAGCTCGACTGAGCGCCAGACAAC
ATTATGCCCTCGCCATCTTCCAGTCTATCGAATATGCTGACGAGCAAGGCCAGATGCAGCTATCCAGCTTCTTTTCTTTCATGTTGGAAAACTATACAAACACACACAAGGAAGATTCAGCATTAGTA
AGTCGACTTTTTGAAAACACCAGGCTCGAAAGCAAGGACAGAGAGGAATACGTGGGATTGATAGATGTGCCTGACTCCTATGACGGTCCTCGTCTGCAGTTTCCTCTCACGTTTACTGACATCAATTT
ACTTCTTCAGGCCTTCAAGCAACAGCAGACACTTCATGCTCACTATGTCTTAGAGGTGCTATTTGAAGCCAGGAAAATCCTGAAGCAGATGCCGAATTTCACTCGCATACAAACCTTTCCCGCCAAAG
AAATAACAATCTGTGGTGATTTGCATGGGAAACTGGATGATCTTATGTTAATTTTCTATAAGAATGGCCTGCCTTCAGAGAAGAATCCATATGTGTTTAATGGTGATTTTGTAGATCGAGGAAACAAT
TCCATGGAGATCCTAATGATCCTGCTTGTTAGTTTTCTTGTCTACCCCACTGACCTGCACCTCAATAGAGGGAACCATGAAGACTTTATGATGAACCTGAGGTATGGCTTCACAAAAGAAATCTTACA
GAAATACAAGCTACATGGGAAAAAAATCTTACAAGTCTTGGAAGAACTCTATACCTGGCTCCCAATTGGTACAATTATTGACAATGAAATCCTGGTCATACATGGTGGGATATCAGAATCCACGGACT
TGAATATACTCCAGCAACTACAGAGAAATAAAATGAAGTCTGTGTTAATGCCACCAATGTCAACAAATCAGGAATGTAACATAAAGAAAAATAAAGCAGGGCCGAGCGAACAGTCTGCTTCTGAACAG
TTGACAAAGCTGGAATGGGAACAGATTATTGACCTTCTGTGGAGTGACCCCAGAGGCAAAAAAGGCTGTTATCCAAACACAAGCCGAGGAGGCGGCTGCTATTTTGGACCAGATGTTACCTCTAAGGT
TCTTAATAAAAACCAGTTGAAGATGGTCATTCGGTCTCATGAGTGTAAACCTGATGGGTATGAAATCTGTCATGATGGAAAGGTCATTACTGTATTTTCTGCTTCTAATTATTATGAAGAAGGCAGCA
ACCGAGGAGCTTACATCAGACTAAGTTATGGTACATCTCCACAATTTTTCCAGTACCAAGTGACTAGTACATCATGCCTGAACCCTCTTTACCAAAGGGTGAATGCTATGGAATTCAGTGCCTTCAGG
ATACTAAAGGAAAGAATGATTGCAAGAAAAACTGACCTTATCAATGCTTTTGAGCTCCGAGATCACAGTAGGACAGGAAAGATTTCATTGGCCCAGTGGGCTTTTTCTATGGAGAGCATTTTGGGGCT
GAACTTACCGTGGAGATCTCTGAGTTCGCATCTGGTAAGCACTGACTCCAGCGGAAGCGTCGACTACATGTCCAGCTTTGATGACATCCACATTGAGAAGCCGATGAAAGATATGAAGTCTGATCTCA
TTGAAACTATGTACAGATACCGATCTGACCTGAAAATCATATTTAATATCATCGACACCGATCAGTCAGGTCTGATCTCCATGGATGAATTCCGGACCATGTGGAAACTTTTCAATGCTCATTACAAA
GTTCATATTGATGATTCCCAAATTGATGAGCTTGCCAGCACAATGGACTCCAACAAAGATGGCAACATAGACTTTAACGAGTTTTTAAGGGCTTTCTATGTAGTCCATAAATACGAGACGCCAGAGAG
CCCTTTGAACAAATGAGAGAGCTTAGCATGAACAAAACCTTCTCCCAGCCCCCTTGAAAACAGCTGACCTCAACTCTCGGCCTTAACAAGAGCCCTTGAAACTCATAGTAGTAGAGAAAAGTAGATCC
TAATTCGCACCATAAGTAGATGCACAGTGTGAGTGTTGGCAGGCTTTAGCGAACTGCTATTGGTAAGACTATGTTAAATATCAGTTGATGAGATTCACTTCCATTGCCAGTGATAAACTGGGTTTGAG
CCTGGGGCTGGTCTCAGATGACACCTAACCATGAGACCAGAGAAATTTAGAAGCATATTCAAAGGAACCCAGAGAGCAGGAAGAGAAATCAATAGGTGTAATATCTGTGAGTGACTGAGGATGAGGTG
AATACTAAACTATTGTTGAAATAAAGTATTTCCATCATCAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039099837 ⟹ XP_038955765

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	37,830,033 - 37,960,378 (+)	NCBI
mRatBN7.2	X	34,021,355 - 34,151,704 (+)	NCBI

RefSeq Acc Id:

XM_039099839 ⟹ XP_038955767

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	37,830,043 - 37,960,378 (+)	NCBI
mRatBN7.2	X	34,021,355 - 34,151,704 (+)	NCBI

RefSeq Acc Id:

XM_039099840 ⟹ XP_038955768

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	37,830,033 - 37,960,378 (+)	NCBI
mRatBN7.2	X	34,021,356 - 34,151,704 (+)	NCBI

RefSeq Acc Id:

XM_063280083 ⟹ XP_063136153

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	37,803,204 - 37,960,378 (+)	NCBI

RefSeq Acc Id:

XM_063280084 ⟹ XP_063136154

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	37,830,043 - 37,960,378 (+)	NCBI


Protein RefSeqs	NP_001030107	(Get FASTA)	NCBI Sequence Viewer
	NP_001421152	(Get FASTA)	NCBI Sequence Viewer
	NP_001421153	(Get FASTA)	NCBI Sequence Viewer
	NP_001421154	(Get FASTA)	NCBI Sequence Viewer
	XP_038955765	(Get FASTA)	NCBI Sequence Viewer
	XP_038955767	(Get FASTA)	NCBI Sequence Viewer
	XP_038955768	(Get FASTA)	NCBI Sequence Viewer
	XP_063136153	(Get FASTA)	NCBI Sequence Viewer
	XP_063136154	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI04697	(Get FASTA)	NCBI Sequence Viewer
	EDL96154	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000055729
	ENSRNOP00000055729.5
	ENSRNOP00000095819
GenBank Protein	Q3SWT6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001030107 ⟸ NM_001034935

- UniProtKB:

Q3SWT6 (UniProtKB/Swiss-Prot), F1LNH9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGCGSSSKKGKKSEKVVRAALIIQNWYRRYRARLSARQHYALAIFQSIEYADEQGQMQLSSFFSFMLENYTNTHKEDSALVSRLFENTRLESKDREEYVGLIDVPDSYDGPRLQFPLTFTDINLLLQA
FKQQQTLHAHYVLEVLFEARKILKQMPNFTRIQTFPAKEITICGDLHGKLDDLMLIFYKNGLPSEKNPYVFNGDFVDRGNNSMEILMILLVSFLVYPTDLHLNRGNHEDFMMNLRYGFTKEILQKYKL
HGKKILQVLEELYTWLPIGTIIDNEILVIHGGISESTDLNILQQLQRNKMKSVLMPPMSTNQECNIKKNKAGPSEQSASEQLTKLEWEQIIDLLWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLNKN
QLKMVIRSHECKPDGYEICHDGKVITVFSASNYYEEGSNRGAYIRLSYGTSPQFFQYQVTSTSCLNPLYQRVNAMEFSAFRILKERMIARKTDLINAFELRDHSRTGKISLAQWAFSMESILGLNLPW
RSLSSHLVSTDSSGSVDYMSSFDDIHIEKPMKDMKSDLIETMYRYRSDLKIIFNIIDTDQSGLISMDEFRTMWKLFNAHYKVHIDDSQIDELASTMDSNKDGNIDFNEFLRAFYVVHKYETPESPLNK

hide sequence

Ensembl Acc Id:

ENSRNOP00000055729 ⟸ ENSRNOT00000058947

RefSeq Acc Id:	XP_038955765 ⟸ XM_039099837
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038955767 ⟸ XM_039099839
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038955768 ⟸ XM_039099840
- Peptide Label:	isoform X2

Protein Domains

EF-hand IQ

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3SWT6-F1-model_v2	AlphaFold	Q3SWT6	1-640	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-2507	BioCyc
Ensembl Genes	ENSRNOG00000027331	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000058947	ENTREZGENE
	ENSRNOT00000058947.5	UniProtKB/Swiss-Prot
	ENSRNOT00000094755	ENTREZGENE
Gene3D-CATH	3.60.21.10	UniProtKB/Swiss-Prot
	EF-hand	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7112183	IMAGE-MGC_LOAD
InterPro	Calcineurin-like_PHP_ApaH	UniProtKB/Swiss-Prot
	EF-hand-dom_pair	UniProtKB/Swiss-Prot
	EF_Hand_1_Ca_BS	UniProtKB/Swiss-Prot
	EF_hand_dom	UniProtKB/Swiss-Prot
	Metallo-depent_PP-like	UniProtKB/Swiss-Prot
	PPP_dom	UniProtKB/Swiss-Prot
	PPP_phosphatase	UniProtKB/Swiss-Prot
	Ser/Thr-Pase_EF-hand_contain	UniProtKB/Swiss-Prot
	Ser/Thr-sp_prot-phosphatase	UniProtKB/Swiss-Prot
KEGG Report	rno:317498	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:125115	IMAGE-MGC_LOAD
NCBI Gene	317498	ENTREZGENE
PANTHER	SERINE/THREONINE-PROTEIN PHOSPHATASE 5-RELATED	UniProtKB/Swiss-Prot
	SERINE/THREONINE-PROTEIN PHOSPHATASE WITH EF-HANDS 1	UniProtKB/Swiss-Prot
Pfam	EF-hand_7	UniProtKB/Swiss-Prot
	Metallophos	UniProtKB/Swiss-Prot
	PPP5	UniProtKB/Swiss-Prot
PhenoGen	Ppef1	PhenoGen
PIRSF	PPEF	UniProtKB/Swiss-Prot
PRINTS	STPHPHTASE	UniProtKB/Swiss-Prot
PROSITE	EF_HAND_1	UniProtKB/Swiss-Prot
	EF_HAND_2	UniProtKB/Swiss-Prot
	SER_THR_PHOSPHATASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000027331	RatGTEx
SMART	EFh	UniProtKB/Swiss-Prot
	PP2Ac	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47473	UniProtKB/Swiss-Prot
	SSF56300	UniProtKB/Swiss-Prot
UniProt	A0A8I6B3D3	ENTREZGENE, UniProtKB/TrEMBL
	A6IPK9_RAT	UniProtKB/TrEMBL
	F1LNH9	ENTREZGENE, UniProtKB/TrEMBL
	PPE1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-01	Ppef1	protein phosphatase with EF-hand domain 1	Ppef1	protein phosphatase, EF-hand calcium binding domain 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-05-24	Ppef1	protein phosphatase, EF-hand calcium binding domain 1	LOC100363004	serine/threonine-protein phosphatase with EF-hands 1-like	Data merged from RGD:2323591	1643240	APPROVED
2010-05-06	LOC100363004	serine/threonine-protein phosphatase with EF-hands 1-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-09-24	Ppef1	protein phosphatase, EF-hand calcium binding domain 1	Ppef1	protein phosphatase with EF hand calcium-binding domain 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Ppef1	protein phosphatase with EF hand calcium-binding domain 1	LOC317498	similar to Serine/threonine protein phosphatase with EF-hands-1 (PPEF-1) (Protein phosphatase with EF calcium-binding domain) (PPEF) (Serine/threonine protein phosphatase 7) (PP7)	Symbol and Name updated	1299863	APPROVED
2006-02-09	LOC317498	similar to Serine/threonine protein phosphatase with EF-hands-1 (PPEF-1) (Protein phosphatase with EF calcium-binding domain) (PPEF) (Serine/threonine protein phosphatase 7) (PP7)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar