Symbol:
Gse1
Name:
Gse1 coiled-coil protein
RGD ID:
1562686
Description:
Human ortholog(s) of this gene implicated in stomach cancer. Orthologous to human GSE1 (Gse1 coiled-coil protein); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
genetic suppressor element 1; LOC307913; RGD1562686; similar to genetic suppressor element 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GSE1 (Gse1 coiled-coil protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Gse1 (genetic suppressor element 1, coiled-coil protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gse1 (Gse1 coiled-coil protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GSE1 (Gse1 coiled-coil protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GSE1 (Gse1 coiled-coil protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gse1 (Gse1 coiled-coil protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GSE1 (Gse1 coiled-coil protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GSE1 (Gse1 coiled-coil protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gse1 (Gse1 coiled-coil protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
RHOBTB2 (Rho related BTB domain containing 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
GSE1 (Gse1 coiled-coil protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Gse1 (genetic suppressor element 1, coiled-coil protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gse1 (Gse1 coiled-coil protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gse1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 65,182,678 - 65,538,183 (+) NCBI GRCr8 mRatBN7.2 19 48,274,164 - 48,629,456 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 48,274,127 - 48,629,458 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 19 53,799,945 - 54,153,732 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 54,060,622 - 54,148,970 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 64,529,034 - 64,876,612 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 50,874,475 - 50,916,263 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 19 47,529,902 - 47,883,061 (+) NCBI Celera Cytogenetic Map 19 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gse1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of GSE1 mRNA] CTD PMID:31150632 Gse1 Rat 17beta-estradiol increases expression ISO GSE1 (Homo sapiens) 6480464 Estradiol results in increased expression of GSE1 mRNA CTD PMID:23019147 Gse1 Rat 17beta-estradiol increases expression ISO Gse1 (Mus musculus) 6480464 Estradiol results in increased expression of GSE1 mRNA CTD PMID:39298647 Gse1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of GSE1 mRNA CTD PMID:32145629 Gse1 Rat 17beta-estradiol multiple interactions ISO GSE1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of GSE1 mRNA CTD PMID:30165855 Gse1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Gse1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GSE1 mRNA CTD PMID:21570461 and PMID:24680724 Gse1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of GSE1 mRNA CTD PMID:33387578 Gse1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GSE1 mRNA CTD PMID:34747641 Gse1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO GSE1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GSE1 mRNA CTD PMID:20106945 more ... Gse1 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of GSE1 mRNA CTD PMID:19162173 Gse1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Gse1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of GSE1 mRNA CTD PMID:18648102 Gse1 Rat 4,4'-sulfonyldiphenol increases methylation ISO Gse1 (Mus musculus) 6480464 bisphenol S results in increased methylation of GSE1 exon CTD PMID:33297965 Gse1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Gse1 (Mus musculus) 6480464 bisphenol S affects the methylation of GSE1 gene CTD PMID:31683443 Gse1 Rat 4-hydroxyphenyl retinamide increases expression ISO Gse1 (Mus musculus) 6480464 Fenretinide results in increased expression of GSE1 mRNA CTD PMID:28973697 Gse1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of GSE1 mRNA CTD PMID:30047161 Gse1 Rat acrolein multiple interactions ISO GSE1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of GSE1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of GSE1 mRNA CTD PMID:32699268 Gse1 Rat aflatoxin B1 increases methylation ISO GSE1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of GSE1 intron CTD PMID:30157460 Gse1 Rat all-trans-retinoic acid increases expression ISO Gse1 (Mus musculus) 6480464 Tretinoin results in increased expression of GSE1 mRNA CTD PMID:16169686 Gse1 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of GSE1 mRNA CTD PMID:20488242 Gse1 Rat all-trans-retinoic acid increases expression ISO GSE1 (Homo sapiens) 6480464 Tretinoin results in increased expression of GSE1 mRNA CTD PMID:21934132 and PMID:33167477 Gse1 Rat alpha-pinene multiple interactions ISO GSE1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of GSE1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of GSE1 mRNA CTD PMID:32699268 Gse1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of GSE1 mRNA CTD PMID:30047161 Gse1 Rat arsane affects methylation ISO GSE1 (Homo sapiens) 6480464 Arsenic affects the methylation of GSE1 gene CTD PMID:25304211 Gse1 Rat arsenic atom affects methylation ISO GSE1 (Homo sapiens) 6480464 Arsenic affects the methylation of GSE1 gene CTD PMID:25304211 Gse1 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of GSE1 gene CTD PMID:35440735 Gse1 Rat benzo[a]pyrene decreases expression ISO Gse1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of GSE1 mRNA CTD PMID:20713471 Gse1 Rat benzo[a]pyrene affects methylation ISO GSE1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GSE1 5' UTR and Benzo(a)pyrene affects the methylation of GSE1 intron CTD PMID:27901495 and PMID:30157460 Gse1 Rat benzo[a]pyrene decreases expression ISO GSE1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of GSE1 mRNA CTD PMID:22316170 and PMID:26238291 Gse1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GSE1 mRNA CTD PMID:25181051 Gse1 Rat bisphenol A increases expression ISO Gse1 (Mus musculus) 6480464 bisphenol A results in increased expression of GSE1 mRNA CTD PMID:32156529 Gse1 Rat bisphenol A decreases expression ISO Gse1 (Mus musculus) 6480464 bisphenol A results in decreased expression of GSE1 mRNA CTD PMID:33221593 Gse1 Rat bisphenol A increases expression ISO GSE1 (Homo sapiens) 6480464 bisphenol A results in increased expression of GSE1 mRNA CTD PMID:29275510 Gse1 Rat bisphenol A decreases methylation ISO Gse1 (Mus musculus) 6480464 bisphenol A results in decreased methylation of GSE1 promoter CTD PMID:27312807 Gse1 Rat buta-1,3-diene decreases expression ISO Gse1 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of GSE1 mRNA CTD PMID:29038090 Gse1 Rat caffeine decreases phosphorylation ISO GSE1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of GSE1 protein CTD PMID:35688186 Gse1 Rat cannabidiol decreases methylation ISO Gse1 (Mus musculus) 6480464 Cannabidiol results in decreased methylation of GSE1 gene CTD PMID:33407853 Gse1 Rat choline multiple interactions ISO Gse1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of GSE1 gene CTD PMID:20938992 Gse1 Rat ciguatoxin CTX1B affects expression ISO Gse1 (Mus musculus) 6480464 Ciguatoxins affects the expression of GSE1 mRNA CTD PMID:18353800 Gse1 Rat cisplatin decreases expression ISO GSE1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of GSE1 mRNA CTD PMID:27594783 Gse1 Rat clotrimazole decreases expression EXP 6480464 Clotrimazole results in decreased expression of GSE1 mRNA CTD PMID:30047161 Gse1 Rat copper(II) sulfate increases expression ISO GSE1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of GSE1 mRNA CTD PMID:19549813 Gse1 Rat coumarin increases phosphorylation ISO GSE1 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of GSE1 protein CTD PMID:35688186 Gse1 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of GSE1 mRNA CTD PMID:23640034 and PMID:23914054 Gse1 Rat diazinon increases methylation ISO GSE1 (Homo sapiens) 6480464 Diazinon results in increased methylation of GSE1 gene CTD PMID:22964155 Gse1 Rat Dibutyl phosphate affects expression ISO GSE1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of GSE1 mRNA CTD PMID:37042841 Gse1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of GSE1 mRNA CTD PMID:21266533 Gse1 Rat dicrotophos increases expression ISO GSE1 (Homo sapiens) 6480464 dicrotophos results in increased expression of GSE1 mRNA CTD PMID:28302478 Gse1 Rat dioxygen increases expression ISO Gse1 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of GSE1 mRNA CTD PMID:24205000 Gse1 Rat dioxygen affects methylation ISO Gse1 (Mus musculus) 6480464 Oxygen deficiency affects the methylation of GSE1 promoter CTD PMID:24205000 Gse1 Rat dorsomorphin multiple interactions ISO GSE1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Gse1 Rat doxorubicin decreases expression ISO GSE1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of GSE1 mRNA CTD PMID:29803840 Gse1 Rat entinostat multiple interactions ISO GSE1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GSE1 mRNA CTD PMID:27188386 Gse1 Rat entinostat increases expression ISO GSE1 (Homo sapiens) 6480464 entinostat results in increased expression of GSE1 mRNA CTD PMID:26272509 Gse1 Rat ethanol affects splicing ISO Gse1 (Mus musculus) 6480464 Ethanol affects the splicing of GSE1 mRNA CTD PMID:30319688 Gse1 Rat ethanol increases expression ISO Gse1 (Mus musculus) 6480464 Ethanol results in increased expression of GSE1 mRNA CTD PMID:30319688 Gse1 Rat folic acid multiple interactions ISO Gse1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of GSE1 gene CTD PMID:20938992 Gse1 Rat FR900359 affects phosphorylation ISO GSE1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of GSE1 protein CTD PMID:37730182 Gse1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of GSE1 mRNA CTD PMID:33387578 Gse1 Rat glyphosate decreases methylation EXP 6480464 Glyphosate results in decreased methylation of GSE1 gene CTD PMID:31011160 Gse1 Rat L-methionine multiple interactions ISO Gse1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of GSE1 gene CTD PMID:20938992 Gse1 Rat lead(0) affects expression ISO GSE1 (Homo sapiens) 6480464 Lead affects the expression of GSE1 mRNA CTD PMID:28903495 Gse1 Rat leflunomide increases expression ISO GSE1 (Homo sapiens) 6480464 leflunomide results in increased expression of GSE1 mRNA CTD PMID:28988120 Gse1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of GSE1 mRNA CTD PMID:30047161 Gse1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of GSE1 gene CTD PMID:35440735 Gse1 Rat methylmercury chloride increases expression ISO GSE1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of GSE1 mRNA CTD PMID:23179753 and PMID:26272509 Gse1 Rat methylmercury chloride multiple interactions ISO GSE1 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GSE1 mRNA CTD PMID:27188386 Gse1 Rat nickel sulfate increases expression ISO GSE1 (Homo sapiens) 6480464 nickel sulfate results in increased expression of GSE1 mRNA CTD PMID:22714537 Gse1 Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of GSE1 mRNA CTD PMID:23665939 Gse1 Rat ozone multiple interactions ISO GSE1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of GSE1 mRNA more ... CTD PMID:32699268 Gse1 Rat paracetamol decreases expression ISO GSE1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of GSE1 mRNA CTD PMID:21420995 Gse1 Rat pirinixic acid increases expression ISO Gse1 (Mus musculus) 6480464 pirinixic acid results in increased expression of GSE1 mRNA CTD PMID:18301758 Gse1 Rat pirinixic acid decreases expression ISO Gse1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of GSE1 mRNA CTD PMID:23811191 Gse1 Rat propiconazole decreases expression EXP 6480464 propiconazole results in decreased expression of GSE1 mRNA CTD PMID:30047161 Gse1 Rat quercetin decreases expression ISO GSE1 (Homo sapiens) 6480464 Quercetin results in decreased expression of GSE1 mRNA CTD PMID:21632981 Gse1 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO GSE1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of GSE1 mRNA CTD PMID:33725128 Gse1 Rat SB 431542 multiple interactions ISO GSE1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Gse1 Rat silver atom decreases expression ISO Gse1 (Mus musculus) 6480464 Silver results in decreased expression of GSE1 mRNA CTD PMID:27131904 Gse1 Rat silver(0) decreases expression ISO Gse1 (Mus musculus) 6480464 Silver results in decreased expression of GSE1 mRNA CTD PMID:27131904 Gse1 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of GSE1 mRNA CTD PMID:19281266 Gse1 Rat sunitinib decreases expression ISO GSE1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of GSE1 mRNA CTD PMID:31533062 Gse1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of GSE1 mRNA] CTD PMID:31150632 Gse1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of GSE1 mRNA CTD PMID:31150632 Gse1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of GSE1 mRNA CTD PMID:23411599 and PMID:34492290 Gse1 Rat titanium dioxide increases methylation ISO Gse1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of GSE1 gene and titanium dioxide results in increased methylation of GSE1 promoter CTD PMID:35295148 Gse1 Rat titanium dioxide decreases methylation ISO Gse1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of GSE1 promoter CTD PMID:35295148 Gse1 Rat triphenyl phosphate affects expression ISO GSE1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GSE1 mRNA CTD PMID:37042841 Gse1 Rat tungsten decreases expression ISO Gse1 (Mus musculus) 6480464 Tungsten results in decreased expression of GSE1 mRNA CTD PMID:30912803 Gse1 Rat valproic acid affects expression ISO GSE1 (Homo sapiens) 6480464 Valproic Acid affects the expression of GSE1 mRNA CTD PMID:25979313 Gse1 Rat valproic acid increases methylation ISO GSE1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of GSE1 gene CTD PMID:29154799 Gse1 Rat vorinostat decreases expression ISO GSE1 (Homo sapiens) 6480464 vorinostat results in decreased expression of GSE1 mRNA CTD PMID:27188386
(+)-schisandrin B (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) alpha-pinene (ISO) amitrole (EXP) arsane (ISO) arsenic atom (ISO) atrazine (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) caffeine (ISO) cannabidiol (ISO) choline (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) clotrimazole (EXP) copper(II) sulfate (ISO) coumarin (ISO) decabromodiphenyl ether (EXP) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (ISO) folic acid (ISO) FR900359 (ISO) gentamycin (EXP) glyphosate (EXP) L-methionine (ISO) lead(0) (ISO) leflunomide (ISO) methimazole (EXP) methoxychlor (EXP) methylmercury chloride (ISO) nickel sulfate (ISO) orphenadrine (EXP) ozone (ISO) paracetamol (ISO) pirinixic acid (ISO) propiconazole (EXP) quercetin (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) Soman (EXP) sunitinib (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) tungsten (ISO) valproic acid (ISO) vorinostat (ISO)
Gse1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 65,182,678 - 65,538,183 (+) NCBI GRCr8 mRatBN7.2 19 48,274,164 - 48,629,456 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 48,274,127 - 48,629,458 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 19 53,799,945 - 54,153,732 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 54,060,622 - 54,148,970 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 64,529,034 - 64,876,612 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 50,874,475 - 50,916,263 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 19 47,529,902 - 47,883,061 (+) NCBI Celera Cytogenetic Map 19 q12 NCBI
GSE1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 85,169,512 - 85,676,200 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 85,169,525 - 85,676,204 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 85,645,015 - 85,709,806 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 84,204,425 - 84,267,313 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 16 69,950,111 - 70,012,922 (+) NCBI Celera Cytogenetic Map 16 q24.1 NCBI HuRef 16 71,388,821 - 71,451,974 (+) NCBI HuRef CHM1_1 16 87,056,381 - 87,121,164 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 91,235,680 - 91,741,713 (+) NCBI T2T-CHM13v2.0
Gse1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 120,955,233 - 121,308,122 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 120,955,195 - 121,308,129 (+) Ensembl GRCm39 Ensembl GRCm38 8 120,228,501 - 120,581,383 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 120,228,456 - 120,581,390 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 123,012,766 - 123,105,283 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 123,374,843 - 123,467,354 (+) NCBI MGSCv36 mm8 Celera 8 124,703,936 - 124,797,008 (+) NCBI Celera Cytogenetic Map 8 E1 NCBI cM Map 8 69.69 NCBI
Gse1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955541 720,458 - 808,174 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955541 517,715 - 808,174 (+) NCBI ChiLan1.0 ChiLan1.0
GSE1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 94,921,665 - 95,423,969 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 100,838,710 - 101,341,245 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 65,838,691 - 66,340,644 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 85,178,960 - 85,680,262 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 85,617,854 - 85,680,262 (+) Ensembl panpan1.1 panPan2
GSE1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 66,997,948 - 67,391,587 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 67,001,022 - 67,180,979 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 67,013,772 - 67,426,986 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 67,225,804 - 67,644,827 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 67,229,422 - 67,447,900 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 67,247,427 - 67,660,851 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 67,081,809 - 67,495,089 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 67,496,368 - 67,910,071 (-) NCBI UU_Cfam_GSD_1.0
Gse1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 27,023,638 - 27,309,824 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936641 2,776,714 - 2,862,484 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936641 2,779,521 - 2,920,840 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GSE1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 3,246,764 - 3,349,122 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 3,244,167 - 3,657,636 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 3,553,241 - 3,612,190 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GSE1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 70,585,176 - 71,087,575 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 70,966,855 - 71,083,912 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 4,653,400 - 4,967,774 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gse1
.
Predicted Target Of
Count of predictions: 50 Count of miRNA genes: 35 Interacting mature miRNAs: 35 Transcripts: ENSRNOT00000023607, ENSRNOT00000068572 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 5135224 Leukc1 Leukocyte quantity QTL 1 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 19 44340214 55283277 Rat 724546 Kidm3 Kidney mass QTL 3 3.1 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 19 29322490 57337602 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 1358200 Insglur2 Insulin/glucose ratio QTL 2 4.1 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 19 33838214 55283146 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat
BE108343
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 48,627,603 - 48,627,794 (+) MAPPER mRatBN7.2 Rnor_6.0 19 54,151,882 - 54,152,072 NCBI Rnor6.0 Rnor_5.0 19 64,874,762 - 64,874,952 UniSTS Rnor5.0 RGSC_v3.4 19 50,915,942 - 50,916,132 UniSTS RGSC3.4 Celera 19 47,881,211 - 47,881,401 UniSTS RH 3.4 Map 19 648.3 UniSTS Cytogenetic Map 19 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000023607 ⟹ ENSRNOP00000023607
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 48,585,961 - 48,629,458 (+) Ensembl Rnor_6.0 Ensembl 19 54,060,622 - 54,148,970 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000094643 ⟹ ENSRNOP00000091424
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 48,274,127 - 48,629,458 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097001 ⟹ ENSRNOP00000084243
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 48,536,103 - 48,629,458 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000108224 ⟹ ENSRNOP00000079149
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 48,535,065 - 48,629,458 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112263 ⟹ ENSRNOP00000093058
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 48,535,065 - 48,629,458 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112924 ⟹ ENSRNOP00000087793
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 48,274,127 - 48,629,458 (+) Ensembl
RefSeq Acc Id:
NM_001427026 ⟹ NP_001413955
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 65,494,660 - 65,538,176 (+) NCBI
RefSeq Acc Id:
XM_017601449 ⟹ XP_017456938
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 65,182,678 - 65,538,183 (+) NCBI mRatBN7.2 19 48,274,379 - 48,629,456 (+) NCBI Rnor_6.0 19 53,799,946 - 54,153,732 (+) NCBI
Sequence:
GCCGGAACCCGAGGATGCGCACGATTCCACCAAGTCTGGAGCCCGGCGCCGGCGCACGGGGTCAGGGGCGCACTGGGCTCCCGAACCGCGGGCCAGCGTGCTAAGGGGCATCCAGGAGCCCTGGCCCA
hide sequence
RefSeq Acc Id:
XP_017456938 ⟸ XM_017601449
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AG34 (UniProtKB/TrEMBL), A0A8I6A4U2 (UniProtKB/TrEMBL)
- Sequence:
MASKARRLPREEGPAPTAGLLREACYLCGEDCTRDARAVPSRLVNGNSGGSMHFPFLSLLPCPPNARPPNKRCEVRSCPKCFSVLEDVWALYRASHNRELISSVQGFLGRYHQAFSASDPTLSELPTS
hide sequence
Ensembl Acc Id:
ENSRNOP00000023607 ⟸ ENSRNOT00000023607
Ensembl Acc Id:
ENSRNOP00000087793 ⟸ ENSRNOT00000112924
Ensembl Acc Id:
ENSRNOP00000079149 ⟸ ENSRNOT00000108224
Ensembl Acc Id:
ENSRNOP00000093058 ⟸ ENSRNOT00000112263
Ensembl Acc Id:
ENSRNOP00000091424 ⟸ ENSRNOT00000094643
Ensembl Acc Id:
ENSRNOP00000084243 ⟸ ENSRNOT00000097001
RefSeq Acc Id:
NP_001413955 ⟸ NM_001427026
- UniProtKB:
A6IZM2 (UniProtKB/TrEMBL), F1M4A7 (UniProtKB/TrEMBL), A0A8I5ZMU3 (UniProtKB/TrEMBL)
RGD ID: 13701195 Promoter ID: EPDNEW_R11716 Type: single initiation site Name: Gse1_1 Description: Gse1 coiled-coil protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 54,060,694 - 54,060,754 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-02-22
Gse1
Gse1 coiled-coil protein
Gse1
genetic suppressor element 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-29
Gse1
genetic suppressor element 1
RGD1562686_predicted
similar to genetic suppressor element 1 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1562686_predicted
similar to genetic suppressor element 1 (predicted)
LOC307913
similar to genetic suppressor element 1
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC307913
similar to genetic suppressor element 1
Symbol and Name status set to provisional
70820 PROVISIONAL
